Basic Information | |
---|---|
Family ID | F024524 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 205 |
Average Sequence Length | 41 residues |
Representative Sequence | TLFESEEAMRRGDEALNAMNPGASERRTSVEFYEVPVQTVS |
Number of Associated Samples | 166 |
Number of Associated Scaffolds | 205 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.39 % |
% of genes near scaffold ends (potentially truncated) | 94.63 % |
% of genes from short scaffolds (< 2000 bps) | 95.12 % |
Associated GOLD sequencing projects | 157 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.415 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.585 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.561 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.829 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 205 Family Scaffolds |
---|---|---|
PF13649 | Methyltransf_25 | 4.39 |
PF07040 | DUF1326 | 3.90 |
PF13361 | UvrD_C | 2.93 |
PF13473 | Cupredoxin_1 | 2.93 |
PF00565 | SNase | 2.44 |
PF12680 | SnoaL_2 | 1.95 |
PF01842 | ACT | 1.95 |
PF00909 | Ammonium_transp | 1.46 |
PF03640 | Lipoprotein_15 | 1.46 |
PF05974 | DUF892 | 1.46 |
PF13460 | NAD_binding_10 | 1.46 |
PF01872 | RibD_C | 1.46 |
PF00903 | Glyoxalase | 0.98 |
PF02028 | BCCT | 0.98 |
PF00892 | EamA | 0.98 |
PF00561 | Abhydrolase_1 | 0.98 |
PF00211 | Guanylate_cyc | 0.98 |
PF00563 | EAL | 0.98 |
PF13563 | 2_5_RNA_ligase2 | 0.98 |
PF00999 | Na_H_Exchanger | 0.98 |
PF02738 | MoCoBD_1 | 0.98 |
PF08241 | Methyltransf_11 | 0.98 |
PF07883 | Cupin_2 | 0.98 |
PF08808 | RES | 0.98 |
PF12847 | Methyltransf_18 | 0.49 |
PF00072 | Response_reg | 0.49 |
PF00106 | adh_short | 0.49 |
PF14520 | HHH_5 | 0.49 |
PF00201 | UDPGT | 0.49 |
PF05593 | RHS_repeat | 0.49 |
PF00775 | Dioxygenase_C | 0.49 |
PF08281 | Sigma70_r4_2 | 0.49 |
PF00702 | Hydrolase | 0.49 |
PF04075 | F420H2_quin_red | 0.49 |
PF00571 | CBS | 0.49 |
PF05977 | MFS_3 | 0.49 |
PF00155 | Aminotran_1_2 | 0.49 |
PF00440 | TetR_N | 0.49 |
PF01636 | APH | 0.49 |
PF01243 | Putative_PNPOx | 0.49 |
PF03060 | NMO | 0.49 |
PF00027 | cNMP_binding | 0.49 |
PF01494 | FAD_binding_3 | 0.49 |
PF00117 | GATase | 0.49 |
PF12637 | TSCPD | 0.49 |
PF02628 | COX15-CtaA | 0.49 |
PF00872 | Transposase_mut | 0.49 |
PF13659 | Obsolete Pfam Family | 0.49 |
PF01471 | PG_binding_1 | 0.49 |
PF12706 | Lactamase_B_2 | 0.49 |
PF00005 | ABC_tran | 0.49 |
PF00144 | Beta-lactamase | 0.49 |
PF00248 | Aldo_ket_red | 0.49 |
PF06897 | DUF1269 | 0.49 |
PF13641 | Glyco_tranf_2_3 | 0.49 |
PF00296 | Bac_luciferase | 0.49 |
PF00990 | GGDEF | 0.49 |
PF07719 | TPR_2 | 0.49 |
PF13424 | TPR_12 | 0.49 |
PF12072 | RNase_Y_N | 0.49 |
PF12893 | Lumazine_bd_2 | 0.49 |
PF00171 | Aldedh | 0.49 |
PF04545 | Sigma70_r4 | 0.49 |
PF00370 | FGGY_N | 0.49 |
PF01545 | Cation_efflux | 0.49 |
PF06262 | Zincin_1 | 0.49 |
PF07366 | SnoaL | 0.49 |
PF06772 | LtrA | 0.49 |
PF13328 | HD_4 | 0.49 |
PF03734 | YkuD | 0.49 |
COG ID | Name | Functional Category | % Frequency in 205 Family Scaffolds |
---|---|---|---|
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 3.90 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 1.46 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.46 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.46 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 1.46 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.46 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.98 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.98 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.98 |
COG1292 | Choline-glycine betaine transporter | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 0.98 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.98 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.98 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.98 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.98 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.98 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.98 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.98 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.98 |
COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.98 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.49 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.49 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.49 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.49 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.49 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.49 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.49 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.49 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.49 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.49 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.49 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.49 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.49 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.49 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.49 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.49 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.49 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.49 |
COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.49 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.90 % |
Unclassified | root | N/A | 36.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_10804381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101484533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
3300000956|JGI10216J12902_102835824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1212 | Open in IMG/M |
3300000956|JGI10216J12902_105983022 | Not Available | 1031 | Open in IMG/M |
3300000956|JGI10216J12902_112166806 | Not Available | 627 | Open in IMG/M |
3300000956|JGI10216J12902_114523546 | Not Available | 581 | Open in IMG/M |
3300001686|C688J18823_10130185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1737 | Open in IMG/M |
3300002459|JGI24751J29686_10102792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
3300002568|C688J35102_119231630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 658 | Open in IMG/M |
3300003267|soilL1_10047231 | Not Available | 1363 | Open in IMG/M |
3300004114|Ga0062593_103549227 | Not Available | 501 | Open in IMG/M |
3300004153|Ga0063455_101100710 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300004153|Ga0063455_101356846 | Not Available | 545 | Open in IMG/M |
3300004479|Ga0062595_101213171 | Not Available | 671 | Open in IMG/M |
3300004643|Ga0062591_102066514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → unclassified Agromyces → Agromyces sp. Soil535 | 589 | Open in IMG/M |
3300005148|Ga0066819_1016924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
3300005329|Ga0070683_101923164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
3300005337|Ga0070682_101767111 | Not Available | 539 | Open in IMG/M |
3300005339|Ga0070660_100908399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
3300005339|Ga0070660_101382062 | Not Available | 598 | Open in IMG/M |
3300005340|Ga0070689_100324446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1286 | Open in IMG/M |
3300005340|Ga0070689_102204903 | Not Available | 505 | Open in IMG/M |
3300005341|Ga0070691_10162872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
3300005343|Ga0070687_100752908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300005345|Ga0070692_11085472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300005354|Ga0070675_100588111 | Not Available | 1009 | Open in IMG/M |
3300005367|Ga0070667_101562855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
3300005367|Ga0070667_102212363 | Not Available | 518 | Open in IMG/M |
3300005434|Ga0070709_10482860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
3300005438|Ga0070701_10300353 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300005445|Ga0070708_101535287 | Not Available | 620 | Open in IMG/M |
3300005535|Ga0070684_101479683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300005540|Ga0066697_10399068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 799 | Open in IMG/M |
3300005543|Ga0070672_102037767 | Not Available | 517 | Open in IMG/M |
3300005548|Ga0070665_102655635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Embleya → Embleya scabrispora | 501 | Open in IMG/M |
3300005564|Ga0070664_100630469 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300005614|Ga0068856_101825126 | Not Available | 619 | Open in IMG/M |
3300005764|Ga0066903_108868647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
3300005834|Ga0068851_10723164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus | 614 | Open in IMG/M |
3300005840|Ga0068870_11371272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300005841|Ga0068863_102347072 | Not Available | 543 | Open in IMG/M |
3300005844|Ga0068862_100172359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1938 | Open in IMG/M |
3300005887|Ga0075292_1014783 | Not Available | 998 | Open in IMG/M |
3300006028|Ga0070717_11460362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300006034|Ga0066656_10703699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
3300006755|Ga0079222_11301091 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300006844|Ga0075428_101524401 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300006847|Ga0075431_101792841 | Not Available | 570 | Open in IMG/M |
3300006880|Ga0075429_101000628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 731 | Open in IMG/M |
3300006894|Ga0079215_10588858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → Moorella group → Moorella → Moorella glycerini | 721 | Open in IMG/M |
3300006903|Ga0075426_10009191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7036 | Open in IMG/M |
3300006904|Ga0075424_100819139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 993 | Open in IMG/M |
3300007790|Ga0105679_10252742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides coralli | 1233 | Open in IMG/M |
3300009094|Ga0111539_11676952 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300009098|Ga0105245_10005927 | All Organisms → cellular organisms → Bacteria | 10734 | Open in IMG/M |
3300009098|Ga0105245_11281531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 782 | Open in IMG/M |
3300009156|Ga0111538_11838377 | Not Available | 762 | Open in IMG/M |
3300009156|Ga0111538_12759502 | Not Available | 615 | Open in IMG/M |
3300009162|Ga0075423_11747127 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300009553|Ga0105249_10269030 | Not Available | 1697 | Open in IMG/M |
3300009553|Ga0105249_10525624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
3300009553|Ga0105249_11289543 | Not Available | 802 | Open in IMG/M |
3300010037|Ga0126304_10841342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
3300010038|Ga0126315_10043043 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
3300010038|Ga0126315_10743033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 643 | Open in IMG/M |
3300010038|Ga0126315_11139085 | Not Available | 528 | Open in IMG/M |
3300010039|Ga0126309_10069031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1743 | Open in IMG/M |
3300010039|Ga0126309_10942532 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300010039|Ga0126309_10959340 | Not Available | 571 | Open in IMG/M |
3300010041|Ga0126312_10076478 | Not Available | 2263 | Open in IMG/M |
3300010041|Ga0126312_10674058 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300010042|Ga0126314_10024048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3736 | Open in IMG/M |
3300010042|Ga0126314_10106935 | Not Available | 1907 | Open in IMG/M |
3300010044|Ga0126310_11450219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300010047|Ga0126382_10546327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 942 | Open in IMG/M |
3300010373|Ga0134128_11007964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
3300010373|Ga0134128_13148813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300010399|Ga0134127_10548337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
3300010400|Ga0134122_10570879 | Not Available | 1039 | Open in IMG/M |
3300010401|Ga0134121_11482848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 693 | Open in IMG/M |
3300010401|Ga0134121_12064626 | Not Available | 604 | Open in IMG/M |
3300011332|Ga0126317_10055510 | Not Available | 971 | Open in IMG/M |
3300012001|Ga0120167_1102588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
3300012096|Ga0137389_10521889 | Not Available | 1019 | Open in IMG/M |
3300012184|Ga0136610_1189110 | Not Available | 709 | Open in IMG/M |
3300012186|Ga0136620_10096620 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300012204|Ga0137374_10636172 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300012207|Ga0137381_10289016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1427 | Open in IMG/M |
3300012212|Ga0150985_101135658 | Not Available | 602 | Open in IMG/M |
3300012212|Ga0150985_119388245 | Not Available | 656 | Open in IMG/M |
3300012350|Ga0137372_10194424 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
3300012350|Ga0137372_10643421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. DvalAA-14 | 773 | Open in IMG/M |
3300012469|Ga0150984_100536697 | Not Available | 542 | Open in IMG/M |
3300012679|Ga0136616_10459143 | All Organisms → cellular organisms → Eukaryota | 578 | Open in IMG/M |
3300012897|Ga0157285_10270710 | Not Available | 566 | Open in IMG/M |
3300012900|Ga0157292_10274342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
3300012914|Ga0157297_10261655 | Not Available | 632 | Open in IMG/M |
3300012951|Ga0164300_10398954 | Not Available | 755 | Open in IMG/M |
3300012957|Ga0164303_10405416 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300012961|Ga0164302_11493315 | Not Available | 556 | Open in IMG/M |
3300012984|Ga0164309_10123756 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
3300013100|Ga0157373_11485262 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300013105|Ga0157369_11669580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 647 | Open in IMG/M |
3300013105|Ga0157369_11669584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 647 | Open in IMG/M |
3300013296|Ga0157374_11467872 | Not Available | 705 | Open in IMG/M |
3300013306|Ga0163162_12948052 | Not Available | 547 | Open in IMG/M |
3300014325|Ga0163163_10296000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1671 | Open in IMG/M |
3300014325|Ga0163163_10624757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
3300014326|Ga0157380_10723492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1003 | Open in IMG/M |
3300014326|Ga0157380_11812783 | Not Available | 669 | Open in IMG/M |
3300014487|Ga0182000_10274198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 689 | Open in IMG/M |
3300014969|Ga0157376_12622877 | Not Available | 544 | Open in IMG/M |
3300015161|Ga0167623_1041870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 959 | Open in IMG/M |
3300015201|Ga0173478_10080959 | Not Available | 1149 | Open in IMG/M |
3300015201|Ga0173478_10638033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella aurantiaca | 559 | Open in IMG/M |
3300015358|Ga0134089_10538397 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 516 | Open in IMG/M |
3300015371|Ga0132258_11362371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1792 | Open in IMG/M |
3300015373|Ga0132257_100758589 | Not Available | 1209 | Open in IMG/M |
3300016319|Ga0182033_11012621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
3300017939|Ga0187775_10036181 | Not Available | 1445 | Open in IMG/M |
3300018076|Ga0184609_10240058 | Not Available | 847 | Open in IMG/M |
3300018081|Ga0184625_10314883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
3300018422|Ga0190265_10452677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1390 | Open in IMG/M |
3300018469|Ga0190270_10032170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3428 | Open in IMG/M |
3300018469|Ga0190270_12729492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 557 | Open in IMG/M |
3300018476|Ga0190274_13707164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
3300018910|Ga0193598_1024061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1558 | Open in IMG/M |
3300018910|Ga0193598_1086475 | Not Available | 727 | Open in IMG/M |
3300018918|Ga0193616_1068941 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300019356|Ga0173481_10707530 | Not Available | 545 | Open in IMG/M |
3300019362|Ga0173479_10038944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1493 | Open in IMG/M |
3300019767|Ga0190267_11198167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinokineospora | 556 | Open in IMG/M |
3300019888|Ga0193751_1022774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3057 | Open in IMG/M |
3300020070|Ga0206356_11253336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1467 | Open in IMG/M |
3300021073|Ga0210378_10073579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1339 | Open in IMG/M |
3300021362|Ga0213882_10471633 | Not Available | 535 | Open in IMG/M |
3300022883|Ga0247786_1021206 | Not Available | 1234 | Open in IMG/M |
3300023057|Ga0247797_1041669 | Not Available | 644 | Open in IMG/M |
3300023102|Ga0247754_1199640 | Not Available | 506 | Open in IMG/M |
3300023266|Ga0247789_1018308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
3300023266|Ga0247789_1112988 | Not Available | 549 | Open in IMG/M |
3300025899|Ga0207642_10251324 | Not Available | 1003 | Open in IMG/M |
3300025906|Ga0207699_10367979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
3300025907|Ga0207645_10580668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
3300025909|Ga0207705_10872828 | Not Available | 697 | Open in IMG/M |
3300025914|Ga0207671_11185090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
3300025914|Ga0207671_11566367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Embleya → Embleya scabrispora | 507 | Open in IMG/M |
3300025925|Ga0207650_11162106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
3300025927|Ga0207687_10391703 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300025932|Ga0207690_10363408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1147 | Open in IMG/M |
3300025932|Ga0207690_10373546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
3300025932|Ga0207690_11525504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300025932|Ga0207690_11559779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia | 552 | Open in IMG/M |
3300025933|Ga0207706_10202716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Polymorphobacter → Polymorphobacter multimanifer | 1740 | Open in IMG/M |
3300025934|Ga0207686_10027637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3323 | Open in IMG/M |
3300025934|Ga0207686_10731617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300025935|Ga0207709_10418948 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300025935|Ga0207709_11548630 | Not Available | 550 | Open in IMG/M |
3300025937|Ga0207669_11334472 | Not Available | 610 | Open in IMG/M |
3300025938|Ga0207704_10055465 | Not Available | 2422 | Open in IMG/M |
3300025938|Ga0207704_10806824 | Not Available | 784 | Open in IMG/M |
3300025938|Ga0207704_10957628 | Not Available | 722 | Open in IMG/M |
3300025941|Ga0207711_10566107 | Not Available | 1060 | Open in IMG/M |
3300025944|Ga0207661_10407162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1234 | Open in IMG/M |
3300025986|Ga0207658_11248512 | Not Available | 679 | Open in IMG/M |
3300026075|Ga0207708_11826227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
3300026078|Ga0207702_10233482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1720 | Open in IMG/M |
3300026089|Ga0207648_10023447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5528 | Open in IMG/M |
3300026118|Ga0207675_100244029 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300027907|Ga0207428_10931346 | Not Available | 613 | Open in IMG/M |
3300028380|Ga0268265_12289320 | Not Available | 547 | Open in IMG/M |
3300028578|Ga0272482_10166019 | Not Available | 662 | Open in IMG/M |
3300028589|Ga0247818_10473747 | Not Available | 851 | Open in IMG/M |
3300028705|Ga0307276_10186871 | Not Available | 541 | Open in IMG/M |
3300028708|Ga0307295_10242445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300028718|Ga0307307_10086958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
3300028718|Ga0307307_10236821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300028744|Ga0307318_10138915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300028755|Ga0307316_10182594 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300028768|Ga0307280_10135686 | Not Available | 842 | Open in IMG/M |
3300028782|Ga0307306_10083755 | Not Available | 834 | Open in IMG/M |
3300028787|Ga0307323_10092269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. DBS9H8 | 1084 | Open in IMG/M |
3300028796|Ga0307287_10111228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus xanthus | 1035 | Open in IMG/M |
3300028814|Ga0307302_10078934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1557 | Open in IMG/M |
3300028814|Ga0307302_10432851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
3300028824|Ga0307310_10475078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 628 | Open in IMG/M |
3300028828|Ga0307312_10960534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 566 | Open in IMG/M |
3300028875|Ga0307289_10122248 | Not Available | 1067 | Open in IMG/M |
3300028876|Ga0307286_10134093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 882 | Open in IMG/M |
3300030510|Ga0268243_1033925 | Not Available | 1061 | Open in IMG/M |
3300030829|Ga0308203_1043882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
3300031547|Ga0310887_10561197 | Not Available | 695 | Open in IMG/M |
3300031731|Ga0307405_11425692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300031747|Ga0318502_10252687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
3300031847|Ga0310907_10663599 | Not Available | 574 | Open in IMG/M |
3300031852|Ga0307410_11264236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
3300031908|Ga0310900_10389778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
3300031938|Ga0308175_102493885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
3300031995|Ga0307409_101559819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 688 | Open in IMG/M |
3300031996|Ga0308176_12062221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300031996|Ga0308176_12695117 | Not Available | 529 | Open in IMG/M |
3300032002|Ga0307416_101583746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300032075|Ga0310890_11008074 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300032126|Ga0307415_101027273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 768 | Open in IMG/M |
3300033551|Ga0247830_10504302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.59% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.39% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.41% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.44% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.44% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.95% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.95% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.46% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.46% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.49% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.49% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.49% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.49% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.49% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.49% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.49% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.49% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018910 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 18 hrs after wetting v1 | Environmental | Open in IMG/M |
3300018918 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_108043811 | 3300000363 | Soil | SEEAMRRGDKALNAMNPGASERRVSVEFYEVPVQTVS* |
INPhiseqgaiiFebDRAFT_1014845333 | 3300000364 | Soil | DSEEAMRRGDEALNAMSPGASERRTSVEFYEVPVETVTS* |
JGI10216J12902_1028358242 | 3300000956 | Soil | TLFESEEAMRKGDETLNAMNPGASERRLSVEFFEVPVQTVS* |
JGI10216J12902_1059830221 | 3300000956 | Soil | SEEAMRRGDEALNAMNPGGTERRTSVEFFEVPVQTVR* |
JGI10216J12902_1121668062 | 3300000956 | Soil | AMRRGDEVLNAMNPSGGGQRTSVEFYEVPVQTVS* |
JGI10216J12902_1145235462 | 3300000956 | Soil | VTLFESEEAMRRGDEALNAMNPGAGGRRTSVEFYEVPVQTVS* |
C688J18823_101301851 | 3300001686 | Soil | LGVTLFDSEEAMRRGDEALNAMSPGGTERRTSVEFYEVPVQTVAD* |
JGI24751J29686_101027922 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | DSKDAMRRGDEALNAMSPGGTERRTSVEFFEVPVQTVTAEXVA* |
C688J35102_1192316301 | 3300002568 | Soil | LFESEEAMRRGDEALNAMNPGTTERRTSVEFYEVPVQTVS* |
soilL1_100472311 | 3300003267 | Sugarcane Root And Bulk Soil | IFESEEAMRRGDEALNAMSPGGTERRVAVEFFEVPVQTMS* |
Ga0062593_1035492272 | 3300004114 | Soil | KGLGITLFESEEAMRRGDEALNAMDPGPAERRLSVEFFEVPIETATGS* |
Ga0063455_1011007102 | 3300004153 | Soil | LGVTLFDSEEAMRRGDEALNAMSPGGTERRTGVEFYEVPVQTVS* |
Ga0063455_1013568461 | 3300004153 | Soil | LFDSEEALRRGDEALNAMSPGGTERRTSVEFFEVPVQTIG* |
Ga0062595_1012131711 | 3300004479 | Soil | KGLGVTLFESEEAMRRGDEALNAMNPGMSGSRTSVEFFEVPVHNLD* |
Ga0062591_1020665142 | 3300004643 | Soil | SGKGVGITLFDSEDAMRRGDEALNAMNPGGTERRLSVEFFEVPVQTIG* |
Ga0066819_10169242 | 3300005148 | Soil | KGVGITLFDSEQAMQRGDAALNAMNPGAGERRTSVEFFEVPVHTVS* |
Ga0070683_1019231641 | 3300005329 | Corn Rhizosphere | GKGLGVTLFESEEAMRRGDEALDALDPGPAERRLSVEFFEVPIETATGS* |
Ga0070682_1017671111 | 3300005337 | Corn Rhizosphere | TLFESEEAMRRGDEALNAMDPGATERRTSVEFYEVPVETISG* |
Ga0070660_1009083991 | 3300005339 | Corn Rhizosphere | VTLFESEEAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS* |
Ga0070660_1013820621 | 3300005339 | Corn Rhizosphere | ADEDAMRRGDEALNAMNPTGSGERRTSVEFYEVPVETIS* |
Ga0070689_1003244461 | 3300005340 | Switchgrass Rhizosphere | ESEEAMRRGDEALDAIDPGPAERRLSVEFFEVPIETATGS* |
Ga0070689_1022049031 | 3300005340 | Switchgrass Rhizosphere | GVTLFETEDAMRRGDDALNAMDPGSTERRVSVEFFEVPVQTVS* |
Ga0070691_101628721 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | TLFESEQAMQRGDAALNAMTPGAGERRTSVEFFEVPVQTVT* |
Ga0070687_1007529081 | 3300005343 | Switchgrass Rhizosphere | FDSEEAMRRGDEALNAMSPGATERRTSVEFFEVPVQTVQ* |
Ga0070692_110854722 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | SEDAMRQGDEALNAMNPPATSGRRTGVEFYEVPVQTVSKEF* |
Ga0070675_1005881112 | 3300005354 | Miscanthus Rhizosphere | GLGVTLFESEEAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS* |
Ga0070667_1015628552 | 3300005367 | Switchgrass Rhizosphere | LFADEDAMRRGDEALNAMNPTGSGERRTSVEFYEVPVETIS* |
Ga0070667_1022123631 | 3300005367 | Switchgrass Rhizosphere | GITLFDSEEAMRRGDEALNAMSPGATERRTSVEFFEVPVQTVQ* |
Ga0070709_104828601 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GVGITLFESEQAMQRGDAALNAMNPGAGERRTSVEFFEVPVHTVS* |
Ga0070701_103003531 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | FESEEAMRRGDEALNAMSPGATERRMSVEFFEVPVQTVQ* |
Ga0070708_1015352871 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RRRVTLFESDEAMRRGDEALNAMNPSSGEQRMSVEFFEVPVQTLS* |
Ga0070684_1014796831 | 3300005535 | Corn Rhizosphere | TLFESEEAMRRGDEALNAMNPGASERRTSVEFYEVPVQTVS* |
Ga0066697_103990681 | 3300005540 | Soil | VGVTLFESEEAMRRGDEALNAMNPGSGERRTSVEFFEVPVHTVG* |
Ga0070672_1020377671 | 3300005543 | Miscanthus Rhizosphere | AMRRGDEALNAMSPGATERRTSVEFFEVPVQTVQ* |
Ga0070665_1026556352 | 3300005548 | Switchgrass Rhizosphere | EDAMRRGDEALNAMSPGGTESRVSVEFYEVPVQTVM* |
Ga0070664_1006304691 | 3300005564 | Corn Rhizosphere | VTLFESEEAMQRGDEALNAMNPGGTERRTSVEFYEVPVQTVT* |
Ga0068856_1018251262 | 3300005614 | Corn Rhizosphere | LYESEEAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS* |
Ga0066903_1088686471 | 3300005764 | Tropical Forest Soil | AMRRGDEALNAMSPGSSERRTSVEFFEVPVQTVH* |
Ga0068851_107231641 | 3300005834 | Corn Rhizosphere | FESEEAMRRGDEALNAMSTSGTERRTSVEFFEVPVQTVG* |
Ga0068870_113712722 | 3300005840 | Miscanthus Rhizosphere | AMRRGDEALNAMSPTGSGEQRTSVEFFEVPVETIS* |
Ga0068863_1023470722 | 3300005841 | Switchgrass Rhizosphere | SEEAMRRGDEALNAMSPGATERRTSVEFFEVPVQTVQ* |
Ga0068862_1001723594 | 3300005844 | Switchgrass Rhizosphere | LGITLFADAEALRRGDAALDAMSPGGTERRVSVEFYEVPVQTVM* |
Ga0075292_10147831 | 3300005887 | Rice Paddy Soil | GLGITLFDSEEAMRRGDEALNAMNPGDASGRRTSVEFYEVPVQTIA* |
Ga0070717_114603621 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QAMQRGDAALNAMNPGAGERRTSVEFFEVPVHTVS* |
Ga0066656_107036991 | 3300006034 | Soil | GVTLFDSEEAMRRGDEALNAMSPGANESRTGVEFFEVPVQTVS* |
Ga0079222_113010912 | 3300006755 | Agricultural Soil | LFESEEAMRRGDEALNAMDPGATERRTSVEFYEVPVETISG* |
Ga0075428_1015244013 | 3300006844 | Populus Rhizosphere | EAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS* |
Ga0075431_1017928411 | 3300006847 | Populus Rhizosphere | EAMRRGDEALNAMSPGASERRTSVEFYEVPVQTVS* |
Ga0075429_1010006282 | 3300006880 | Populus Rhizosphere | MRRGDEALNAMSPGATERRTSVEFYEVPVETVTS* |
Ga0079215_105888581 | 3300006894 | Agricultural Soil | KGLGVTLFESQDAMRRGDEALNAMNPGGTERRTSVEFFEVPVQTVR* |
Ga0075426_100091911 | 3300006903 | Populus Rhizosphere | FESEQAMQRGDAALNAMNPGAGERRTSVEFFEVPVHTVS* |
Ga0075424_1008191391 | 3300006904 | Populus Rhizosphere | TGKGVGITLFDSEEAMRRGDEALNAMSPGGTEQRTSVDFFEVPVQTVS* |
Ga0105679_102527422 | 3300007790 | Soil | ITLFESEEAMRRGDEALNAMNPRGTERRTSVEFFEVPVRTVA* |
Ga0111539_116769522 | 3300009094 | Populus Rhizosphere | VTLFETEDAMRRGDDALNAMDPGSTERRVSVEFFEVPVQTVN* |
Ga0105245_100059271 | 3300009098 | Miscanthus Rhizosphere | KGLGVTLFETEDAMRRGDDALNAMDPGSTERRVSVEFFEVPVQTVS* |
Ga0105245_112815311 | 3300009098 | Miscanthus Rhizosphere | TLFDNEEAMRRGDAALNAMSPGGSERRTSVEFYEVPVHTVT* |
Ga0111538_118383771 | 3300009156 | Populus Rhizosphere | ESEEAMRRGDEALNAMNPGASERRVSVEFFEVPVQTISS* |
Ga0111538_127595022 | 3300009156 | Populus Rhizosphere | GIGITLFADEDAMRRGDEALNAMNPTGSGERRTSVEFYEVPVETIS* |
Ga0075423_117471273 | 3300009162 | Populus Rhizosphere | FDSEEAMRRGDEALNAMNPGSGGQRTSVEFYEVPVQTVT* |
Ga0105249_102690303 | 3300009553 | Switchgrass Rhizosphere | LGVTLFESEEAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS* |
Ga0105249_105256241 | 3300009553 | Switchgrass Rhizosphere | DEAAMRRGDEALNAMSPGSTERRTSVEFFEVPVQTVS* |
Ga0105249_112895431 | 3300009553 | Switchgrass Rhizosphere | TLFESEEAMRRGDEALNAMNPGPTETRTSVEFFEVPVQTVS* |
Ga0126304_108413421 | 3300010037 | Serpentine Soil | AMRRGDEALNAMNPGASERRTSVEFYEVPVQTVT* |
Ga0126315_100430433 | 3300010038 | Serpentine Soil | VTLFDTEEAMRRGDEALNAMNPPGASGRRTAVDFYEVPVETVS* |
Ga0126315_107430331 | 3300010038 | Serpentine Soil | EEAMRRGDEALNAMNPGATERRTSVEFYEVPVQTVS* |
Ga0126315_111390851 | 3300010038 | Serpentine Soil | EEAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS* |
Ga0126309_100690311 | 3300010039 | Serpentine Soil | KGLGVTLFDSEEAMRRGDEALNAMDPGATERRTSVDFYEVPVETVT* |
Ga0126309_109425321 | 3300010039 | Serpentine Soil | TLFESEEAMRRGDEALNAMSPGGSERRTSVEFYEVPVQTVS* |
Ga0126309_109593401 | 3300010039 | Serpentine Soil | SEDAMRRGDEALNAMSPGGSERRMSVEFYEVPVQTVR* |
Ga0126312_100764781 | 3300010041 | Serpentine Soil | VTLFESEEAMRRGDEALNAMNPGGTERRTSVEFFEVPVQTVT* |
Ga0126312_106740581 | 3300010041 | Serpentine Soil | EEAMRRGDEALDAMSPGPTETRTSVEFYEVPVQTVS* |
Ga0126314_100240485 | 3300010042 | Serpentine Soil | GLGITLFDSEDAMRRGDEALNAMNPGASERRTSVEFFEVPVQTAVS* |
Ga0126314_101069351 | 3300010042 | Serpentine Soil | ITLFESEDAMRRGDEALNAMDPGGSERRTSVEFYEVPVQTVS* |
Ga0126310_114502192 | 3300010044 | Serpentine Soil | TGKGLGVTLFEDEEAMRRGDEALNAMNPGASERRTSVEFYEVPVQTVT* |
Ga0126382_105463271 | 3300010047 | Tropical Forest Soil | VWDDAPGDEALNAMNPGANERRVSVEFFEVPVQTVT* |
Ga0134128_110079642 | 3300010373 | Terrestrial Soil | GITLFESEEAMRRGDAALNAMDPGSTERRTSVEFYEVPVETISGSRRTIGR* |
Ga0134128_131488131 | 3300010373 | Terrestrial Soil | KGLGVTLFETEDAMRRGDDALNAMDPGSTERRVSVEFFEVPVQTVN* |
Ga0134127_105483371 | 3300010399 | Terrestrial Soil | KGIGITLFDSEEAMRRGDEALNNMTPGASERRTSVEFFEVPVETVTG* |
Ga0134122_105708793 | 3300010400 | Terrestrial Soil | GVTLFDSEAAMRRGDEALNAMNPGGAERRVSVEFFEVPVHTVD* |
Ga0134121_114828482 | 3300010401 | Terrestrial Soil | FESEEAMHRGDEALNAMSPGASERRTAVEFFEVPVQTVD* |
Ga0134121_120646262 | 3300010401 | Terrestrial Soil | VTLFESEEAMRRGDEALNAMSPGGTERRTSVEFYEVPVQTVN* |
Ga0126317_100555101 | 3300011332 | Soil | EEAMRRGDEALNAMSPGSSERRTSVEFFEVPVHTVD* |
Ga0120167_11025881 | 3300012001 | Permafrost | MLFESEEAMRRGDDALNAMPGGGGRVSVEFYEVPVQTLT* |
Ga0137389_105218891 | 3300012096 | Vadose Zone Soil | MRRGDEALNAMNPGAGERRTSVEFYEVPVQTITS* |
Ga0136610_11891103 | 3300012184 | Polar Desert Sand | ESEEAMRRGDEALNAMSPGATERRTSVDFYEVPVQTVS* |
Ga0136620_100966202 | 3300012186 | Polar Desert Sand | FESEEAMRRGDEALNAMNPGVSERRTSVEFYEVPVQTVS* |
Ga0137374_106361722 | 3300012204 | Vadose Zone Soil | FDSEEAMHRGDAALNAMTPGAGEARTSVEFYEVPVQTVS* |
Ga0137381_102890162 | 3300012207 | Vadose Zone Soil | GITLFESEEAMRRGDEALNAMTPGPSGQRTSVEFYEVPVHKHG* |
Ga0150985_1011356581 | 3300012212 | Avena Fatua Rhizosphere | TLFESEEAMRRGDEALNAMSPGESERRTSVEFYEVPVHTVT* |
Ga0150985_1193882452 | 3300012212 | Avena Fatua Rhizosphere | FDSEEALRRGDEALNAMSPGGTERRTSVEFFEVPVQTIG* |
Ga0137372_101944241 | 3300012350 | Vadose Zone Soil | TLFDSEEAMRRGDAALNAMNPGASERRTSVDFYEVPVQTVSV* |
Ga0137372_106434211 | 3300012350 | Vadose Zone Soil | TLFDSEEAMRRGDAALNAMNPGASERRTSVDFYEVPVQTVSS* |
Ga0150984_1005366971 | 3300012469 | Avena Fatua Rhizosphere | GKGIGITLFESEEAMSRGDEALNAMNPGGSERRTSVEFYEVPVQTVL* |
Ga0136616_104591431 | 3300012679 | Polar Desert Sand | EEAMRRGDEALNAMNPGASERRLSVEFFEVPVQTVS* |
Ga0157285_102707101 | 3300012897 | Soil | DAMRRGDEALNAMSPGASERRTSVDFYEVPVQTVS* |
Ga0157292_102743421 | 3300012900 | Soil | ESEEAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS* |
Ga0157297_102616551 | 3300012914 | Soil | TGKGLGVTRFDSEEAMPRGDEALNATNPGGTERRTSVEFYEVPVQTFS* |
Ga0164300_103989542 | 3300012951 | Soil | AMRRGDEALNTMNPGSTERRVSVEFFEVPVQTVS* |
Ga0164303_104054162 | 3300012957 | Soil | GVGVTLFESEEAMRRGDEALNAMNPGASERRVSVEFFEVPVQTISS* |
Ga0164302_114933152 | 3300012961 | Soil | TLFESEEAMRRGDEALNEMSPGSSERRTSVEFFEVPVHTVD* |
Ga0164309_101237561 | 3300012984 | Soil | GKGVGITLFESEDAMRRGDEALNAMSPGGSERRVSVEFFEVPVETVT* |
Ga0157373_114852622 | 3300013100 | Corn Rhizosphere | RASGKGYGITLYDTEDAMRRGDEALKAMPGAGGTRLAVEFFEVPVHTLG* |
Ga0157369_116695802 | 3300013105 | Corn Rhizosphere | ITLYDTEDAMRRGDEALKAMPGAGGTRLAVEFFEVPVHTLG* |
Ga0157369_116695842 | 3300013105 | Corn Rhizosphere | ITLYDTEDAMRRGDEALKAMPGAGGTRLAVEFFEVPVHTLA* |
Ga0157374_114678721 | 3300013296 | Miscanthus Rhizosphere | GMGITLFESEEAMRRGDAALNAMDPGATERRTSVEFYEVPVETISG* |
Ga0163162_129480523 | 3300013306 | Switchgrass Rhizosphere | VTLFESEEAMRRGDEALNAMNPGASERRVSVEFFEVPVQTISS* |
Ga0163163_102960001 | 3300014325 | Switchgrass Rhizosphere | EEAMRRGDEALSAMSPGGTESRVSVEFYEVPVQTVM* |
Ga0163163_106247571 | 3300014325 | Switchgrass Rhizosphere | RRGDEVLNAMSPPGEGLGRRTSVDMYEVGVDVRE* |
Ga0157380_107234923 | 3300014326 | Switchgrass Rhizosphere | VRRGDEALNAMNPTGSGERRTSVEFYEVPVETIS* |
Ga0157380_118127831 | 3300014326 | Switchgrass Rhizosphere | AMRRGDEALNAMSPGASEQRTSVEFYEVPVQTVH* |
Ga0182000_102741982 | 3300014487 | Soil | VTLFESEEAMRRGDEALNAMSPGGTERRTSVEFYEVPVQTVD* |
Ga0157376_126228772 | 3300014969 | Miscanthus Rhizosphere | GKGVGVTLFDSEAAMRRGDEALNAMNPGGAERRVSVEFFEVPVHTVD* |
Ga0167623_10418701 | 3300015161 | Glacier Forefield Soil | ESEEAMRRGDEALNAMDPGADERRTSVEFYEVPVKTVS* |
Ga0173478_100809594 | 3300015201 | Soil | FESEEAMRRGDEALNAMDPGPAERRLSVEFFEVPIETATGS* |
Ga0173478_106380331 | 3300015201 | Soil | TGKGLGVTLFETEDAMRRGDEALNAMDPGSTERRVSVEFFEVPVQTVS* |
Ga0134089_105383971 | 3300015358 | Grasslands Soil | LGVTLFDSQEAMRRGDEALNAMSPGGSERRTSVEFFEVPVQTVS* |
Ga0132258_113623714 | 3300015371 | Arabidopsis Rhizosphere | LGITLFESEEAMRRGDEALNAIDPGPAERRLSVEFFEVPIETATGS* |
Ga0132257_1007585893 | 3300015373 | Arabidopsis Rhizosphere | DLRRGDEALNAMSPGASGRRTSVEFFEVPVETVTD* |
Ga0182033_110126211 | 3300016319 | Soil | LFDDEAAMRRGDQALNAMNPGSTERRTSVEFYEVPVQTIM |
Ga0187775_100361811 | 3300017939 | Tropical Peatland | SEEAMRRGDEALNAMNPGASERRTSVEFYEVPVQTVS |
Ga0184609_102400581 | 3300018076 | Groundwater Sediment | DTEEAMRRGDAALNAMNPPGASGRRTAVDFYEVPVETVS |
Ga0184625_103148832 | 3300018081 | Groundwater Sediment | VGVTLFESEDAMRRGDEALNAMNPGGVERRVSVEFFEVPVQTVT |
Ga0190265_104526771 | 3300018422 | Soil | MFARIATFESEEAMRRGDEALNAMTPDGTERRTSVKFFEVPVQTVA |
Ga0190270_100321703 | 3300018469 | Soil | VIPANVDDAIGMVRADEALNAMNPGGTERRTSVEFYEVPVQTVT |
Ga0190270_127294922 | 3300018469 | Soil | GKGLGITLFESEDAMRRGDQALNAMNPGPTERRTSVDFFEVPVQTVS |
Ga0190274_137071642 | 3300018476 | Soil | ESEEAMRRGDEALNAMNPGSTERRTSVEFYEVPVQTVS |
Ga0193598_10240611 | 3300018910 | Soil | TLSESEEAMRRGDEALNAMSPGATERRTSVDFYEVPVQTVS |
Ga0193598_10864752 | 3300018910 | Soil | FESEEAMRRGHEALDAMDPGGTEQRTSVEFYEVPVQTVS |
Ga0193616_10689412 | 3300018918 | Soil | LRFFESEEAMRRGDEALNAMSPGATERRTSVDFYEVPVQTVS |
Ga0173481_107075302 | 3300019356 | Soil | LGVTLFDSEDAMRRGDEALNAMSPGASERRTSVEFYEVPVQTVS |
Ga0173479_100389444 | 3300019362 | Soil | TLFESEEAMRRGDEALDAIDPGPAERRLSVEFFEVPIETATGS |
Ga0190267_111981671 | 3300019767 | Soil | KGLGVTLFESEEAMRRGDAALNAMSPGASERRTSVEFYEVPVQTVT |
Ga0193751_10227745 | 3300019888 | Soil | MFEREEAMRRGDEALNAMNPGAGTPASVDLYEVPAHTLG |
Ga0206356_112533363 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GVGITLFESEQAMQRGDAALNAMTPGAGERRTSVEFFEVPVQTVT |
Ga0210378_100735791 | 3300021073 | Groundwater Sediment | TEEAMRRGDAALNAMNPPGASGRRTAVDFYEVPVETVS |
Ga0213882_104716332 | 3300021362 | Exposed Rock | VTLFESEEAMRRGDEALNAMNPGASERRTSVEFYEVPIYTVS |
Ga0247786_10212063 | 3300022883 | Soil | ESEEAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS |
Ga0247797_10416692 | 3300023057 | Soil | EDAMRRGDEALNAMDPGSTERRVSVEFFEVPVHTVS |
Ga0247754_11996401 | 3300023102 | Soil | EAMRRGDEALNAMDPGPAERRLSVEFFEVPIETATGS |
Ga0247789_10183081 | 3300023266 | Soil | FEDEEAMRRGDEALNAMNPGGTEQRTSVEFFEVPVHTVS |
Ga0247789_11129881 | 3300023266 | Soil | SEDAMRRGDEALNGMNPGGTERRTSVEFFEVPVETVSQRD |
Ga0207642_102513242 | 3300025899 | Miscanthus Rhizosphere | FADEDAMRRGDEALNAMNPTGSGERRTSVEFYEVPVETIS |
Ga0207699_103679791 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GVGITLFESEQAMQRGDAALNAMNPGAGERRTSVEFFEVPVHTVS |
Ga0207645_105806681 | 3300025907 | Miscanthus Rhizosphere | FDSEDAMRRGDEALNKMNPTGSGERRTSVEFYEVPVETIS |
Ga0207705_108728281 | 3300025909 | Corn Rhizosphere | LGVTLFESEEAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS |
Ga0207671_111850901 | 3300025914 | Corn Rhizosphere | RRGDEALNAMSPGGTERRTSVEFFEVPVQTVTAEHVA |
Ga0207671_115663671 | 3300025914 | Corn Rhizosphere | TLFADEEAMRRGDEALNAMSPGGTESRVSVEFYEVPVQTVM |
Ga0207650_111621061 | 3300025925 | Switchgrass Rhizosphere | ITLFESEDAMRRGDEALNAMSPGGTERRTSVEFFEVPVQTLH |
Ga0207687_103917033 | 3300025927 | Miscanthus Rhizosphere | LFADEEAMRRGDEALNAMSPGGTESRVSVEFYEVPVQTVM |
Ga0207690_103634083 | 3300025932 | Corn Rhizosphere | AMRRGDEALDAIDPGPAERRLSVEFFEVPIETATGS |
Ga0207690_103735462 | 3300025932 | Corn Rhizosphere | DEEAMRRGDEALNAMNPGGTEQRTSVEFFEVPVHTVS |
Ga0207690_115255042 | 3300025932 | Corn Rhizosphere | FDSEDAMRRGDEALNNMSPGASERRTSVEFYEVPVETVTG |
Ga0207690_115597792 | 3300025932 | Corn Rhizosphere | GKGIGVTLFDSEEAMRRGDEALNKMNPTGSGERRTSVEFYEVPVETIS |
Ga0207706_102027162 | 3300025933 | Corn Rhizosphere | LFESEEAMRRGDEALNAIDPGPAERRLSVEFFEVPIETATGA |
Ga0207686_100276371 | 3300025934 | Miscanthus Rhizosphere | ITLFDSEDAMRRGDEALNAMNPGNNERRTSVEFYEVPVHTIG |
Ga0207686_107316171 | 3300025934 | Miscanthus Rhizosphere | DSEDAMRRGDEALNNMSPGASERRTSVEFYEVPVETVTG |
Ga0207709_104189483 | 3300025935 | Miscanthus Rhizosphere | ITLFADEEAMRRGDEALNAMSPGGTESRVSVEFYEVPVQTVM |
Ga0207709_115486301 | 3300025935 | Miscanthus Rhizosphere | ITLFADEDAMRRGDEALNAMNPTGSGERRTSVEFYEVPVETIS |
Ga0207669_113344721 | 3300025937 | Miscanthus Rhizosphere | FDSEEAMRRGDEALNAMSPGATERRTSVEFFEVPVQTVQ |
Ga0207704_100554651 | 3300025938 | Miscanthus Rhizosphere | FDSEAAMRRGDEALNAMNPGGAERRVSVEFFEVPVHTVD |
Ga0207704_108068241 | 3300025938 | Miscanthus Rhizosphere | AMRRGDEALNAMNPTGSGERRTAVEFYEVPVETIS |
Ga0207704_109576282 | 3300025938 | Miscanthus Rhizosphere | ITFFDSEEAMRRGDEALNAMNPGQTERRTSVEFFEVPVQTVS |
Ga0207711_105661071 | 3300025941 | Switchgrass Rhizosphere | KGLGVTLFDSEDAMRRGDEALNNMSPGASERRTSVEFYEVPVQTVS |
Ga0207661_104071622 | 3300025944 | Corn Rhizosphere | LFADEDAMRRGDEALNAMNPTGSGERRTAVEFYEVPVETIS |
Ga0207658_112485122 | 3300025986 | Switchgrass Rhizosphere | GITLFADEDAMRRGDEALNAMNPTGSGERRTSVEFYEVPVETIS |
Ga0207708_118262272 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | EAMRRGDEALNAMNPGGTERRTSVEFYEVPVQTVS |
Ga0207702_102334824 | 3300026078 | Corn Rhizosphere | LFESEEAMRRGDAALNAMDPGATERRTSVEFYEVPVETISG |
Ga0207648_100234472 | 3300026089 | Miscanthus Rhizosphere | VTLFETEDAMRRGDGALNAMDPGSTERRVSVEFFEVPVQTVS |
Ga0207675_1002440291 | 3300026118 | Switchgrass Rhizosphere | EAMRRGDEALNAMNPGPTETRTSVEFFEVPVQTVS |
Ga0207428_109313461 | 3300027907 | Populus Rhizosphere | IESDEAMRRGDEALNAMNPSSGEQRMSVEFFEVPVQTLS |
Ga0268265_122893201 | 3300028380 | Switchgrass Rhizosphere | SGKGVGITLFDSEEAMRRGDEALNAMSPGATERRTSVEFFEVPVQTVQ |
Ga0272482_101660191 | 3300028578 | Soil | AMRRGDEALNAMSPGATERRTSVEFYEVPVETVSQP |
Ga0247818_104737472 | 3300028589 | Soil | VTLFDSEEAMRRGDEALNKMNPTGSGERRTSVEFYEVPVETIS |
Ga0307276_101868711 | 3300028705 | Soil | SEEALRRGDTALNAMNPGASERRTSVEFYEVPVQTVAD |
Ga0307295_102424452 | 3300028708 | Soil | TLFESEDALRRGDEALNAMNPGGAEHRVSVEFFEVPVQTVT |
Ga0307307_100869582 | 3300028718 | Soil | GKGLGVSLYDSEEAMRRGDEALNAMNPPSESGRRTAVEFYEVPVQTVN |
Ga0307307_102368211 | 3300028718 | Soil | FEREDAMRRGDEALNAMDPSPAASRTAVEFFEVPVQTVS |
Ga0307318_101389151 | 3300028744 | Soil | EEAMRRGDEALNAMNPGSTERRTSVEFYEVPVQTVS |
Ga0307316_101825941 | 3300028755 | Soil | EEAMRRGDDALNAMNPGANERRTSVDFYEVPVVKSQGVV |
Ga0307280_101356863 | 3300028768 | Soil | GRGLGVTLFDSEEAMRRGDEALNAMSPGATERRTSVEFFEVPVHTVD |
Ga0307306_100837551 | 3300028782 | Soil | DSEEAMRRGDEALNAMSPGGTERRTSVEFYEVPVQTVAD |
Ga0307323_100922691 | 3300028787 | Soil | EEAMRRGDAALNAMNPGANERRTSVDFYEVPVQTVAP |
Ga0307287_101112281 | 3300028796 | Soil | KGLGVSIFESEEAMRRGDEALNAMTPGASERRTSVEFYEVPVQTVT |
Ga0307302_100789342 | 3300028814 | Soil | TGKGLGITLFDSEEAMRRGDTALNAMNPGATERRTSVEFYEVPVQTVAD |
Ga0307302_104328512 | 3300028814 | Soil | FESEEAMRRGDEALNVMSPGASERRTSVEFYEVPVQTVT |
Ga0307310_104750781 | 3300028824 | Soil | TLFDTEEDMRRGDEALNSMNPGSSERRTSVEFYEVPVDTLTG |
Ga0307312_109605341 | 3300028828 | Soil | AMRRGDEALNAMNPPGESGRRTAVEFYEVPVETVS |
Ga0307289_101222481 | 3300028875 | Soil | SEEAMRRGDEALNAMSPGATERRTSVEFFEVPVQTVG |
Ga0307286_101340932 | 3300028876 | Soil | GITLFESEDAMRRGDEALNGMNPGGTERRTSVEFFEVPVETVSQRD |
Ga0268243_10339252 | 3300030510 | Soil | ETGKGLGVTLFESEEAMRRGDATLNAMSPGGSERRTSVEFYEVPVQTVA |
Ga0308203_10438822 | 3300030829 | Soil | LFESEDAMRRGDEALNAMNPGGAEHRVSVEFFEVPVQTVT |
Ga0310887_105611972 | 3300031547 | Soil | KGLGVTLFDSEEDLRRGDEALNAMSPGASERRTSVEFFEVPVETVTD |
Ga0307405_114256921 | 3300031731 | Rhizosphere | GLGVTLFESEEAMRRGDEALNAMNPGATERRTSVEFYEVPVQTVS |
Ga0318502_102526873 | 3300031747 | Soil | SEDAMRRGDEALNAMTPGASERRTSVEFYEVPVQTVS |
Ga0310907_106635992 | 3300031847 | Soil | SDEAMRRGDEALNAMNPSSGEQRMSVEFFEMPVQTLS |
Ga0307410_112642362 | 3300031852 | Rhizosphere | EEAMRRGDEALNAMSARGESRTSVEFYEVPVQTVS |
Ga0310900_103897781 | 3300031908 | Soil | LGVTLFESEEAMRRGDETLNAMNPGSTERRTSVEFYEVPVQTVS |
Ga0308175_1024938851 | 3300031938 | Soil | GKGIGITLFESEDAMRRGDEALNAMNPGMSGSRTGVEYYEVPVHKLD |
Ga0307409_1015598191 | 3300031995 | Rhizosphere | IGITLFDSEDAMRRGDEALNAMSPGDTERRTSVEFYEVPVQTVR |
Ga0308176_120622212 | 3300031996 | Soil | FESEEAMRRGDEALNAMTPGGGGSRTSVDFYEVPVHTLGG |
Ga0308176_126951171 | 3300031996 | Soil | FETEEAMRRGDEALNAMNPGASERRTSVEFYEVPVQTVS |
Ga0307416_1015837461 | 3300032002 | Rhizosphere | LFESEDAMRRGDEALNSMSPGASERRTSVEFYEVPVQTVS |
Ga0310890_110080742 | 3300032075 | Soil | LGVTLFESEDAMRRGDEALNAMNPGGTERRTSVEFFEVPVQTVR |
Ga0307415_1010272731 | 3300032126 | Rhizosphere | FDSEDAMRRGDEALNAMSPGDTERRTSVEFYEVPVQTVR |
Ga0247830_105043023 | 3300033551 | Soil | GKGLGVTLFDSEDAMRRGDEALNAMSPGASERRTSVEFYEVPVQTVS |
⦗Top⦘ |