Basic Information | |
---|---|
Family ID | F023759 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 209 |
Average Sequence Length | 39 residues |
Representative Sequence | DHRTDAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA |
Number of Associated Samples | 182 |
Number of Associated Scaffolds | 209 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.44 % |
% of genes near scaffold ends (potentially truncated) | 98.09 % |
% of genes from short scaffolds (< 2000 bps) | 86.60 % |
Associated GOLD sequencing projects | 167 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.474 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.048 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.660 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.589 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 209 Family Scaffolds |
---|---|---|
PF13439 | Glyco_transf_4 | 53.11 |
PF13579 | Glyco_trans_4_4 | 5.74 |
PF00106 | adh_short | 1.91 |
PF13231 | PMT_2 | 1.91 |
PF00034 | Cytochrom_C | 0.96 |
PF01566 | Nramp | 0.96 |
PF12704 | MacB_PCD | 0.96 |
PF00072 | Response_reg | 0.48 |
PF04471 | Mrr_cat | 0.48 |
PF13561 | adh_short_C2 | 0.48 |
PF05016 | ParE_toxin | 0.48 |
PF12680 | SnoaL_2 | 0.48 |
PF07681 | DoxX | 0.48 |
PF01402 | RHH_1 | 0.48 |
PF13620 | CarboxypepD_reg | 0.48 |
PF02368 | Big_2 | 0.48 |
PF08327 | AHSA1 | 0.48 |
PF00464 | SHMT | 0.48 |
PF14281 | PDDEXK_4 | 0.48 |
PF00004 | AAA | 0.48 |
PF05076 | SUFU | 0.48 |
PF00408 | PGM_PMM_IV | 0.48 |
PF13358 | DDE_3 | 0.48 |
PF13683 | rve_3 | 0.48 |
PF02518 | HATPase_c | 0.48 |
PF01370 | Epimerase | 0.48 |
COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
---|---|---|---|
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.96 |
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.48 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.48 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.48 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.48 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.48 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.47 % |
Unclassified | root | N/A | 10.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000953|JGI11615J12901_10368029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300001131|JGI12631J13338_1019677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300001166|JGI12694J13545_1006586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1399 | Open in IMG/M |
3300001175|JGI12649J13570_1011715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
3300001356|JGI12269J14319_10347236 | Not Available | 523 | Open in IMG/M |
3300001471|JGI12712J15308_10150617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300001593|JGI12635J15846_10077975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2431 | Open in IMG/M |
3300001593|JGI12635J15846_10728327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300002075|JGI24738J21930_10038993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 965 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100280578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1552 | Open in IMG/M |
3300004080|Ga0062385_10009715 | All Organisms → cellular organisms → Bacteria | 3225 | Open in IMG/M |
3300004152|Ga0062386_100554816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 936 | Open in IMG/M |
3300004635|Ga0062388_100235942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1476 | Open in IMG/M |
3300004635|Ga0062388_100795795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 895 | Open in IMG/M |
3300004643|Ga0062591_100334531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1213 | Open in IMG/M |
3300005093|Ga0062594_102745503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 546 | Open in IMG/M |
3300005178|Ga0066688_10851885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 566 | Open in IMG/M |
3300005179|Ga0066684_10930661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 565 | Open in IMG/M |
3300005330|Ga0070690_100060501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2437 | Open in IMG/M |
3300005439|Ga0070711_100534039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 971 | Open in IMG/M |
3300005445|Ga0070708_100433220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
3300005447|Ga0066689_10050282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2232 | Open in IMG/M |
3300005471|Ga0070698_100297923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1543 | Open in IMG/M |
3300005537|Ga0070730_10217607 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300005556|Ga0066707_10523392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300005575|Ga0066702_10584256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 672 | Open in IMG/M |
3300005586|Ga0066691_10374323 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300005591|Ga0070761_10143010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1398 | Open in IMG/M |
3300005712|Ga0070764_10355346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
3300005764|Ga0066903_100997021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1530 | Open in IMG/M |
3300005921|Ga0070766_10520028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 792 | Open in IMG/M |
3300005937|Ga0081455_10648331 | Not Available | 680 | Open in IMG/M |
3300005952|Ga0080026_10101306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 803 | Open in IMG/M |
3300006028|Ga0070717_10185546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1815 | Open in IMG/M |
3300006052|Ga0075029_100503070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 800 | Open in IMG/M |
3300006052|Ga0075029_100511219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 794 | Open in IMG/M |
3300006052|Ga0075029_100945035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 593 | Open in IMG/M |
3300006059|Ga0075017_101139439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 610 | Open in IMG/M |
3300006059|Ga0075017_101156485 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300006176|Ga0070765_101360919 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300006237|Ga0097621_100894672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 827 | Open in IMG/M |
3300006237|Ga0097621_101252779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 699 | Open in IMG/M |
3300006354|Ga0075021_10233138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1129 | Open in IMG/M |
3300006871|Ga0075434_101541439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300006881|Ga0068865_100628133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
3300007258|Ga0099793_10369601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
3300007258|Ga0099793_10555042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300009615|Ga0116103_1138322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300009640|Ga0116126_1029983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2293 | Open in IMG/M |
3300009643|Ga0116110_1264735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300009700|Ga0116217_10321833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
3300009700|Ga0116217_10677835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300009792|Ga0126374_10554718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
3300010043|Ga0126380_10416060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300010043|Ga0126380_10478317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
3300010048|Ga0126373_13186745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300010159|Ga0099796_10214961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300010341|Ga0074045_10061587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2679 | Open in IMG/M |
3300010358|Ga0126370_10703567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
3300010361|Ga0126378_13305061 | Not Available | 512 | Open in IMG/M |
3300011087|Ga0138570_1184446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
3300012189|Ga0137388_10881897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
3300012189|Ga0137388_11486063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300012199|Ga0137383_10451559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
3300012206|Ga0137380_11175568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300012353|Ga0137367_10301526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1146 | Open in IMG/M |
3300012356|Ga0137371_11391881 | Not Available | 515 | Open in IMG/M |
3300012357|Ga0137384_11024200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300012357|Ga0137384_11310227 | Not Available | 571 | Open in IMG/M |
3300012361|Ga0137360_11718445 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012363|Ga0137390_10892454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300012683|Ga0137398_10032491 | All Organisms → cellular organisms → Bacteria | 2969 | Open in IMG/M |
3300012683|Ga0137398_10295416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300012923|Ga0137359_10343758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1326 | Open in IMG/M |
3300012944|Ga0137410_12122712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300012964|Ga0153916_11523000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300012971|Ga0126369_11338673 | Not Available | 806 | Open in IMG/M |
3300013297|Ga0157378_11112007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
3300014155|Ga0181524_10045222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2853 | Open in IMG/M |
3300014162|Ga0181538_10142093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
3300015052|Ga0137411_1081460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
3300015193|Ga0167668_1001777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4537 | Open in IMG/M |
3300016294|Ga0182041_11644837 | Not Available | 593 | Open in IMG/M |
3300017932|Ga0187814_10229351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300017933|Ga0187801_10161285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300017934|Ga0187803_10034440 | Not Available | 2011 | Open in IMG/M |
3300017938|Ga0187854_10245333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
3300017941|Ga0187850_10183035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
3300017942|Ga0187808_10593935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300017943|Ga0187819_10055783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2345 | Open in IMG/M |
3300017943|Ga0187819_10876821 | Not Available | 503 | Open in IMG/M |
3300017955|Ga0187817_10729450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300017959|Ga0187779_10028877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3185 | Open in IMG/M |
3300017959|Ga0187779_10337491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
3300017961|Ga0187778_10910585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300017973|Ga0187780_10441339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
3300017975|Ga0187782_10204402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1478 | Open in IMG/M |
3300017975|Ga0187782_11123694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300017998|Ga0187870_1187470 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300017999|Ga0187767_10141256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300018006|Ga0187804_10286617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300018018|Ga0187886_1219123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300018042|Ga0187871_10201445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
3300018058|Ga0187766_11453078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300018062|Ga0187784_10487023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
3300018062|Ga0187784_11328382 | Not Available | 570 | Open in IMG/M |
3300018085|Ga0187772_10355375 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1013 | Open in IMG/M |
3300018086|Ga0187769_11032222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300018088|Ga0187771_10893056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300018088|Ga0187771_11847100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300018089|Ga0187774_11348841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300018090|Ga0187770_10585802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
3300018090|Ga0187770_10836879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300018090|Ga0187770_11506559 | Not Available | 548 | Open in IMG/M |
3300018468|Ga0066662_10240122 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
3300020579|Ga0210407_10401214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
3300021088|Ga0210404_10733920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300021171|Ga0210405_10106746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2210 | Open in IMG/M |
3300021171|Ga0210405_10207369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
3300021171|Ga0210405_11012559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300021377|Ga0213874_10263361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300021407|Ga0210383_11653537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300021420|Ga0210394_10999335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 725 | Open in IMG/M |
3300021474|Ga0210390_10007206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9201 | Open in IMG/M |
3300021475|Ga0210392_11223795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300021477|Ga0210398_10991930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300022724|Ga0242665_10369434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300024178|Ga0247694_1034231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300025469|Ga0208687_1118159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300025576|Ga0208820_1003272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7502 | Open in IMG/M |
3300025711|Ga0207696_1090227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300025898|Ga0207692_10073422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1810 | Open in IMG/M |
3300025912|Ga0207707_10520255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
3300025916|Ga0207663_10034410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 3029 | Open in IMG/M |
3300025929|Ga0207664_10156677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1939 | Open in IMG/M |
3300025938|Ga0207704_10123271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1779 | Open in IMG/M |
3300025945|Ga0207679_10001899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12979 | Open in IMG/M |
3300025986|Ga0207658_12009571 | Not Available | 526 | Open in IMG/M |
3300026067|Ga0207678_10193979 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300026088|Ga0207641_10816996 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300026308|Ga0209265_1120902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300026489|Ga0257160_1015105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
3300026536|Ga0209058_1078405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
3300026552|Ga0209577_10300830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
3300026555|Ga0179593_1154841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2903 | Open in IMG/M |
3300027089|Ga0207943_107393 | Not Available | 698 | Open in IMG/M |
3300027370|Ga0209010_1000321 | All Organisms → cellular organisms → Bacteria | 16131 | Open in IMG/M |
3300027521|Ga0209524_1052288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300027609|Ga0209221_1102013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300027609|Ga0209221_1180761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300027634|Ga0209905_1017620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
3300027678|Ga0209011_1053390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
3300027692|Ga0209530_1008899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3172 | Open in IMG/M |
3300027698|Ga0209446_1184479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300027729|Ga0209248_10035239 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300027737|Ga0209038_10187693 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300027745|Ga0209908_10000109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 5302 | Open in IMG/M |
3300027824|Ga0209040_10514081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300027842|Ga0209580_10437399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300027846|Ga0209180_10107722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1592 | Open in IMG/M |
3300027853|Ga0209274_10333355 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300027857|Ga0209166_10226228 | Not Available | 999 | Open in IMG/M |
3300027867|Ga0209167_10728693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300027869|Ga0209579_10801555 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300027875|Ga0209283_10329997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
3300027889|Ga0209380_10167735 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300027889|Ga0209380_10178617 | Not Available | 1244 | Open in IMG/M |
3300027894|Ga0209068_10104416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
3300027895|Ga0209624_10184720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
3300027895|Ga0209624_10202270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
3300027905|Ga0209415_10812859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300027910|Ga0209583_10088553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
3300028015|Ga0265353_1019030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300028047|Ga0209526_10827446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300028798|Ga0302222_10389350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300028857|Ga0302289_1107402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300028906|Ga0308309_11065294 | Not Available | 699 | Open in IMG/M |
3300029914|Ga0311359_10383842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
3300029918|Ga0302143_1013889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1802 | Open in IMG/M |
3300029952|Ga0311346_10128386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3106 | Open in IMG/M |
3300030000|Ga0311337_11473453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300030005|Ga0302174_10073005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
3300030043|Ga0302306_10250316 | Not Available | 680 | Open in IMG/M |
3300030503|Ga0311370_11608822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300030580|Ga0311355_10828350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
3300030707|Ga0310038_10373177 | Not Available | 626 | Open in IMG/M |
3300030934|Ga0075391_11251867 | Not Available | 694 | Open in IMG/M |
3300030991|Ga0073994_10056362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3463 | Open in IMG/M |
3300031028|Ga0302180_10082226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1872 | Open in IMG/M |
3300031057|Ga0170834_103450006 | Not Available | 614 | Open in IMG/M |
3300031231|Ga0170824_122020698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300031231|Ga0170824_125923223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300031715|Ga0307476_10009316 | All Organisms → cellular organisms → Bacteria | 6081 | Open in IMG/M |
3300031719|Ga0306917_10360604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300031902|Ga0302322_101964067 | Not Available | 718 | Open in IMG/M |
3300031912|Ga0306921_10694279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
3300031964|Ga0311373_10459634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
3300032261|Ga0306920_101453305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
3300032261|Ga0306920_101796915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
3300032783|Ga0335079_10621333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
3300032805|Ga0335078_11995535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300032892|Ga0335081_10179242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2971 | Open in IMG/M |
3300032892|Ga0335081_10287054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2190 | Open in IMG/M |
3300032893|Ga0335069_11191630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
3300032897|Ga0335071_10158980 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
3300032955|Ga0335076_11096456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300033561|Ga0371490_1172801 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300034199|Ga0370514_034050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.05% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.61% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.78% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.35% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.35% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.87% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.87% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.39% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.39% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.39% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.91% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.44% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.44% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.48% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.48% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.48% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.48% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.48% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.48% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.48% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.48% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027089 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015 (SPAdes) | Environmental | Open in IMG/M |
3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028857 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030005 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_2 | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030934 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031964 | III_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11615J12901_103680292 | 3300000953 | Soil | KALRERSDAAVLQSIRRQVFELAEGFPLYAERRAKAQAEARV* |
JGI12631J13338_10196771 | 3300001131 | Forest Soil | GAVLARIRKEVLGLCEEFPLYAERRARAQAEVRA* |
JGI12694J13545_10065861 | 3300001166 | Forest Soil | LLQRNDAAVLARIRKEVLSLCEAFPLYAERRVRAQAEVRA* |
JGI12649J13570_10117152 | 3300001175 | Forest Soil | DALLQRNEGAVLARIRKEVLGLCEEFPLYAERRARAQAEVRA* |
JGI12269J14319_103472361 | 3300001356 | Peatlands Soil | AAVLSRVRQQVLDLAETFPLYPERRARAQAEARA* |
JGI12712J15308_101506171 | 3300001471 | Forest Soil | ASVAGKVRGQVLELCEAFPLYAARRAKAQAEVRA* |
JGI12635J15846_100779755 | 3300001593 | Forest Soil | LLRRTDAAVLKRIRKDVLDLSEAFPLYAERRARAQAEVRA* |
JGI12635J15846_107283272 | 3300001593 | Forest Soil | LQRTDTALLAKVRKQVLELCEAFPLYAERRARAQAEARV* |
JGI24738J21930_100389932 | 3300002075 | Corn Rhizosphere | WISRTLHNRTNAVELGKIRKEVFELAEEFPLYPERRAKAPAEVRV* |
JGIcombinedJ26739_1002805781 | 3300002245 | Forest Soil | WIAEALNHRRDAAVLEKIRKQVLGLAEEFPLYAERRARAQAEVRA* |
Ga0062385_100097151 | 3300004080 | Bog Forest Soil | LQRSDAAVLVRIRKEVLGLCEAFPLYAERRARAQAEVRA* |
Ga0062386_1005548161 | 3300004152 | Bog Forest Soil | NHRTDAATLARIRKQVLALAEQFPLYAERRARAQVETRA* |
Ga0062388_1002359421 | 3300004635 | Bog Forest Soil | ALLQRSDAAVLVRIRKEVLGLCEAFPLYAERRARAQAEVRA* |
Ga0062388_1007957951 | 3300004635 | Bog Forest Soil | LQHRADATVLGKIRKQVLDLADTFPLYPERRAKAQAEVRA* |
Ga0062591_1003345313 | 3300004643 | Soil | YALLNRTDATALGKVRKQVLELCEAFPLYAERRAKAQAEVRA* |
Ga0062594_1027455032 | 3300005093 | Soil | QALHHRTDGAVLGKIRKQVLGLAEVFPLYPERRAKAQVELRA* |
Ga0066688_108518851 | 3300005178 | Soil | ALDHRTDAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA* |
Ga0066684_109306612 | 3300005179 | Soil | LNQRQDAAVLTKIRRQVLELAETFPLYPERRLRAAALTRA* |
Ga0070690_1000605011 | 3300005330 | Switchgrass Rhizosphere | GRWISRTLHNRTNAVELGKIRKEVFELAEEFPLYPERRAKAPAEVRV* |
Ga0070711_1005340391 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SEALHHRKEADVLAKIRGQVLELAEAFPLYAERRAKAHAEVRA* |
Ga0070708_1004332201 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLQNRADASLLSKVRRQVLQLAEAFPLYAERRAVIASEVRA* |
Ga0066689_100502821 | 3300005447 | Soil | ISEALHNPTDAVVLSRIRKQVLELAETFPLYSERRVRAQAEVRA* |
Ga0070698_1002979231 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AEALNHRADAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA* |
Ga0070730_102176073 | 3300005537 | Surface Soil | TDAAVLQKIRKQVLELCERFPLYAERRAKATAGVR* |
Ga0066707_105233922 | 3300005556 | Soil | SRTDSAVLTKVRTQVLELAEAFPLYPERRAKAQAEVRA* |
Ga0066702_105842562 | 3300005575 | Soil | AEALDHRTDTAALKKIRKQVEELAEQFPLYPERRARTVAESRA* |
Ga0066691_103743231 | 3300005586 | Soil | EALLQRTDAGVLARIRKEVLGVCEAFPLYAERRARAQAEVRV* |
Ga0070761_101430101 | 3300005591 | Soil | EALDHRTDAAVLGQIRKQVLGLAEEFPLYAERRVRAQADVRA* |
Ga0070764_103553461 | 3300005712 | Soil | ALGRIRKQVLGLAEDFPLYAERRARAHAHEEVRA* |
Ga0066903_1009970213 | 3300005764 | Tropical Forest Soil | HRTEPAMLRKIRNQVLELAEAFPLYPERRAKAQAEVRA* |
Ga0070766_105200281 | 3300005921 | Soil | TDAATLGKIRKQVLELADTFPLYPERRARAQAEAGA* |
Ga0081455_106483312 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LTNRNDPAALAKVRKQVVELAEAFPLYPERRAKAQAEV* |
Ga0080026_101013062 | 3300005952 | Permafrost Soil | LNHRTDAAVLGKIRKQVLGMAEEFPLYAERRAKAQAEVRA* |
Ga0070717_101855461 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DSGVLQKIRRQVLELAEAFPLYAERRAKTQAEVRA* |
Ga0075029_1005030701 | 3300006052 | Watersheds | HHRTEVAVLGKIREEVLGLAEAFPLYPERRAKAQVEVRA* |
Ga0075029_1005112192 | 3300006052 | Watersheds | EVLNQRTDAATLAKIRKQVLALAEEFPLYAERRARVQAEVRV* |
Ga0075029_1009450351 | 3300006052 | Watersheds | LQHRSEAPVLAKVRKQVLDLAEAFPLYPERRAKAQLEVRA* |
Ga0075017_1011394392 | 3300006059 | Watersheds | NHRTDAAVLARIRKEVLALAEEFPLYAERRARAQVEVRA* |
Ga0075017_1011564852 | 3300006059 | Watersheds | LLHRTDAAVLTRVRKEVLDLCEAFPLYAERRAKAQAEVRA* |
Ga0070765_1013609191 | 3300006176 | Soil | ALLHRTDAAALQRIRKEVLGLCEVFPLYAERRARAQAEVRM* |
Ga0097621_1008946722 | 3300006237 | Miscanthus Rhizosphere | EALTNRNDAAALAKVRKQVVELAETFPLYPERRAKAQVEARV* |
Ga0097621_1012527792 | 3300006237 | Miscanthus Rhizosphere | EALTNRNDAAALAKVRKQVVELADAFPLYQERRAKAQVEARI* |
Ga0075021_102331381 | 3300006354 | Watersheds | NRTDTAILGKIRKQVLSLADTFPLYPERRARAQSELKA* |
Ga0075434_1015414391 | 3300006871 | Populus Rhizosphere | APVLGNIRKQVLALAEAFPLYPERRAKAQAELRA* |
Ga0068865_1006281332 | 3300006881 | Miscanthus Rhizosphere | AAVLGKIRKQVLSLAEAFPLYPERRAKAQVEVRA* |
Ga0099793_103696011 | 3300007258 | Vadose Zone Soil | EMRQSSHWSTEALDHRTDTAVLVKIRKQVLGMAEEFPLYAERRARAQAEVRA* |
Ga0099793_105550421 | 3300007258 | Vadose Zone Soil | DGTVPRKIRDRVVEMAEAFPLYAEQRAKAQAEVRA* |
Ga0116103_11383221 | 3300009615 | Peatland | ALDHRTDAAVLAKIRKQVLGMAEEFPLYAERRARAQAEVRA* |
Ga0116126_10299831 | 3300009640 | Peatland | TDAAVLAKIRKQVLGMAEEFPLYAERRARAQAEVRA* |
Ga0116110_12647351 | 3300009643 | Peatland | AAVLGRIRKEVLALAEEFPLYAERRARAQAEVRA* |
Ga0116217_103218331 | 3300009700 | Peatlands Soil | HRTDAAVLAKVRKQVLGLCEMFPLYAERRAKAQAEVRA* |
Ga0116217_106778352 | 3300009700 | Peatlands Soil | ALHHRTDAAVLEKIRKQVLGMAGTFPLYPERRAKAQAEVRA* |
Ga0126374_105547182 | 3300009792 | Tropical Forest Soil | RSDAATLARIKRQVLELAEAFPLYAERRAKAQTEARA* |
Ga0126380_104160602 | 3300010043 | Tropical Forest Soil | WIAQSLLHRGEAEVLAKVRKQVLELCEGFPLYAERRARAQAEVRA* |
Ga0126380_104783171 | 3300010043 | Tropical Forest Soil | NDSASLQGIRQQVFELAEAFPLYPERRARAQAEAKV* |
Ga0126373_131867451 | 3300010048 | Tropical Forest Soil | DAEVLAKVRKQVLELCEAFPLYAERRARAQAEVRA* |
Ga0099796_102149612 | 3300010159 | Vadose Zone Soil | LHRTDTAVLSKVNKQVLELCEAFPLYAERRAKAQAEVRA* |
Ga0074045_100615873 | 3300010341 | Bog Forest Soil | AAVLAKIRKQVLGMAEEFPLYAERRARAQAEVRA* |
Ga0126370_107035671 | 3300010358 | Tropical Forest Soil | EPPILRKIRNQVLELAEVFPLYPERRAKAQAEVRA* |
Ga0126378_133050611 | 3300010361 | Tropical Forest Soil | ALNNRNDAQTLTRIRKQVVELVDGFPLYPERRAKAAVESRA* |
Ga0138570_11844461 | 3300011087 | Peatlands Soil | DAVVLSKVRKQVLDLCEAFPLYADRRAKAQAEARA* |
Ga0137388_108818972 | 3300012189 | Vadose Zone Soil | DHRTDAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA* |
Ga0137388_114860631 | 3300012189 | Vadose Zone Soil | NRTNAVVLARIRKQVLELAEAFPLYSERRVRAQAEVRA* |
Ga0137383_104515592 | 3300012199 | Vadose Zone Soil | EVLNNRTEPNVASKVRRQVLQLAEAFPLYAERRAKSQAELRA* |
Ga0137380_111755681 | 3300012206 | Vadose Zone Soil | NRADANQLGRIRKQVLELAETFPLYSERRARLHALRT* |
Ga0137367_103015263 | 3300012353 | Vadose Zone Soil | LQRTDTGVLAKIRKQVLELCEAFPLYAERRAKAQAEVRV* |
Ga0137371_113918812 | 3300012356 | Vadose Zone Soil | HHRTDAVVLAKIRKQVLDLAEEFPLYAERRSRAQAEVRA* |
Ga0137384_110242002 | 3300012357 | Vadose Zone Soil | GSAVLSKVRQQVLDLCEAFPLYAERRAKAQAEVRA* |
Ga0137384_113102271 | 3300012357 | Vadose Zone Soil | SLLHRTDTAVLSKVRNQVLEFCEAFPLYADRRAKAQAEVRA* |
Ga0137360_117184452 | 3300012361 | Vadose Zone Soil | EALHHRSDAAMLTKTRKQVLELAEEFPLYPERRAQAQAEVKA* |
Ga0137390_108924542 | 3300012363 | Vadose Zone Soil | EALLTRTDPAVLGRIRKQVLALCETFPLYAERRARAQVEARS* |
Ga0137398_100324911 | 3300012683 | Vadose Zone Soil | DAAILKKIRRQVEELAEQFPLYPERRARTVAHSRA* |
Ga0137398_102954161 | 3300012683 | Vadose Zone Soil | HHRAETPVLGKIRHEVLGLAEAFPLYPERRAKAQMEIRA* |
Ga0137359_103437582 | 3300012923 | Vadose Zone Soil | STVLGKIRREVLELAESFPLYAERRAKAQAEVRA* |
Ga0137410_121227121 | 3300012944 | Vadose Zone Soil | ALQQRTDSTVLGKIRREVLELAECFPLYAERRAKAQAEVRA* |
Ga0153916_115230003 | 3300012964 | Freshwater Wetlands | HNRTDAALLARVRKQVLGMAEAFPLYPERRARAQVLARA* |
Ga0126369_113386731 | 3300012971 | Tropical Forest Soil | RNDAGVLAKIRKQVMTLAEDFPLYAERRAKAQAEVRA* |
Ga0157378_111120071 | 3300013297 | Miscanthus Rhizosphere | HNRTNAVELGKIRKEVFELAEEFPLYPERRAKAPAEVRV* |
Ga0181524_100452221 | 3300014155 | Bog | LDHRTDAVVLGRIRKEVLALAEEFPLYAERRARAQAEVRA* |
Ga0181538_101420932 | 3300014162 | Bog | EALDHRTDDAVLAKIRKQVLGLAEEFPLYAERRSRTQAEVRA* |
Ga0137411_10814601 | 3300015052 | Vadose Zone Soil | HRTDALVLGGKIRRQVLELAEAFPLYAERRAQAQAEVRA* |
Ga0167668_10017774 | 3300015193 | Glacier Forefield Soil | ISHWIAEALNHRRDAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA* |
Ga0182041_116448372 | 3300016294 | Soil | SLLHRNDAAVLGKVRRQVLELCEAFPLYAELRARAQAEVRA |
Ga0187814_102293511 | 3300017932 | Freshwater Sediment | SEALHQRTDATVLGRIRKQVLALADTFPLYPERRAKAEVRA |
Ga0187801_101612851 | 3300017933 | Freshwater Sediment | RGDATLLARVRKEVLDLCEAFPLYADRRARAQAEVRA |
Ga0187803_100344401 | 3300017934 | Freshwater Sediment | DAAVLAKIRKQVLELAEEFPLYAERRARTQAEMRA |
Ga0187854_102453332 | 3300017938 | Peatland | DDAVLAKIRKQVLGLADTFPLYPERRAKAQAEARA |
Ga0187850_101830351 | 3300017941 | Peatland | LDHRTDAAVLGKIRKQVLGMAEEFPLYAERRARAQAEVRA |
Ga0187808_105939351 | 3300017942 | Freshwater Sediment | HQRTEATVLSKIRKQVLQMAEAFPLYPERRAKTQAEVRA |
Ga0187819_100557831 | 3300017943 | Freshwater Sediment | HRTDAAVLGRIRKEVLALAEEFPLYAERRARAQAEVRA |
Ga0187819_108768211 | 3300017943 | Freshwater Sediment | LHHRNETALLEKIRGQVLELAEEFPLYPERRAKAQAEVRA |
Ga0187817_107294501 | 3300017955 | Freshwater Sediment | HRADAAVLGKIRKQVLQLADTFPLYPERRAKAQAELRA |
Ga0187779_100288774 | 3300017959 | Tropical Peatland | ADDAILAKIRKQVLGLAEAFPLYPERRARAHADVRA |
Ga0187779_103374911 | 3300017959 | Tropical Peatland | RTDAAVLAKIRKQVLELAEEFPLYSERRARAEVRA |
Ga0187778_109105851 | 3300017961 | Tropical Peatland | RTDATILAKVRKQVLGLCEAFPLYAERRAKAQAEARA |
Ga0187780_104413392 | 3300017973 | Tropical Peatland | VLLHRADAAVLAKVRKQVLSMCEAFPLYAERRAKVQAEVRA |
Ga0187782_102044023 | 3300017975 | Tropical Peatland | EVLLHRNDAAVLACVRKQVLSMCEAFPLYAERRAKAQAEVRA |
Ga0187782_111236943 | 3300017975 | Tropical Peatland | LLHRTDAAVLGTVRQRVLELCEAFPLYAERRARAQAEVRV |
Ga0187870_11874701 | 3300017998 | Peatland | ALDHRTDAAVLAKIRKQVLGMAEEFPLYAERRARAQAEVKA |
Ga0187767_101412561 | 3300017999 | Tropical Peatland | RADAAVLAKVRKQVLSMCEAFPLYAERRAKVQAEVRA |
Ga0187804_102866172 | 3300018006 | Freshwater Sediment | QRTEATVLSKIRKQVLQMAEAFPLYPERRAKTQAEVRA |
Ga0187886_12191231 | 3300018018 | Peatland | DAAVLAKIRKQVLGMAEEFPLYFERRARAQAEVRA |
Ga0187871_102014451 | 3300018042 | Peatland | HRTEASVLTRIRKDVLDLCEAFPLYAERRARAQAEVRA |
Ga0187766_114530781 | 3300018058 | Tropical Peatland | EALHHRADGGVLSKIRKQVLELADTFPLYPERRAKAQAELRA |
Ga0187784_104870232 | 3300018062 | Tropical Peatland | DAAALGIIRKQVLDLCEAFPLYAERRARAQAETRA |
Ga0187784_113283821 | 3300018062 | Tropical Peatland | HPTYNAVLGKIRKQVLQMAEAFPLYPERRAQAQSEVRA |
Ga0187772_103553751 | 3300018085 | Tropical Peatland | EALHNRTDTAVLSKIRKQVLQLAEAFPLYPERRAKAQAEMRA |
Ga0187769_110322221 | 3300018086 | Tropical Peatland | EALNNRTDAAVLARIHKQVLELTEEFPLYAERRARAQAEVRA |
Ga0187771_108930561 | 3300018088 | Tropical Peatland | DAAVLAKIRKQVLELTEEFPLYAERRARAQAEVRA |
Ga0187771_118471002 | 3300018088 | Tropical Peatland | LHKRTDAAVLEKIRKQVLDLAEAFPLYPERRAKAQAEVRA |
Ga0187774_113488411 | 3300018089 | Tropical Peatland | ADDAILTKIRKQVLGLAEVFPLYPERRSKAQAEVRG |
Ga0187770_105858023 | 3300018090 | Tropical Peatland | EALHQRTDAAVLEKIRKQVLDLAEAFPLYPERRAKAQAEVRA |
Ga0187770_108368791 | 3300018090 | Tropical Peatland | SDAEVLAKVRKQVVELCEAFPLYAERRAKAQAEVRA |
Ga0187770_115065591 | 3300018090 | Tropical Peatland | TDAAVLAKIRKQVLELTEEFPLYAERRARAGAEVRA |
Ga0066662_102401221 | 3300018468 | Grasslands Soil | RTDAAVLAKVRKQVLELCEAFPLYADRRAKAQAEVRA |
Ga0210407_104012142 | 3300020579 | Soil | EALLHRTDAGVLSKVRQQVLDLCEAFPLYAERRAKAQAEVRA |
Ga0210404_107339202 | 3300021088 | Soil | ALHQRTDAVTLEKIRKQVLELADTFPLYPERRARAQAEARA |
Ga0210405_101067464 | 3300021171 | Soil | LQHRTDASVLGKIRKQVLGLAEAFPLYPERRAKAQLEVRA |
Ga0210405_102073692 | 3300021171 | Soil | AEALQRRKEAEALAQIRRQVLEMAEAFPLYAERRARAQAEVRA |
Ga0210405_110125592 | 3300021171 | Soil | IAEVLNHRRDAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA |
Ga0213874_102633611 | 3300021377 | Plant Roots | EALQNRTDSVALTKIRKQVLDLAEAFPLYADRRSRSQAEVRA |
Ga0210383_116535371 | 3300021407 | Soil | DAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA |
Ga0210394_109993351 | 3300021420 | Soil | LLHRTDVAVLSKVRKQVLDLCEAFPLYAERRAKAQAEVRA |
Ga0210390_100072061 | 3300021474 | Soil | YAAVLGRIRKDVLDLCEAFPLYAERRASAQAEVRA |
Ga0210392_112237952 | 3300021475 | Soil | ADALTQHSDAAALAKIKRQVMELAEEFPLYAERRTQAHAEVRV |
Ga0210398_109919302 | 3300021477 | Soil | LHQRTDAATLGKIRKQVLELADTFPLYPERRARAQAEARA |
Ga0242665_103694341 | 3300022724 | Soil | RTDAATLGKIRKQVLELADTFPLYPERRARAQAEAGA |
Ga0247694_10342312 | 3300024178 | Soil | HRTEAAVLGKIRKQVLSLAEAFPLYPERRAKAQVEVRA |
Ga0208687_11181591 | 3300025469 | Peatland | DAAVLAKIRKQVLGMAEEFPLYAERRARAQAEVRA |
Ga0208820_10032721 | 3300025576 | Peatland | AAALDHRTDAVVLGRIRKEVLALAEEFPLYAERRARAQAEVRA |
Ga0207696_10902272 | 3300025711 | Switchgrass Rhizosphere | RWISRTLHNRTNAVELGKIRKEVFELAEEFPLYPERRAKAPAEVRV |
Ga0207692_100734224 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ESPVLNNIRKQVLDLAEAFPLYPERRAKSQLEVRA |
Ga0207707_105202552 | 3300025912 | Corn Rhizosphere | LHHRTEAAVLGKIRKQVLSLAEAFPLYPERRAKAQVEVRA |
Ga0207663_100344103 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HRSEPDTLSKIRRQVLELAEAFPLYAERRAKAQAEARA |
Ga0207664_101566771 | 3300025929 | Agricultural Soil | ALLHRTDATVLGKVRKQVLELCEAFPLYADRRAKAQAEVRA |
Ga0207704_101232711 | 3300025938 | Miscanthus Rhizosphere | TDAAVLGKIRKQVLSLAEAFPLYPERRAKAQVEVRA |
Ga0207679_100018991 | 3300025945 | Corn Rhizosphere | GRWISRTLHNRTNAVELGKIRKEVFELAEEFPLYPERRAKAPAEVRV |
Ga0207658_120095712 | 3300025986 | Switchgrass Rhizosphere | HQRTDAVALGKIRKQVADFAEEFPLYPERRAKAQAEVRA |
Ga0207678_101939792 | 3300026067 | Corn Rhizosphere | MPQIALGKIRKQVADFAEEFPLYPERRAKAQAEVRA |
Ga0207641_108169963 | 3300026088 | Switchgrass Rhizosphere | MRQIGSWISKALRERSDAAVLQSIRRQVFELAEGFPLYAERRAKAQAEARV |
Ga0209265_11209021 | 3300026308 | Soil | QHRTDSPVLGKIRKQVLQLAEAFPLYPERRAKAQAELRA |
Ga0257160_10151052 | 3300026489 | Soil | WIAEALNHRTDSAVLVKIRKQVLGMAEEFPLYAERRARAQAEVRI |
Ga0209058_10784051 | 3300026536 | Soil | RTDAQVLKRIRQQVFELAEGFPLYPERRARVQAEVRV |
Ga0209577_103008301 | 3300026552 | Soil | QVGRWISEVLHNRTDSAVLAKVRKQVLGLSEAFSLYPERRARAQAELRA |
Ga0179593_11548412 | 3300026555 | Vadose Zone Soil | MKEAEMRKISHWIAEALDHRTDNAVLGKNPQAGSLGWQRSFPLYAERRARAQAEVRA |
Ga0207943_1073932 | 3300027089 | Forest Soil | IAEALLQRTDAAALGRIRKDVLDLCEAFPLYAERRARAQAEVRA |
Ga0209010_10003211 | 3300027370 | Forest Soil | DAVVLAEIRKQVLGLCEAFPLYAERRARAQAEVRA |
Ga0209524_10522881 | 3300027521 | Forest Soil | DAAVLGKIRKQVLGLAEEFPLYAERRAQAQAEVRA |
Ga0209221_11020132 | 3300027609 | Forest Soil | EALNHRTDAAVLGKIRGQVLGLAEEFPLYAERRAKAQAEIRA |
Ga0209221_11807612 | 3300027609 | Forest Soil | NRTDAATLEKIRKQVLELANTFPLYADRRAKAQAEVRA |
Ga0209905_10176202 | 3300027634 | Thawing Permafrost | EALDHRTDAIVLAKIRKQVLGMAEQFPLYAERRAKAQAEARV |
Ga0209011_10533901 | 3300027678 | Forest Soil | NYRSDAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA |
Ga0209530_10088991 | 3300027692 | Forest Soil | LQRNEGAVLARIRKEVLGLCEEFPLYAERRARAQAEVRA |
Ga0209446_11844791 | 3300027698 | Bog Forest Soil | RTDAAVLGKIRKEVLGMAEDFPLYSERRARAEVRA |
Ga0209248_100352391 | 3300027729 | Bog Forest Soil | IAEVLLQRSDAAVLERVRKEVLELCEAFPLYAERRARARAEVRA |
Ga0209038_101876931 | 3300027737 | Bog Forest Soil | ALLQRSDPALLARVRKQVLSMCEAFPLYAERRAKAQAEVRA |
Ga0209908_100001096 | 3300027745 | Thawing Permafrost | TDAVVLERIRKDVFELCEAFPLYAERRARAQAEVRA |
Ga0209040_105140812 | 3300027824 | Bog Forest Soil | TDASVLANIRKQVLELCEAFPLYAERRARAQAEVRA |
Ga0209580_104373991 | 3300027842 | Surface Soil | LHHRNEADALKRIRKEVLELADAFPLYPERRAKAEVRV |
Ga0209180_101077221 | 3300027846 | Vadose Zone Soil | DHRTDAAVLGKIRKQVLGLAEEFPLYAERRARAQAEVRA |
Ga0209274_103333551 | 3300027853 | Soil | EALLHRTDAVVLSKVRKQVLDLCEAFPLYAERRAKAQAEVRA |
Ga0209166_102262281 | 3300027857 | Surface Soil | TDAAVLQKIRKQVLELCERFPLYAERRAKATAGVR |
Ga0209167_107286932 | 3300027867 | Surface Soil | ALHQRADAATLGKIRKQVLELADTFPLYPERRARAQAEARA |
Ga0209579_108015551 | 3300027869 | Surface Soil | SEALHHRNEPDVLARIRKEVLALAEAFPLYAERRAQAEVRV |
Ga0209283_103299971 | 3300027875 | Vadose Zone Soil | ISEALHNRTDTAALARIRKQVLQLAETFPLYPERRARAQAEVRA |
Ga0209380_101677351 | 3300027889 | Soil | EVLHHRTDAGVLGKIRNQVLGLAEAFPLYPERRAKAQAELRA |
Ga0209380_101786172 | 3300027889 | Soil | LLQRADASVAGKVRGQVLELCEAFPLYAERRAKTQAEVRA |
Ga0209068_101044162 | 3300027894 | Watersheds | HNRTDTAILGKIRKQVLSLADTFPLYPERRARAQSELKA |
Ga0209624_101847202 | 3300027895 | Forest Soil | ALHERTEPAVLERIRLQVLEMAEAFPLYPERRARAQAEVRA |
Ga0209624_102022702 | 3300027895 | Forest Soil | DASVAGKVRGQVLELCEAFPLYAERRAKAQAEVKA |
Ga0209415_108128591 | 3300027905 | Peatlands Soil | DATVLGKIRKQVLEMADTFPLYPERRARAQAEVRA |
Ga0209583_100885532 | 3300027910 | Watersheds | DASVLNKIRKQVLTLAEAFPLYPERRAKAQVEVRA |
Ga0265353_10190301 | 3300028015 | Soil | QRTDAATLGKIRKQVLELADTFPLYPERRARAQAEARA |
Ga0209526_108274462 | 3300028047 | Forest Soil | SEAAVLSKIRRQVLGLAEAFPLYPERRARAQAELRA |
Ga0302222_103893501 | 3300028798 | Palsa | ADAGVAGKVRGQVLELCESFPLYAGRRARAQAEVRT |
Ga0302289_11074021 | 3300028857 | Fen | LNQRTDAAALAKIRKQVLELAEEFPLYAERRAKAQAEVRA |
Ga0308309_110652941 | 3300028906 | Soil | IADALLHRTDAAALQRIRKEVLGLCEVFPLYAERRARAQAEVRM |
Ga0311359_103838421 | 3300029914 | Bog | ISEALDHRTDAAVLHKIRKEVLGLAEEFPLYAERRSKAQSEVRA |
Ga0302143_10138891 | 3300029918 | Bog | LDHRTDAAMLAKIRKDVLGLAEEFPLYAERRARAQAEVRA |
Ga0311346_101283863 | 3300029952 | Bog | EALDHRTDAAVLHKIRKEVLGLAEEFPLYVERRAKAQSEVRA |
Ga0311337_114734532 | 3300030000 | Fen | NQRTDAAALAKIRKQVLELAEEFPLYAERRAKAQAEVRT |
Ga0302174_100730052 | 3300030005 | Fen | EVLNQRTDAAALAKIRKQVLELAEEFPLYAERRAKAQAEVRA |
Ga0302306_102503163 | 3300030043 | Palsa | QISHWIAEALDHRADGSVLAKIRKQVLGLAEEFPLYAERRAQASAEVRG |
Ga0311370_116088221 | 3300030503 | Palsa | EALDHRTDPVALAKIRKQVLGLAEEFPLYAERRARAQAEVRA |
Ga0311355_108283502 | 3300030580 | Palsa | RTDKAALTKIRQQVLELCEAFPLYAERRARAQAEARV |
Ga0310038_103731771 | 3300030707 | Peatlands Soil | DTAVLSRVRRQVLEMAEAFPLYPERRARAQAEARA |
Ga0075391_112518671 | 3300030934 | Soil | RADVAVLAKIRKQVLEMAEEFPLYAERRARAQAEVRA |
Ga0073994_100563621 | 3300030991 | Soil | RRDAAVLEKIRKQVLGLAEEFPLYAERRARAQAEVRA |
Ga0302180_100822263 | 3300031028 | Palsa | RTDATVLARIRKEVLGLCESFPLYAERRAKAQAEV |
Ga0170834_1034500061 | 3300031057 | Forest Soil | RSDATILAKIRKEVLDLCEAFPLYAERRQRTQAEKRA |
Ga0170824_1220206981 | 3300031231 | Forest Soil | ALLQRTDAAVLARVRKEVLDLCEAFPLYAERRARAQAEVRA |
Ga0170824_1259232231 | 3300031231 | Forest Soil | HRTDAAVLAKIRKQVVEFAEGFPLYPERRAKAQAELRA |
Ga0307476_100093161 | 3300031715 | Hardwood Forest Soil | AEVLLHQTDTAVLSKVRKQVLELCEAFPLYAERRARAQAEVRA |
Ga0306917_103606042 | 3300031719 | Soil | EALHHRADDAILAKIRKLVLGLAEAFPLYPERRAKAQAEVRG |
Ga0307468_1024767992 | 3300031740 | Hardwood Forest Soil | HHRSEPDTLNRIRRQVLELAEAFPLYAERRARAQAEARA |
Ga0302322_1019640671 | 3300031902 | Fen | LHHRNDAAALAKIRKQVLGMAEEFPLYAERRAKAQAEVKA |
Ga0306921_106942791 | 3300031912 | Soil | DVPVLDRIRRQVLELAEAFPLYAERRARAQAEARA |
Ga0311373_104596341 | 3300031964 | Palsa | ADALLHRTDKAALTKIRQQVLELCEAFPLYAERRARAQAEARV |
Ga0306920_1014533052 | 3300032261 | Soil | QALLHRNETAVSARVRQQVLALSEAFPLYPERRARAQAEVRA |
Ga0306920_1017969151 | 3300032261 | Soil | LHHRKEADVLAKIRGQVLELAEAFPIYAERRARAHAEVRA |
Ga0335079_106213332 | 3300032783 | Soil | SEVLLHRADAAVLSRVRKQVLDLCEAFPLYADRRAKAQAEVRA |
Ga0335078_119955352 | 3300032805 | Soil | NDAAVLSKVKKQVLEMCEAFPLYAERRAKAQAEVRV |
Ga0335081_101792421 | 3300032892 | Soil | LHRADAAVLSRVRKQVLDLCEAFPLYADRRAKAQAEVRA |
Ga0335081_102870543 | 3300032892 | Soil | EALTHRNDPATLSKIRKQVLALAEEFPLYSERRARAQAEVRV |
Ga0335069_111916302 | 3300032893 | Soil | LHREDRAVLSKVRKQVLELCESFPLYAERRARAQAEVRA |
Ga0335071_101589803 | 3300032897 | Soil | NRTDAGALAKIRKQVMELAEEFPLYAERRAKAQAEVRA |
Ga0335076_110964561 | 3300032955 | Soil | IAEALTHRNDPATLGKIRKQVLALAEEFPLYSERRARAQAEVRV |
Ga0371490_11728011 | 3300033561 | Peat Soil | LDHRADAAVLAKIRKQVLGMAEEFPLYADRRARAQAEVRV |
Ga0370514_034050_1_108 | 3300034199 | Untreated Peat Soil | DAAVLSKVRKQVLDLCEAFPLYAERRAKAQAEVRA |
⦗Top⦘ |