Basic Information | |
---|---|
Family ID | F024100 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 207 |
Average Sequence Length | 41 residues |
Representative Sequence | MADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRRT |
Number of Associated Samples | 137 |
Number of Associated Scaffolds | 207 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 88.41 % |
% of genes near scaffold ends (potentially truncated) | 98.55 % |
% of genes from short scaffolds (< 2000 bps) | 88.89 % |
Associated GOLD sequencing projects | 128 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (68.599 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.985 % of family members) |
Environment Ontology (ENVO) | Unclassified (69.082 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.802 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 207 Family Scaffolds |
---|---|---|
PF08401 | ArdcN | 0.48 |
PF13830 | DUF4192 | 0.48 |
PF00145 | DNA_methylase | 0.48 |
PF07275 | ArdA | 0.48 |
PF02767 | DNA_pol3_beta_2 | 0.48 |
PF02945 | Endonuclease_7 | 0.48 |
PF06737 | Transglycosylas | 0.48 |
COG ID | Name | Functional Category | % Frequency in 207 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.48 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.48 |
COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.48 |
COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.91 % |
Unclassified | root | N/A | 26.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003277|JGI25908J49247_10151091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 542 | Open in IMG/M |
3300004282|Ga0066599_101456827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 524 | Open in IMG/M |
3300004460|Ga0066222_1084582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3376 | Open in IMG/M |
3300005517|Ga0070374_10374629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 717 | Open in IMG/M |
3300005525|Ga0068877_10053702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2648 | Open in IMG/M |
3300005527|Ga0068876_10033326 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
3300005581|Ga0049081_10212184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 691 | Open in IMG/M |
3300005581|Ga0049081_10290242 | Not Available | 566 | Open in IMG/M |
3300005582|Ga0049080_10237621 | Not Available | 597 | Open in IMG/M |
3300005805|Ga0079957_1195860 | Not Available | 979 | Open in IMG/M |
3300005805|Ga0079957_1331510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 674 | Open in IMG/M |
3300006003|Ga0073912_1021903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 538 | Open in IMG/M |
3300006639|Ga0079301_1020815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2292 | Open in IMG/M |
3300006641|Ga0075471_10532151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 581 | Open in IMG/M |
3300006802|Ga0070749_10511654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 653 | Open in IMG/M |
3300006802|Ga0070749_10576260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 608 | Open in IMG/M |
3300006802|Ga0070749_10653205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 564 | Open in IMG/M |
3300006805|Ga0075464_10247102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1066 | Open in IMG/M |
3300006917|Ga0075472_10142671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1175 | Open in IMG/M |
3300006920|Ga0070748_1240092 | Not Available | 654 | Open in IMG/M |
3300007304|Ga0102689_1864032 | Not Available | 503 | Open in IMG/M |
3300007538|Ga0099851_1204567 | Not Available | 717 | Open in IMG/M |
3300007973|Ga0105746_1180437 | Not Available | 718 | Open in IMG/M |
3300008107|Ga0114340_1008797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5734 | Open in IMG/M |
3300008107|Ga0114340_1253429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 536 | Open in IMG/M |
3300008108|Ga0114341_10473969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 574 | Open in IMG/M |
3300008110|Ga0114343_1019958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2987 | Open in IMG/M |
3300008259|Ga0114841_1154843 | Not Available | 901 | Open in IMG/M |
3300008263|Ga0114349_1272010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 525 | Open in IMG/M |
3300008266|Ga0114363_1055266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2729 | Open in IMG/M |
3300008266|Ga0114363_1190431 | Not Available | 640 | Open in IMG/M |
3300008448|Ga0114876_1270460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 509 | Open in IMG/M |
3300008450|Ga0114880_1218799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 622 | Open in IMG/M |
3300009085|Ga0105103_10703648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 581 | Open in IMG/M |
3300009151|Ga0114962_10733760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 503 | Open in IMG/M |
3300009152|Ga0114980_10510389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 684 | Open in IMG/M |
3300009159|Ga0114978_10603603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 634 | Open in IMG/M |
3300009159|Ga0114978_10808920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 528 | Open in IMG/M |
3300009160|Ga0114981_10384789 | Not Available | 757 | Open in IMG/M |
3300009164|Ga0114975_10383557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 769 | Open in IMG/M |
3300009164|Ga0114975_10733379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 521 | Open in IMG/M |
3300009169|Ga0105097_10571354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 635 | Open in IMG/M |
3300009180|Ga0114979_10229210 | Not Available | 1117 | Open in IMG/M |
3300009181|Ga0114969_10368255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 830 | Open in IMG/M |
3300009181|Ga0114969_10561976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 630 | Open in IMG/M |
3300009184|Ga0114976_10448438 | Not Available | 670 | Open in IMG/M |
3300009187|Ga0114972_10277755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1001 | Open in IMG/M |
3300010157|Ga0114964_10297192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 766 | Open in IMG/M |
3300010354|Ga0129333_10100425 | Not Available | 2673 | Open in IMG/M |
3300010354|Ga0129333_10279462 | Not Available | 1498 | Open in IMG/M |
3300010370|Ga0129336_10201575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1132 | Open in IMG/M |
3300010370|Ga0129336_10406040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 744 | Open in IMG/M |
3300012723|Ga0157604_1165082 | Not Available | 652 | Open in IMG/M |
3300013005|Ga0164292_10022339 | All Organisms → cellular organisms → Bacteria | 5146 | Open in IMG/M |
3300013005|Ga0164292_10720244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 636 | Open in IMG/M |
3300013014|Ga0164295_10798117 | Not Available | 730 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1236965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 654 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10360690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 835 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10478416 | Not Available | 762 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10535146 | Not Available | 768 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10478462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 836 | Open in IMG/M |
3300016681|Ga0180043_124917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 711 | Open in IMG/M |
3300017701|Ga0181364_1056659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 610 | Open in IMG/M |
3300017707|Ga0181363_1044631 | Not Available | 806 | Open in IMG/M |
3300017716|Ga0181350_1079021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 834 | Open in IMG/M |
3300017722|Ga0181347_1149235 | Not Available | 639 | Open in IMG/M |
3300017722|Ga0181347_1151142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 634 | Open in IMG/M |
3300017723|Ga0181362_1027594 | Not Available | 1211 | Open in IMG/M |
3300017723|Ga0181362_1041474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 969 | Open in IMG/M |
3300017723|Ga0181362_1069959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 713 | Open in IMG/M |
3300017723|Ga0181362_1070659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 709 | Open in IMG/M |
3300017723|Ga0181362_1092120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 606 | Open in IMG/M |
3300017723|Ga0181362_1110525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 542 | Open in IMG/M |
3300017736|Ga0181365_1120503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 629 | Open in IMG/M |
3300017761|Ga0181356_1013716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 3050 | Open in IMG/M |
3300017761|Ga0181356_1063863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1247 | Open in IMG/M |
3300017761|Ga0181356_1115559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 861 | Open in IMG/M |
3300017761|Ga0181356_1132660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 785 | Open in IMG/M |
3300017761|Ga0181356_1143843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 743 | Open in IMG/M |
3300017761|Ga0181356_1210780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 570 | Open in IMG/M |
3300017761|Ga0181356_1214632 | Not Available | 563 | Open in IMG/M |
3300017774|Ga0181358_1201641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 650 | Open in IMG/M |
3300017774|Ga0181358_1216503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 619 | Open in IMG/M |
3300017774|Ga0181358_1235509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 582 | Open in IMG/M |
3300017777|Ga0181357_1085951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1202 | Open in IMG/M |
3300017777|Ga0181357_1114194 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
3300017777|Ga0181357_1117085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1001 | Open in IMG/M |
3300017777|Ga0181357_1176636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 774 | Open in IMG/M |
3300017777|Ga0181357_1288707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 560 | Open in IMG/M |
3300017778|Ga0181349_1216931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 654 | Open in IMG/M |
3300017780|Ga0181346_1146958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 885 | Open in IMG/M |
3300017784|Ga0181348_1304113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 533 | Open in IMG/M |
3300017785|Ga0181355_1160410 | Not Available | 903 | Open in IMG/M |
3300017785|Ga0181355_1172288 | Not Available | 864 | Open in IMG/M |
3300017785|Ga0181355_1236301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 705 | Open in IMG/M |
3300017785|Ga0181355_1295233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 610 | Open in IMG/M |
3300017785|Ga0181355_1317460 | Not Available | 580 | Open in IMG/M |
3300017785|Ga0181355_1371580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 522 | Open in IMG/M |
3300019784|Ga0181359_1221007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 595 | Open in IMG/M |
3300019784|Ga0181359_1241396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 554 | Open in IMG/M |
3300019784|Ga0181359_1249542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 539 | Open in IMG/M |
3300020048|Ga0207193_1660750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 693 | Open in IMG/M |
3300020109|Ga0194112_10549818 | Not Available | 798 | Open in IMG/M |
3300020159|Ga0211734_10004093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1885 | Open in IMG/M |
3300020172|Ga0211729_10254245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 511 | Open in IMG/M |
3300020196|Ga0194124_10432384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 593 | Open in IMG/M |
3300020200|Ga0194121_10336133 | Not Available | 760 | Open in IMG/M |
3300020204|Ga0194116_10522383 | Not Available | 552 | Open in IMG/M |
3300020205|Ga0211731_11717464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 697 | Open in IMG/M |
3300020498|Ga0208050_1023277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 634 | Open in IMG/M |
3300020533|Ga0208364_1050185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 544 | Open in IMG/M |
3300020553|Ga0208855_1011114 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
3300020557|Ga0208231_1053327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 626 | Open in IMG/M |
3300021376|Ga0194130_10405016 | Not Available | 723 | Open in IMG/M |
3300021438|Ga0213920_1062338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 751 | Open in IMG/M |
3300021963|Ga0222712_10533426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 688 | Open in IMG/M |
3300022176|Ga0212031_1073971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 580 | Open in IMG/M |
3300022190|Ga0181354_1019002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2158 | Open in IMG/M |
3300022190|Ga0181354_1063946 | Not Available | 1223 | Open in IMG/M |
3300022190|Ga0181354_1070765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1156 | Open in IMG/M |
3300022190|Ga0181354_1123667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 829 | Open in IMG/M |
3300022190|Ga0181354_1124089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 827 | Open in IMG/M |
3300022190|Ga0181354_1188404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 622 | Open in IMG/M |
3300022190|Ga0181354_1203458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 588 | Open in IMG/M |
3300022200|Ga0196901_1019397 | All Organisms → Viruses → Predicted Viral | 2758 | Open in IMG/M |
3300022407|Ga0181351_1156379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 813 | Open in IMG/M |
3300022747|Ga0228703_1143593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 518 | Open in IMG/M |
3300023174|Ga0214921_10385471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 724 | Open in IMG/M |
3300024354|Ga0255171_1002519 | Not Available | 4222 | Open in IMG/M |
3300024357|Ga0255165_1068482 | Not Available | 572 | Open in IMG/M |
3300025687|Ga0208019_1129484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 736 | Open in IMG/M |
3300025889|Ga0208644_1208669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 842 | Open in IMG/M |
3300025889|Ga0208644_1339093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 579 | Open in IMG/M |
3300027291|Ga0255139_1079668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 548 | Open in IMG/M |
3300027596|Ga0255119_1103965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 503 | Open in IMG/M |
3300027683|Ga0209392_1259733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 516 | Open in IMG/M |
3300027734|Ga0209087_1225878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 704 | Open in IMG/M |
3300027741|Ga0209085_1011398 | Not Available | 4437 | Open in IMG/M |
3300027747|Ga0209189_1388970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 520 | Open in IMG/M |
3300027759|Ga0209296_1233355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 767 | Open in IMG/M |
3300027782|Ga0209500_10252329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 769 | Open in IMG/M |
3300027782|Ga0209500_10313443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 660 | Open in IMG/M |
3300027785|Ga0209246_10377658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 535 | Open in IMG/M |
3300027798|Ga0209353_10355967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 610 | Open in IMG/M |
3300027798|Ga0209353_10363903 | Not Available | 601 | Open in IMG/M |
3300027808|Ga0209354_10413098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 523 | Open in IMG/M |
3300027808|Ga0209354_10438788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 503 | Open in IMG/M |
3300027816|Ga0209990_10419939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 578 | Open in IMG/M |
3300027816|Ga0209990_10423309 | Not Available | 575 | Open in IMG/M |
3300027892|Ga0209550_10314802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1001 | Open in IMG/M |
3300027899|Ga0209668_10560219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 762 | Open in IMG/M |
3300027899|Ga0209668_10901257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 596 | Open in IMG/M |
3300027969|Ga0209191_1178445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 849 | Open in IMG/M |
3300027972|Ga0209079_10284057 | Not Available | 562 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1206055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 739 | Open in IMG/M |
3300028103|Ga0255172_1086019 | Not Available | 561 | Open in IMG/M |
3300028392|Ga0304729_1110503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 925 | Open in IMG/M |
3300028394|Ga0304730_1045306 | Not Available | 2169 | Open in IMG/M |
3300031787|Ga0315900_10311483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1297 | Open in IMG/M |
3300031834|Ga0315290_10857189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 774 | Open in IMG/M |
3300031857|Ga0315909_10196849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1602 | Open in IMG/M |
3300031857|Ga0315909_10341563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1098 | Open in IMG/M |
3300031857|Ga0315909_10491547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 850 | Open in IMG/M |
3300031857|Ga0315909_10646485 | Not Available | 697 | Open in IMG/M |
3300031951|Ga0315904_10004685 | Not Available | 19361 | Open in IMG/M |
3300031951|Ga0315904_10942851 | Not Available | 691 | Open in IMG/M |
3300031951|Ga0315904_11023043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 653 | Open in IMG/M |
3300031951|Ga0315904_11461500 | Not Available | 506 | Open in IMG/M |
3300031963|Ga0315901_10548658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 889 | Open in IMG/M |
3300031963|Ga0315901_10747058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 717 | Open in IMG/M |
3300031963|Ga0315901_11090819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 550 | Open in IMG/M |
3300031999|Ga0315274_11013387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 847 | Open in IMG/M |
3300031999|Ga0315274_11166901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 767 | Open in IMG/M |
3300032050|Ga0315906_10174201 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
3300032050|Ga0315906_10337526 | Not Available | 1339 | Open in IMG/M |
3300032050|Ga0315906_10509330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1016 | Open in IMG/M |
3300032053|Ga0315284_12207481 | Not Available | 548 | Open in IMG/M |
3300032116|Ga0315903_10617481 | Not Available | 828 | Open in IMG/M |
3300032462|Ga0335396_10262211 | Not Available | 1130 | Open in IMG/M |
3300032462|Ga0335396_10715887 | Not Available | 611 | Open in IMG/M |
3300033521|Ga0316616_101412624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 897 | Open in IMG/M |
3300033816|Ga0334980_0424196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 501 | Open in IMG/M |
3300033993|Ga0334994_0017884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4750 | Open in IMG/M |
3300033996|Ga0334979_0184973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1238 | Open in IMG/M |
3300034012|Ga0334986_0071902 | All Organisms → Viruses → Predicted Viral | 2131 | Open in IMG/M |
3300034012|Ga0334986_0300279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 851 | Open in IMG/M |
3300034012|Ga0334986_0486374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 609 | Open in IMG/M |
3300034061|Ga0334987_0437820 | Not Available | 816 | Open in IMG/M |
3300034061|Ga0334987_0733866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 560 | Open in IMG/M |
3300034062|Ga0334995_0059206 | All Organisms → Viruses → Predicted Viral | 3077 | Open in IMG/M |
3300034062|Ga0334995_0503862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 727 | Open in IMG/M |
3300034062|Ga0334995_0679301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 583 | Open in IMG/M |
3300034066|Ga0335019_0016074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5161 | Open in IMG/M |
3300034066|Ga0335019_0480965 | Not Available | 745 | Open in IMG/M |
3300034066|Ga0335019_0681606 | Not Available | 592 | Open in IMG/M |
3300034082|Ga0335020_0527354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 558 | Open in IMG/M |
3300034092|Ga0335010_0027711 | All Organisms → Viruses → Predicted Viral | 4336 | Open in IMG/M |
3300034093|Ga0335012_0237968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 949 | Open in IMG/M |
3300034101|Ga0335027_0075045 | Not Available | 2647 | Open in IMG/M |
3300034101|Ga0335027_0425729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 853 | Open in IMG/M |
3300034102|Ga0335029_0442661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 771 | Open in IMG/M |
3300034102|Ga0335029_0473372 | Not Available | 735 | Open in IMG/M |
3300034106|Ga0335036_0865515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 516 | Open in IMG/M |
3300034109|Ga0335051_0348673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 709 | Open in IMG/M |
3300034118|Ga0335053_0509958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 708 | Open in IMG/M |
3300034283|Ga0335007_0480345 | Not Available | 751 | Open in IMG/M |
3300034284|Ga0335013_0347904 | Not Available | 928 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.99% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.36% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.63% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.73% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.28% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.86% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.38% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.93% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.93% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.93% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.97% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.97% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.97% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.97% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.97% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.97% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.48% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.48% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.48% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.48% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.48% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006003 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_2-Sept-14 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300016681 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027291 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8d | Environmental | Open in IMG/M |
3300027596 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25908J49247_101510911 | 3300003277 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYEYYRRTDKIFTD |
Ga0066599_1014568271 | 3300004282 | Freshwater | VAENSADIAKRIILGCVAEGMTIDAACGSAGKSMKTYEYYRR |
Ga0066222_108458211 | 3300004460 | Marine | VAENSADIAKRIILVAVSEGMTIEQACASAGKSIKTYEYYRRTD |
Ga0070374_103746292 | 3300005517 | Freshwater Lake | MTENSADIAKRIILGCVAENMTVEQACASAGKSLKTYEYYR |
Ga0068877_100537029 | 3300005525 | Freshwater Lake | MAENSADIAKRIILSCVAEAMTIEQACASAGKSMKTYEYYRRTD |
Ga0068876_100333261 | 3300005527 | Freshwater Lake | MTEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTYEYYRRTDKV |
Ga0049081_102121841 | 3300005581 | Freshwater Lentic | VADNSADIAKRIILGCVAEGMTIDAACGSAGKSIKTYEYY |
Ga0049081_102902421 | 3300005581 | Freshwater Lentic | VAEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTYEYYRRTDK |
Ga0049080_102376211 | 3300005582 | Freshwater Lentic | VAENSADIAKRIILGAVAEGMTIEAATASAGKSIKTYE |
Ga0079957_11958601 | 3300005805 | Lake | MSNNTADIAKRVILNAVAEGMTIETACGEAGKSMKTYEYYR |
Ga0079957_13315102 | 3300005805 | Lake | MSNNTADIAKRVILNAVAEGMTIETACGEAGKSMKTYEYYRRSDKVFA |
Ga0073912_10219032 | 3300006003 | Sand | MADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYE |
Ga0079301_10208155 | 3300006639 | Deep Subsurface | MAENSADIAKRIILGCVAEGMTVEQGCASAGKSIKTYEYY |
Ga0075471_105321511 | 3300006641 | Aqueous | VAENSADIAKRIILGCVAEGMTIDAACGSAGKSMKT |
Ga0070749_105116541 | 3300006802 | Aqueous | VAENSADIAKRIILGAMAEGMTVEAACAAAGKSGKTYEYYRRSDK |
Ga0070749_105762601 | 3300006802 | Aqueous | MAEKSSEIAKRVILAAVAEGMTVEQAVGSAGKSMKTYEYYRRTDKV |
Ga0070749_106532052 | 3300006802 | Aqueous | MAEKSSEIAKRVILQAVAEGLTVEAAVGSAGKSMKTYEYYRRTDRSF |
Ga0075464_102471021 | 3300006805 | Aqueous | VADNSADIAKRIILGCVAEGMTIEAACTSAGKSMKTYEYY |
Ga0075472_101426711 | 3300006917 | Aqueous | MADNSADIAKRIILGCVAEGMTIEAACTSAGKSMKTYEYYRRTD |
Ga0070748_12400921 | 3300006920 | Aqueous | MTEKSSDIAKRVILSGVAEGMTIEAATASAGKSYKTYEYYR |
Ga0102689_18640321 | 3300007304 | Freshwater Lake | MAENSADIAKRIILGAVAEGMTVEAATASAGKSIKTYEYY |
Ga0099851_12045672 | 3300007538 | Aqueous | MTEKSSEIAKRVILQAVAEGLTVEAAVGSAGKSMKTY |
Ga0105746_11804371 | 3300007973 | Estuary Water | MTEKSSDIAKRVILSGVAEGMTIEAATASAGKSYKTY |
Ga0114340_10087971 | 3300008107 | Freshwater, Plankton | VAENSADIAKRIILGCVAEGMTIEQACASAGKSMK |
Ga0114340_12534291 | 3300008107 | Freshwater, Plankton | VAENSADIAKRIILGCVAEGMTIEQACASAGKSMKTYEYYRRTDKVFT |
Ga0114341_104739691 | 3300008108 | Freshwater, Plankton | MADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYYRRTDKI |
Ga0114343_10199581 | 3300008110 | Freshwater, Plankton | MAENSADIAKRIILNCVAEGMTVEQACASAGKSMKTYE |
Ga0114841_11548432 | 3300008259 | Freshwater, Plankton | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYKSYEYYRRTDP |
Ga0114349_12720101 | 3300008263 | Freshwater, Plankton | VAENSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYYRRTD |
Ga0114363_10552666 | 3300008266 | Freshwater, Plankton | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYKSYE* |
Ga0114363_11904311 | 3300008266 | Freshwater, Plankton | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYK |
Ga0114876_12704602 | 3300008448 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYYRRTDKV |
Ga0114880_12187991 | 3300008450 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIEAACGQAGKSLK |
Ga0105103_107036481 | 3300009085 | Freshwater Sediment | VADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEY |
Ga0114962_107337601 | 3300009151 | Freshwater Lake | MAENSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYYRRT |
Ga0114980_105103892 | 3300009152 | Freshwater Lake | VAENSADIAKRLILGCVAEGMTIEAACGSAGKSMKTYEYYRR |
Ga0114978_106036031 | 3300009159 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYY |
Ga0114978_108089201 | 3300009159 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACGSAGKSIKTYEYYRRT |
Ga0114981_103847893 | 3300009160 | Freshwater Lake | MTEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTYEYY |
Ga0114975_103835572 | 3300009164 | Freshwater Lake | MADNSADIAKRVILGAVAEGMTVEAATASAGKSIKTYEYYRRT |
Ga0114975_107333792 | 3300009164 | Freshwater Lake | VADNSADIAKRIILGAVAEGMTVEAATASAGKSIKTYEYYRRTD |
Ga0105097_105713541 | 3300009169 | Freshwater Sediment | VADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYYRRTDKVFTDK |
Ga0114979_102292101 | 3300009180 | Freshwater Lake | MTEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTYENYRRTD |
Ga0114969_103682552 | 3300009181 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIEAACTSAGKSMKTYEYYRRTDK |
Ga0114969_105619761 | 3300009181 | Freshwater Lake | MAENSADIAKRIILGCVAENMTVEQACASAGKSLKTYEY |
Ga0114976_104484381 | 3300009184 | Freshwater Lake | MSEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTY |
Ga0114972_102777551 | 3300009187 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIEAACTSAGKSMK |
Ga0114964_102971921 | 3300010157 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRR |
Ga0129333_101004256 | 3300010354 | Freshwater To Marine Saline Gradient | MAEKSSEIAKRVILAAVAEGLTVEQAVGSAGKSMKTYEYYRR |
Ga0129333_102794624 | 3300010354 | Freshwater To Marine Saline Gradient | MPENTSDIAKRVILSAIAEGMTVEQAVASAGKSYKSY |
Ga0129336_102015751 | 3300010370 | Freshwater To Marine Saline Gradient | MTEKSSEIAKRVILAAVAEGLTVEAAVGSAGKSMKTYEYYRRTDRSFA |
Ga0129336_104060401 | 3300010370 | Freshwater To Marine Saline Gradient | MSENSADIAKRIILECVAGGMRVEDACKSAGKSIKTYEYYR |
Ga0157604_11650822 | 3300012723 | Freshwater | MADNSADIAKRIILGAVAEGMTVEAATASAGKSIKTYE |
Ga0164292_1002233920 | 3300013005 | Freshwater | MAENSADIAKRIILGCVAEGMTIEQACLSAGKSMKTYEYY |
Ga0164292_107202441 | 3300013005 | Freshwater | VAENSADIAKRIILGCVAEGMTIEQACASAGKSMKTYEY |
Ga0164295_107981171 | 3300013014 | Freshwater | MADNSADIAKRIILGAVAEGMTVEAATTSAGKSIKTY |
(restricted) Ga0172374_12369652 | 3300013122 | Freshwater | MAENSADIAKRIILSCVAQGMTVDQACSSAGKSMKTYEYYRRTD |
(restricted) Ga0172367_103606901 | 3300013126 | Freshwater | MAENSADIAKRIILSCVAQGMTVDQACSSAGKSMKTYEYYRRTDKIFAD |
(restricted) Ga0172373_104784161 | 3300013131 | Freshwater | MSNNTADIAKRVILNAVAEGMTIETACGEAGKSMK |
(restricted) Ga0172372_105351461 | 3300013132 | Freshwater | MSNNTADIAKRVILNAVAEGMTIETACGEAGKSMKTY |
(restricted) Ga0172375_104784623 | 3300013137 | Freshwater | MSNNTADIAKRVILNAVAEGMTIETACGEAGKSMKTY* |
Ga0180043_1249171 | 3300016681 | Freshwater | VADNIADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYY |
Ga0181364_10566591 | 3300017701 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYE |
Ga0181363_10446312 | 3300017707 | Freshwater Lake | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYKSYEYYRRTDPVWKDKV |
Ga0181350_10790212 | 3300017716 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYEYYRRTDK |
Ga0181347_11492351 | 3300017722 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKT |
Ga0181347_11511421 | 3300017722 | Freshwater Lake | VADNSADIAKRIILGAVAEGMTIEAATASAGKSIKTYEYYRRT |
Ga0181362_10275942 | 3300017723 | Freshwater Lake | MAENSADIAKRIILGCVAENMTVEQACASAGKSLKTY |
Ga0181362_10414741 | 3300017723 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACGSAGKSIKTYE |
Ga0181362_10699591 | 3300017723 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRRTD |
Ga0181362_10706591 | 3300017723 | Freshwater Lake | MAENSADIGKRIILSCVAESMTVEQACASAGKSLKTYEYYRRTD |
Ga0181362_10921201 | 3300017723 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRRT |
Ga0181362_11105251 | 3300017723 | Freshwater Lake | VADNSADIAKRIILGAVAEGMTIEAACTSAGKSIKTYEYYRRTDKI |
Ga0181365_11205031 | 3300017736 | Freshwater Lake | MAENSADIGKRIILTSVAEGMTIEQACASAGKSIKTYEYYRRTDKIFS |
Ga0181356_10137161 | 3300017761 | Freshwater Lake | MTEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTYEYYRI |
Ga0181356_10638631 | 3300017761 | Freshwater Lake | VADNSADIAKRLILGCVAEGMTIEAACASAGKSIKTYL |
Ga0181356_11155592 | 3300017761 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRRTDKVFT |
Ga0181356_11326601 | 3300017761 | Freshwater Lake | MAENSADIAKRIILGCVAEGMTIEQACLSAGKSMK |
Ga0181356_11438431 | 3300017761 | Freshwater Lake | MAENSADIGKRIILSCVAESMTVEQACASAGKSLKTY |
Ga0181356_12107802 | 3300017761 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYYRRTDKIFC |
Ga0181356_12146321 | 3300017761 | Freshwater Lake | VAEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTYEYY |
Ga0181358_12016411 | 3300017774 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYYRRTDKIFCDKI |
Ga0181358_12165032 | 3300017774 | Freshwater Lake | VADNPADIAKRIILGAVAEGMTVEAATASAGKSIKTYEYYRRTD |
Ga0181358_12355092 | 3300017774 | Freshwater Lake | VTDNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEY |
Ga0181357_10859511 | 3300017777 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYEY |
Ga0181357_11141942 | 3300017777 | Freshwater Lake | MADNSADIAKRLILGCVAEGMTIEAACVSAGKSIKTYEYYRRTDKIFTD |
Ga0181357_11170851 | 3300017777 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRRTDKV |
Ga0181357_11766361 | 3300017777 | Freshwater Lake | VADNSADIAKRIILGCVTEGMTIDAACTSAGKSMKTYEYYP |
Ga0181357_12887071 | 3300017777 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYD |
Ga0181349_12169312 | 3300017778 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYEYYRRTDKIFTDK |
Ga0181346_11469581 | 3300017780 | Freshwater Lake | MADNSADIAKRVILSCVAEGMTIEAACGQAGKSLKTYEYYRRTDKIFIS |
Ga0181348_13041132 | 3300017784 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYYRR |
Ga0181355_11604102 | 3300017785 | Freshwater Lake | VAENSADIAKRIILGAVAEGRTIEAATASAGKSIKTY |
Ga0181355_11722881 | 3300017785 | Freshwater Lake | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYKSY |
Ga0181355_12363011 | 3300017785 | Freshwater Lake | VAENSADIAKRIILGCVAEGMTIEQACTSAGKSMKTYEYY |
Ga0181355_12952331 | 3300017785 | Freshwater Lake | VADNSADIAKRIILGAVAEGMTVDAATASAGKSIKTYEYYRRPDKI |
Ga0181355_13174601 | 3300017785 | Freshwater Lake | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYKSYEYY |
Ga0181355_13715801 | 3300017785 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYYRRTD |
Ga0181359_12210071 | 3300019784 | Freshwater Lake | MTENSADIAKRIILGCVAENMTVEQACASAGKSLKTYEYY |
Ga0181359_12413961 | 3300019784 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYYRRTDKIF |
Ga0181359_12495422 | 3300019784 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYYRRTDKIFCD |
Ga0207193_16607501 | 3300020048 | Freshwater Lake Sediment | MADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYYRRTDKVF |
Ga0194112_105498183 | 3300020109 | Freshwater Lake | MSNNTADIAKRVILNAVAEGMTIETACGEAGKSMKTYEYYRR |
Ga0211734_100040934 | 3300020159 | Freshwater | MAENSADIAKRIILGCVAEGMTVEQGCASAGKSIKTYEYYRRTDKVFA |
Ga0211729_102542451 | 3300020172 | Freshwater | MAENTADIAKRIILTCVAEGMTIEQSCKSAGKSIKAYEYYRYAGSIHMP |
Ga0194124_104323841 | 3300020196 | Freshwater Lake | MAENSADIAKRVIIASVADGMTIDQACAAAGRSMKTYEYYRRTE |
Ga0194121_103361331 | 3300020200 | Freshwater Lake | MSNNTADIAKRVILNAVAEGMTIETACGEAGKSMKTYEYYRRSD |
Ga0194116_105223831 | 3300020204 | Freshwater Lake | MAENSADIAKRVIIASVADGMTIDQACAAAGRSMKTYEYYRRT |
Ga0211731_117174641 | 3300020205 | Freshwater | MAENSADIGKRIILKSVAEGMTVEAACGSAGKSLKTYEYYRRT |
Ga0208050_10232771 | 3300020498 | Freshwater | VADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYYRRTDKVF |
Ga0208364_10501851 | 3300020533 | Freshwater | MAENSADIAKRIILGCVAEGMTVEQGCASAGKSIKTYEYYRRTDK |
Ga0208855_10111142 | 3300020553 | Freshwater | VADNSADIAKRIILGCVAEGMTIEQACASAGKSIK |
Ga0208231_10533271 | 3300020557 | Freshwater | VADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRRT |
Ga0194130_104050161 | 3300021376 | Freshwater Lake | MSDNSADIAKRIIIASVAEGKTIDQSCAAAGKSIK |
Ga0213920_10623381 | 3300021438 | Freshwater | MADNSADIAKRIILGCVAEGMTIEQATASAGKSIKT |
Ga0222712_105334262 | 3300021963 | Estuarine Water | VSENSADIAKRIILGCVSEGMTIEAACGSAGKSIKTYEYYRRTDK |
Ga0212031_10739711 | 3300022176 | Aqueous | MAENSADIAKRIILSCVAEAFTIEQACASAGKSMKTYEYYRRTDKVFA |
Ga0181354_10190021 | 3300022190 | Freshwater Lake | MAENSADIAKRIILGCVAEGMTIEQACLSAGKSMKTY |
Ga0181354_10639461 | 3300022190 | Freshwater Lake | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYKSYE |
Ga0181354_10707653 | 3300022190 | Freshwater Lake | MAENSADIGKRIILSCVAESMTVEQACASAGKSLKTYEYYRRTDKVSF |
Ga0181354_11236671 | 3300022190 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKT |
Ga0181354_11240892 | 3300022190 | Freshwater Lake | VADNSADIAKRIILGAVAEGMTIEAACTSAGKSIKTYEYYRRTDKIFT |
Ga0181354_11884041 | 3300022190 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYEYYRRTAPP |
Ga0181354_12034582 | 3300022190 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIEMACISAGKSMKTYEYYR |
Ga0196901_10193971 | 3300022200 | Aqueous | MTEKSSEIAKRVILAAVAEGLTVEAAVGSAGKSMKTYEYYR |
Ga0181351_11563792 | 3300022407 | Freshwater Lake | MTENSADIAKRIILGCVAENMTVEQACASAGKSLKTYEYYRRSDRVFADK |
Ga0228703_11435932 | 3300022747 | Freshwater | VAENSADIAKRVILSCVAQGMTIEQACTSAGKSMKTYEYYRRTDKVF |
Ga0214921_103854711 | 3300023174 | Freshwater | VADNSADIAKRIILGCVAEGMTIEAACASAGKSIK |
Ga0255171_10025191 | 3300024354 | Freshwater | MPENTSDIAKRVILSAIAEGMTVEQAVASAGKSYKS |
Ga0255165_10684821 | 3300024357 | Freshwater | MPENTSDIAKRVILSAIAEGMTVEQAVASAGKSYKSYEYYRRTDPAF |
Ga0208019_11294842 | 3300025687 | Aqueous | MTEKSSEIAKRVILQAVAEGLTVEAAVGSAGKSMKTYEYYRRTDR |
Ga0208644_12086691 | 3300025889 | Aqueous | MAEKSSEIAKRVILTAVAEGMTVEAAVGSAGKSMKTYEYYRRT |
Ga0208644_13390932 | 3300025889 | Aqueous | MAENSADIAKRIILGAVAEGMTIEAACSGAGKSMKTYEY |
Ga0255139_10796681 | 3300027291 | Freshwater | MAENSADIGKRIILSCVAESMTVEQACASAGKSLKTYEYY |
Ga0255119_11039651 | 3300027596 | Freshwater | VAENSADIAKRIILGAVAEGMTIEAATASAGKSIKTYEYY |
Ga0209392_12597331 | 3300027683 | Freshwater Sediment | VADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYE |
Ga0209087_12258781 | 3300027734 | Freshwater Lake | MAENSADIAKRIILGCVAENMTVEQACASAGKSLKTYEYYRRSDRVF |
Ga0209085_101139815 | 3300027741 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRRTDK |
Ga0209189_13889701 | 3300027747 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIEAACASAGKSIK |
Ga0209296_12333551 | 3300027759 | Freshwater Lake | VADNSADIAKRIILGAVAEGMTVEAATASAGKSIKTYEYYRRTDK |
Ga0209500_102523292 | 3300027782 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIEAACTSAGKSMKTYEYYR |
Ga0209500_103134431 | 3300027782 | Freshwater Lake | MAENSADIAKRIILNSVAESMTIEQACGSAGKSIKTYEYY |
Ga0209246_103776582 | 3300027785 | Freshwater Lake | MAENSADIAKRIILGCVAEGMTIEQACLSAGKSMKTYEYYRRTDK |
Ga0209353_103559671 | 3300027798 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYEYY |
Ga0209353_103639031 | 3300027798 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKT |
Ga0209354_104130981 | 3300027808 | Freshwater Lake | MAENSADIAKRIILGCVAENMTVEQACASAGKSLKTYE |
Ga0209354_104387881 | 3300027808 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYEYYRRTD |
Ga0209990_104199391 | 3300027816 | Freshwater Lake | MAENSADIAKRIILGCVAEGMTIEQACLSAGKSMKTYEY |
Ga0209990_104233092 | 3300027816 | Freshwater Lake | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYKSYEYYR |
Ga0209550_103148022 | 3300027892 | Freshwater Lake | MADNSADIAKRIILGCVAEGMTIDAACSSAGKSMKTYEYYR |
Ga0209668_105602192 | 3300027899 | Freshwater Lake Sediment | MADNSADIAKRIILGCVAEGMTIEAACTSAGKSMKTYEYYRRTDKIFT |
Ga0209668_109012571 | 3300027899 | Freshwater Lake Sediment | VAENSADIAKRIILGCVAEGMTIEAACTSAGKSMKTYEYYR |
Ga0209191_11784451 | 3300027969 | Freshwater Lake | VAENSADIAKRIILGCVAEGMTIDAACSSAGKSMKT |
Ga0209079_102840572 | 3300027972 | Freshwater Sediment | VADNSADIAKRIILGCVAEGMTIEQACASAGKSIKT |
(restricted) Ga0247834_12060551 | 3300027977 | Freshwater | MAENSADIGKRIILKSVAQGMTVEAACGSAGKSLKTYEYYR |
Ga0255172_10860191 | 3300028103 | Freshwater | MPENTSDIAKRVILSAIAEGMTVEQAVASAGKSYKSYEYY |
Ga0304729_11105031 | 3300028392 | Freshwater Lake | VAENSADIAKRIILGCVAEGITIDAACGSAGKSMKT |
Ga0304730_10453064 | 3300028394 | Freshwater Lake | VADNSADIAKRIILGCVAEGMTIDAACGSAGKSIKTYEYYR |
Ga0315900_103114831 | 3300031787 | Freshwater | VADNSADIAKRIILGCVAEGMIIEQACASAGKSIKTYEYYRRTDKVFT |
Ga0315290_108571891 | 3300031834 | Sediment | MADNSADIAKRIILGCVAEGMTIDAACTSAGKSMKTYEYYRRTDKIFTD |
Ga0315909_101968493 | 3300031857 | Freshwater | VADNSADIAKRIILGCVAEGMTIEAACGQAGKSLKTYEYY |
Ga0315909_103415631 | 3300031857 | Freshwater | MADNSADIAKRLILGCVAEGMTIEQACASAGKSIKTYEYYR |
Ga0315909_104915471 | 3300031857 | Freshwater | MADNSADIAKRIILGCVAEGMTIEAACASAGKSIKTYEYYRRTDK |
Ga0315909_106464851 | 3300031857 | Freshwater | MSNNTADIAKRVILNAVAEGMTIEQACGEAGKSMKTYEYY |
Ga0315904_1000468541 | 3300031951 | Freshwater | MPENTAEIAKRVILSAIAEGMTVEQAVASAGRSYKSYEYYRR |
Ga0315904_109428511 | 3300031951 | Freshwater | MADNSADIAKRIILGAVAEGMTIEAATASAGKSIK |
Ga0315904_110230431 | 3300031951 | Freshwater | VAENSADIAKRIILGAVAEGMTIDAACSSAGKSMKTYEYYRRTDKI |
Ga0315904_114615001 | 3300031951 | Freshwater | MAEKSSEIAKRVILAAVAEGATVEQAVGSAGKSMKTY |
Ga0315901_105486581 | 3300031963 | Freshwater | MAENSADIAKRIILGAVAEGMTVEAATASAGKSIKTYEYYRRTDKIF |
Ga0315901_107470581 | 3300031963 | Freshwater | MAENSADIAKRIILGCVAEGMTVEQGCASAGKSIKTYEYYRRT |
Ga0315901_110908191 | 3300031963 | Freshwater | VADNSADIAKRIILGCVAEGMTIDAACGSAGKSIKTYEY |
Ga0315274_110133871 | 3300031999 | Sediment | MADNSADIAKRIILGCVAEGMTIEQATASSGKSIKTYEYYRR |
Ga0315274_111669012 | 3300031999 | Sediment | MTENSADIAKRIILGCVAENMTVEQACASAGKSLKTYEYYRRSDR |
Ga0315906_101742014 | 3300032050 | Freshwater | VADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYYRRTN |
Ga0315906_103375263 | 3300032050 | Freshwater | MADTTADIAKRVILAAVAEGMTVEAACASAGKSLKSYEYYR |
Ga0315906_105093302 | 3300032050 | Freshwater | MAENSADIAKRIILGCVAENMTVEQACASAGKSLKTYEYYRRSDKIFADK |
Ga0315284_122074813 | 3300032053 | Sediment | MADNSADIAKRIILGCVTEGMTIDAACTSAGKSMK |
Ga0315903_106174811 | 3300032116 | Freshwater | MTEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTYEYYRRTDKVF |
Ga0335396_102622112 | 3300032462 | Freshwater | VPDNSADIAKRVILASVGEGMTVLAACQVAGKSEKT |
Ga0335396_107158872 | 3300032462 | Freshwater | VADNSADISKRIILGCVSEGMTIEQACSSAGKSMK |
Ga0316616_1014126242 | 3300033521 | Soil | MADNSADIAKRIILRCVAEGMTIEMACGEAGKSIKTYEYYRRTDKQFADK |
Ga0334980_0424196_363_500 | 3300033816 | Freshwater | MAENSADIAKRIILGCVAEGMTVEQGCASAGKSIKTYEYYRRTDKV |
Ga0334994_0017884_3_125 | 3300033993 | Freshwater | MAENSADIGKRIILTSVAEGMTIEQACASAGKSIKTYEYYR |
Ga0334979_0184973_2_139 | 3300033996 | Freshwater | MADNSADIAKRIILGAVAEGMTVEAATASAGKSIKTYEYYRRTDKI |
Ga0334986_0071902_1_135 | 3300034012 | Freshwater | MADNSADIAKRIILGCVAEGMTIEQACASAGKSNKTYEYYRRTDK |
Ga0334986_0300279_702_851 | 3300034012 | Freshwater | MAENSADIAKRIILTSVAEGMTVEQACGSAGKSLKTYEYYRRSDKIFADK |
Ga0334986_0486374_2_133 | 3300034012 | Freshwater | MADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYEYYRRTD |
Ga0334987_0437820_703_816 | 3300034061 | Freshwater | MAENSADIGKRIILTSVAEGMTIEQACASAGKSIKTYE |
Ga0334987_0733866_447_560 | 3300034061 | Freshwater | MTENSADIAKRIILGCVAEGMTIEQACASAGKSMKTYE |
Ga0334995_0059206_2933_3076 | 3300034062 | Freshwater | MSEKSSDIAKRLILSGVAEGLTIEAATAAAGKSYKTYEYYRRTDKVFA |
Ga0334995_0503862_1_114 | 3300034062 | Freshwater | MADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTYE |
Ga0334995_0679301_1_111 | 3300034062 | Freshwater | MADNSADIAKRIILGCVAEGMTIEQACASAGKSIKTY |
Ga0335019_0016074_3_131 | 3300034066 | Freshwater | MADNSADIAKRIILGCVAEGMTIDAACGSAGKSIKTYEYYRRT |
Ga0335019_0480965_1_126 | 3300034066 | Freshwater | MTEKSSDIAKRLILSGVAEGLTIEAATAAAGKSYKTYEYYRR |
Ga0335019_0681606_479_592 | 3300034066 | Freshwater | MADNSADIAKRVILGAVAEGMTVEAATASAGKSIKTYE |
Ga0335020_0527354_2_124 | 3300034082 | Freshwater | MAENSADIAKRIILGCVAENMTVEQACASAGKSLKTYEYYR |
Ga0335010_0027711_4228_4335 | 3300034092 | Freshwater | MAEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKT |
Ga0335012_0237968_3_152 | 3300034093 | Freshwater | MTEKSSDIAKRLILSGVAEGLTIEAATAASGKSYKTYEYYRRTDKVFADK |
Ga0335027_0075045_2_109 | 3300034101 | Freshwater | MAENSADIAKRIILSAVAEGMTIEQACISAGKSMKT |
Ga0335027_0425729_714_851 | 3300034101 | Freshwater | MSENSADIAKRIILNCVAEAFTIEQACASAGKSMKTYEYYRRTDKV |
Ga0335029_0442661_1_120 | 3300034102 | Freshwater | MADNSADIAKRIILGCVAEGMTIEQATASAGKSIKTYEYY |
Ga0335029_0473372_625_735 | 3300034102 | Freshwater | MADNSADIAKRVILGAVAEGMTIDAACGSAGKSIKTY |
Ga0335036_0865515_3_119 | 3300034106 | Freshwater | MADNSADIAKRIILGCVAEGMTIEQATASAGKSIKTYEY |
Ga0335051_0348673_1_129 | 3300034109 | Freshwater | MADNSADIAKRVILGAVAEGMTIDAACGSAGKSIKTYEYYRRT |
Ga0335053_0509958_604_708 | 3300034118 | Freshwater | MAENSADIAKRIILGCVAEGMTIEQACASAGKSMK |
Ga0335007_0480345_1_108 | 3300034283 | Freshwater | MSEKSSDIAKRLILSGVAEGLTIEAATAAAGKSYKT |
Ga0335013_0347904_1_111 | 3300034284 | Freshwater | MADNSADIAKRIILGAVAEGMTVEAATASAGKSIKTY |
⦗Top⦘ |