NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F024600

Metagenome Family F024600

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024600
Family Type Metagenome
Number of Sequences 205
Average Sequence Length 43 residues
Representative Sequence RNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Number of Associated Samples 124
Number of Associated Scaffolds 205

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.41 %
% of genes near scaffold ends (potentially truncated) 89.76 %
% of genes from short scaffolds (< 2000 bps) 93.66 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.122 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.268 % of family members)
Environment Ontology (ENVO) Unclassified
(47.317 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.683 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.06%    β-sheet: 0.00%    Coil/Unstructured: 56.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 205 Family Scaffolds
PF00816Histone_HNS 5.37
PF04392ABC_sub_bind 3.90
PF06411HdeA 1.46
PF00872Transposase_mut 1.46
PF13683rve_3 1.46
PF13676TIR_2 1.46
PF13649Methyltransf_25 0.98
PF13442Cytochrome_CBB3 0.98
PF01527HTH_Tnp_1 0.98
PF00550PP-binding 0.49
PF13458Peripla_BP_6 0.49
PF00196GerE 0.49
PF00581Rhodanese 0.49
PF04075F420H2_quin_red 0.49
PF00155Aminotran_1_2 0.49
PF06078DUF937 0.49
PF13333rve_2 0.49
PF03404Mo-co_dimer 0.49
PF00589Phage_integrase 0.49
PF00144Beta-lactamase 0.49
PF03721UDPG_MGDP_dh_N 0.49
PF01381HTH_3 0.49
PF11026DUF2721 0.49
PF07883Cupin_2 0.49
PF10431ClpB_D2-small 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 205 Family Scaffolds
COG2916DNA-binding protein H-NSTranscription [K] 5.37
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 3.90
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 1.46
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.49
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.49
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.49
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.49
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.49
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.49
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.49
COG2367Beta-lactamase class ADefense mechanisms [V] 0.49
COG3753Uncharacterized conserved protein YidB, DUF937 familyFunction unknown [S] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.12 %
UnclassifiedrootN/A4.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000580|AF_2010_repII_A01DRAFT_1045158All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium679Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10001937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5412Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1081444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1020705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium924Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1048632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300000955|JGI1027J12803_100430438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300000955|JGI1027J12803_100740678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300000955|JGI1027J12803_101657802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300004479|Ga0062595_102150601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300005093|Ga0062594_101681258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300005162|Ga0066814_10108461All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005332|Ga0066388_101147529Not Available1322Open in IMG/M
3300005332|Ga0066388_106859106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300005436|Ga0070713_100638377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1013Open in IMG/M
3300005467|Ga0070706_100104678All Organisms → cellular organisms → Bacteria → Proteobacteria2632Open in IMG/M
3300005471|Ga0070698_100968535All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300005557|Ga0066704_10299344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1087Open in IMG/M
3300005557|Ga0066704_10872030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300005561|Ga0066699_11285992All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005575|Ga0066702_10966170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300005587|Ga0066654_10539473All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005713|Ga0066905_101469204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300005764|Ga0066903_101611673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1231Open in IMG/M
3300005764|Ga0066903_101798827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1170Open in IMG/M
3300005764|Ga0066903_101953730Not Available1125Open in IMG/M
3300005764|Ga0066903_102166143All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300005764|Ga0066903_103303313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium871Open in IMG/M
3300005764|Ga0066903_103565339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae838Open in IMG/M
3300005764|Ga0066903_103903151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium800Open in IMG/M
3300005764|Ga0066903_104247221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium766Open in IMG/M
3300005764|Ga0066903_105053398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300005764|Ga0066903_105522762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium666Open in IMG/M
3300005764|Ga0066903_107413378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300005764|Ga0066903_108309485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300005764|Ga0066903_108443429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300005764|Ga0066903_108498203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300005764|Ga0066903_108833571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300006028|Ga0070717_10394465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1242Open in IMG/M
3300006028|Ga0070717_10518913All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300006028|Ga0070717_10645764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12960Open in IMG/M
3300006028|Ga0070717_12076865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300006175|Ga0070712_101693298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300006797|Ga0066659_10074201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2235Open in IMG/M
3300006903|Ga0075426_10334672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1111Open in IMG/M
3300006969|Ga0075419_10868642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300007076|Ga0075435_100706234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12877Open in IMG/M
3300009137|Ga0066709_102282483Not Available743Open in IMG/M
3300009147|Ga0114129_12369871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300009162|Ga0075423_10151635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2434Open in IMG/M
3300010043|Ga0126380_10246560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1233Open in IMG/M
3300010046|Ga0126384_10032008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3502Open in IMG/M
3300010046|Ga0126384_10701887All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300010046|Ga0126384_11656390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300010047|Ga0126382_10829749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium792Open in IMG/M
3300010047|Ga0126382_11519549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300010048|Ga0126373_10793564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71009Open in IMG/M
3300010048|Ga0126373_11437913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium755Open in IMG/M
3300010335|Ga0134063_10507251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12604Open in IMG/M
3300010358|Ga0126370_11711780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300010361|Ga0126378_11140516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium879Open in IMG/M
3300010361|Ga0126378_12809450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300010361|Ga0126378_13007153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300010361|Ga0126378_13448677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300010362|Ga0126377_10912226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium942Open in IMG/M
3300010376|Ga0126381_100350223All Organisms → cellular organisms → Bacteria2041Open in IMG/M
3300010376|Ga0126381_103785758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300010398|Ga0126383_11659725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300010863|Ga0124850_1078842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium985Open in IMG/M
3300011003|Ga0138514_100005051Not Available1929Open in IMG/M
3300012096|Ga0137389_11554499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300012202|Ga0137363_10255447Not Available1425Open in IMG/M
3300012202|Ga0137363_10779007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300012204|Ga0137374_10683471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium773Open in IMG/M
3300012212|Ga0150985_105226194All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300012353|Ga0137367_10702970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300012469|Ga0150984_102718057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1223Open in IMG/M
3300012469|Ga0150984_121467963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium700Open in IMG/M
3300012532|Ga0137373_10731735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300012937|Ga0162653_100011246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1083Open in IMG/M
3300012939|Ga0162650_100016421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1025Open in IMG/M
3300012957|Ga0164303_11070092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300012987|Ga0164307_11734985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300012989|Ga0164305_10408031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1042Open in IMG/M
3300014325|Ga0163163_10827557All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300014969|Ga0157376_10568475Not Available1124Open in IMG/M
3300015371|Ga0132258_13754616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71035Open in IMG/M
3300016270|Ga0182036_11611071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300016294|Ga0182041_12092601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300016319|Ga0182033_10479089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71066Open in IMG/M
3300016319|Ga0182033_10742756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium861Open in IMG/M
3300016319|Ga0182033_11532808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300016341|Ga0182035_10147596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1801Open in IMG/M
3300016357|Ga0182032_10079076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2252Open in IMG/M
3300016357|Ga0182032_10135225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1801Open in IMG/M
3300016357|Ga0182032_10412612All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300016404|Ga0182037_11375413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300016422|Ga0182039_10152726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1790Open in IMG/M
3300016422|Ga0182039_10391687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1177Open in IMG/M
3300016422|Ga0182039_11329961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium651Open in IMG/M
3300016422|Ga0182039_11812343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300016445|Ga0182038_10252617Not Available1418Open in IMG/M
3300016445|Ga0182038_10359073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1209Open in IMG/M
3300016445|Ga0182038_11091975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium709Open in IMG/M
3300016445|Ga0182038_11207507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300016445|Ga0182038_11405715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300018073|Ga0184624_10167864All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300018082|Ga0184639_10060363All Organisms → cellular organisms → Bacteria → Proteobacteria1972Open in IMG/M
3300018468|Ga0066662_10202122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1572Open in IMG/M
3300018469|Ga0190270_10530062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1130Open in IMG/M
3300021168|Ga0210406_10773210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium733Open in IMG/M
3300021372|Ga0213877_10228133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300021405|Ga0210387_10562498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71014Open in IMG/M
3300021478|Ga0210402_10317783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1443Open in IMG/M
3300021560|Ga0126371_10780257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1102Open in IMG/M
3300021560|Ga0126371_12247278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300022756|Ga0222622_10263063All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300025910|Ga0207684_10833431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium australiense778Open in IMG/M
3300025915|Ga0207693_10040875All Organisms → cellular organisms → Bacteria3652Open in IMG/M
3300025916|Ga0207663_11280958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300026035|Ga0207703_11770058All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300026088|Ga0207641_10401659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1316Open in IMG/M
3300027646|Ga0209466_1126444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300027874|Ga0209465_10663290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300027909|Ga0209382_11559655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300028768|Ga0307280_10130996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411855Open in IMG/M
3300028828|Ga0307312_10821073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300031543|Ga0318516_10145810All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300031543|Ga0318516_10524976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300031544|Ga0318534_10852034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300031545|Ga0318541_10102971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1534Open in IMG/M
3300031573|Ga0310915_10191109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1429Open in IMG/M
3300031573|Ga0310915_10233851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1291Open in IMG/M
3300031573|Ga0310915_10754622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7685Open in IMG/M
3300031668|Ga0318542_10089735Not Available1469Open in IMG/M
3300031679|Ga0318561_10392241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium762Open in IMG/M
3300031679|Ga0318561_10694775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7559Open in IMG/M
3300031679|Ga0318561_10728805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300031682|Ga0318560_10380854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300031713|Ga0318496_10412962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300031713|Ga0318496_10779880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300031719|Ga0306917_10545080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium911Open in IMG/M
3300031719|Ga0306917_11311677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7560Open in IMG/M
3300031744|Ga0306918_10321745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1195Open in IMG/M
3300031744|Ga0306918_10357431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1134Open in IMG/M
3300031747|Ga0318502_10579510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300031748|Ga0318492_10016921All Organisms → cellular organisms → Bacteria3102Open in IMG/M
3300031765|Ga0318554_10597582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium622Open in IMG/M
3300031770|Ga0318521_10750832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300031770|Ga0318521_11049266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7500Open in IMG/M
3300031781|Ga0318547_10498611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium752Open in IMG/M
3300031781|Ga0318547_10666240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300031781|Ga0318547_10908512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria549Open in IMG/M
3300031793|Ga0318548_10353126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium722Open in IMG/M
3300031794|Ga0318503_10072651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1072Open in IMG/M
3300031796|Ga0318576_10217163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium900Open in IMG/M
3300031833|Ga0310917_10224572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1260Open in IMG/M
3300031833|Ga0310917_10392431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium943Open in IMG/M
3300031833|Ga0310917_10922165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300031879|Ga0306919_10039663All Organisms → cellular organisms → Bacteria3044Open in IMG/M
3300031879|Ga0306919_10277891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1266Open in IMG/M
3300031879|Ga0306919_10350552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1127Open in IMG/M
3300031879|Ga0306919_11276902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300031879|Ga0306919_11469510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300031890|Ga0306925_10853392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7940Open in IMG/M
3300031893|Ga0318536_10204136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1006Open in IMG/M
3300031897|Ga0318520_11050983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300031910|Ga0306923_10590749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71247Open in IMG/M
3300031910|Ga0306923_10991222All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300031910|Ga0306923_11629857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300031912|Ga0306921_12588477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300031941|Ga0310912_10317330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas harenae1207Open in IMG/M
3300031941|Ga0310912_10393812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1078Open in IMG/M
3300031945|Ga0310913_10784733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300031945|Ga0310913_10899804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300031945|Ga0310913_11127089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300031946|Ga0310910_10056887All Organisms → cellular organisms → Bacteria → Proteobacteria2777Open in IMG/M
3300031946|Ga0310910_10344697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1176Open in IMG/M
3300031946|Ga0310910_10492025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → Defluviicoccus vanus973Open in IMG/M
3300031946|Ga0310910_10703485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium798Open in IMG/M
3300031947|Ga0310909_10118994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2142Open in IMG/M
3300031947|Ga0310909_11681637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300031954|Ga0306926_12577226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300031981|Ga0318531_10191815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium920Open in IMG/M
3300032001|Ga0306922_10205866Not Available2111Open in IMG/M
3300032001|Ga0306922_10835822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium960Open in IMG/M
3300032001|Ga0306922_11902736Not Available582Open in IMG/M
3300032043|Ga0318556_10448242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7675Open in IMG/M
3300032051|Ga0318532_10217830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300032059|Ga0318533_10188039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium septicum1474Open in IMG/M
3300032059|Ga0318533_10950479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300032059|Ga0318533_11109213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300032059|Ga0318533_11300177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300032063|Ga0318504_10177131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium990Open in IMG/M
3300032063|Ga0318504_10353414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300032076|Ga0306924_10290042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1878Open in IMG/M
3300032076|Ga0306924_10439755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1490Open in IMG/M
3300032090|Ga0318518_10271453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium871Open in IMG/M
3300032091|Ga0318577_10397186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7659Open in IMG/M
3300032091|Ga0318577_10436705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300032261|Ga0306920_101120945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1140Open in IMG/M
3300033289|Ga0310914_10552772All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300033289|Ga0310914_11593825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300033289|Ga0310914_11792604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria518Open in IMG/M
3300033289|Ga0310914_11891342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300033551|Ga0247830_10454712All Organisms → cellular organisms → Bacteria1003Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil10.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.44%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.46%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.49%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.49%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.49%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.49%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.49%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A01DRAFT_104515833300000580Forest SoilDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
AF_2010_repII_A1DRAFT_1000193793300000597Forest SoilYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSS*
AF_2010_repII_A100DRAFT_108144433300000655Forest SoilALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKRN*
AP72_2010_repI_A100DRAFT_102070523300000837Forest SoilKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
AP72_2010_repI_A100DRAFT_104863213300000837Forest SoilGYYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
JGI1027J12803_10043043833300000955SoilMIDLQTLEENLSKVTNFCSDEKNFKIPVMKAVEQVLGK*
JGI1027J12803_10074067813300000955SoilTLEDNVSKVKNYCYDEKNFKVPIMKAVETVLGKPSNPR*
JGI1027J12803_10165780223300000955SoilSGYYNAKRNNKIIDLEALEDNVSKVQNYCYDEKNFKVPIMKAVETVLGKSSNVR*
Ga0062595_10215060113300004479SoilNTRMIDLQTLEENLSKVTNYCSNEKNFKMPVMKAVEQVLGKQ*
Ga0062594_10168125823300005093SoilVAKNAKRNNRVIDLQSMEENMSKVQNYCNDEKNFKVPVMKAIEQVLGKTG*
Ga0066814_1010846113300005162SoilNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN*
Ga0066388_10114752933300005332Tropical Forest SoilKRNNRVLDLQTFEENMTKVTNFCSDEKNFKMPVMKAIEQVLGKSK*
Ga0066388_10685910613300005332Tropical Forest SoilYYNAKRNNKIIDLDTFEDNVSKVQSYCYEEKNFKVPIMKAVEQVLGGRK*
Ga0070713_10063837713300005436Corn, Switchgrass And Miscanthus RhizosphereRNNRMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN*
Ga0070706_10010467833300005467Corn, Switchgrass And Miscanthus RhizosphereVIDQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0070698_10096853533300005471Corn, Switchgrass And Miscanthus RhizosphereAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066704_1029934413300005557SoilGYYNAKRNNRVIDLQSLEENMSKVTNYCSDEKNFKVPVMKGCRTGIG*
Ga0066704_1087203013300005557SoilGYYNAKRNNRVIDLQSLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066699_1128599213300005561SoilMKRASRFNAKRNNRMIDQQALDENMSKVKNYCSDEKNFKVPVMKAVEQ
Ga0066702_1096617013300005575SoilNAKRNNRVIDLQTFEENMSKVTNFCSDERNFKVPVMKAVEQVLGK*
Ga0066654_1053947323300005587SoilMKRASRFNAKRNNRMIDQQALDENMSKVKNYCSDEKNFKVPVMKAVEQV
Ga0066905_10146920413300005713Tropical Forest SoilSAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066903_10161167313300005764Tropical Forest SoilGYYSAKRNTRVIDLQSLEEKLSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066903_10179882733300005764Tropical Forest SoilISGYYHAKHNNRTLDLQAFEDNMNKVESYCSDEKNSKVPVMQAVERVLGISLDR*
Ga0066903_10195373043300005764Tropical Forest SoilYHAKHNNRTLDLQAFEDNMNKVESYCSDEKNSKVPVMEAVERVLGISLAK*
Ga0066903_10216614333300005764Tropical Forest SoilIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066903_10330331333300005764Tropical Forest SoilVIDLQTFEENMSKVMNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066903_10356533933300005764Tropical Forest SoilKRNNRVIDLQTFEENMSKVTNFCSDEKNFKMPVMKAVEQVLGKSN*
Ga0066903_10390315113300005764Tropical Forest SoilVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSS*
Ga0066903_10424722113300005764Tropical Forest SoilNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMNAVEQVLGKKSN*
Ga0066903_10505339823300005764Tropical Forest SoilYYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQALGKSK*
Ga0066903_10552276213300005764Tropical Forest SoilRNNRVIDLQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVY*
Ga0066903_10741337823300005764Tropical Forest SoilNAKRNNKIIDLDTFEDNVSKVQSYCYEEKNFKVPIMKAVEQVLGGRK*
Ga0066903_10830948513300005764Tropical Forest SoilDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066903_10844342923300005764Tropical Forest SoilRNNRVIDLQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066903_10849820313300005764Tropical Forest SoilVIDLQSLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0066903_10883357113300005764Tropical Forest SoilRVIDLQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKRN*
Ga0070717_1039446543300006028Corn, Switchgrass And Miscanthus RhizosphereYYNAKRNNRMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN*
Ga0070717_1051891333300006028Corn, Switchgrass And Miscanthus RhizosphereYNAKRNNRMIDLQTFEENLSKVTNFCSDEKNFKVPVMKAVEQVLGKSN*
Ga0070717_1064576413300006028Corn, Switchgrass And Miscanthus RhizosphereAKRNNRVIDLQSLEENMSKVTNYCSDEKNFKVPVMKAVERVLGNKSN*
Ga0070717_1207686513300006028Corn, Switchgrass And Miscanthus RhizosphereGYYNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0070712_10169329813300006175Corn, Switchgrass And Miscanthus RhizosphereIDLQTFEENMSKVQNFCSDEKNFKVPVMKAVEQVLGKGN*
Ga0066659_1007420163300006797SoilFEENMSKVTNYCSDEKNFKVPVMRAVEQVLGKSN*
Ga0075426_1033467233300006903Populus RhizosphereRNNRVIDLQTFEENMSKVQNFCSDEKNFKVPVMKAVEQVLGKGN*
Ga0075419_1086864223300006969Populus RhizosphereVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKGN*
Ga0075435_10070623423300007076Populus RhizosphereALEENMSKVTNYCSDEKNFKVPVMKAVEQALGNKSN*
Ga0066709_10228248313300009137Grasslands SoilMSGRAGSGYYYNAKRNNLMVDLQTLEENATKVQNYCYDEKNFKVPVMKAVERVLGGRR*
Ga0114129_1236987123300009147Populus RhizosphereIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0075423_1015163513300009162Populus RhizosphereVLDLQSFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKGN*
Ga0126380_1024656033300010043Tropical Forest SoilRVIDLQTFEENLSKVTNYCYDEKNFKVPVMKAVEQVLGKSN*
Ga0126384_1003200883300010046Tropical Forest SoilAKRNNRVIDLQTLEENMSKVNNYCSDEKNFKVPVMKAVEQVLGKRN*
Ga0126384_1070188713300010046Tropical Forest SoilRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0126384_1165639013300010046Tropical Forest SoilNNRIVDLQALEENMNKVQNYCYDEKNFKVPVMKAVETVLGK*
Ga0126382_1082974933300010047Tropical Forest SoilLSGYYNAKRNNRIVDLQALEENMNKVQNYCYDEKNFKVPVMKAVEQVLGK*
Ga0126382_1151954913300010047Tropical Forest SoilNRVIDLQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0126373_1079356433300010048Tropical Forest SoilVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0126373_1143791313300010048Tropical Forest SoilNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0134063_1050725113300010335Grasslands SoilLEENMSKVTNYCSDEKNFKVPVMKAVEQALGNKSN*
Ga0126370_1171178013300010358Tropical Forest SoilHNNRTLDLQAFEENVSKVESYCSDEKNSKVPVMEAVERVLSISLDK*
Ga0126378_1114051623300010361Tropical Forest SoilVIDLQTLEENMSKVTNYCSDEKNFNVPVMKAAGIG*
Ga0126378_1280945013300010361Tropical Forest SoilIDLQTFEENMSKVTNFCSDEKNFKMPVMKAVEQVLGKSN*
Ga0126378_1300715323300010361Tropical Forest SoilLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0126378_1344867713300010361Tropical Forest SoilQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0126377_1091222613300010362Tropical Forest SoilYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMRAVEQVLGKSN*
Ga0126381_10035022343300010376Tropical Forest SoilVIDLQTLEENMGEMKNYCSDEKNFNVPVMKPVEQVLGKSN*
Ga0126381_10378575813300010376Tropical Forest SoilLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKRN*
Ga0126383_1165972523300010398Tropical Forest SoilRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSKSVD*
Ga0124850_107884213300010863Tropical Forest SoilVIDLQTFEENMSKVTSYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0138514_10000505123300011003SoilLDENVSKVKNYCSDEKNFKVPVMKAVEQVLGKGK*
Ga0137389_1155449923300012096Vadose Zone SoilRNNRVIDLQSLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGNKSN*
Ga0137363_1025544723300012202Vadose Zone SoilYNAKRNNRIIDLQTLEENVSKLQNYCYDEKNFKVPVMKAVEQVLSGPK*
Ga0137363_1077900723300012202Vadose Zone SoilLEENMSKVTNYCSDEKNFKVPVMNAVEQVLGGRK*
Ga0137374_1068347123300012204Vadose Zone SoilDLQTLEENATKVQNYCSDEKNFKVPVMKAVERVLGGRK*
Ga0150985_10522619433300012212Avena Fatua RhizosphereVIDLQTLEDNMSKVKNYCSDEKNSKAPVMKAVGQVLGKNN*
Ga0137367_1070297023300012353Vadose Zone SoilGYYNAKRNNVMVDLQTLEENATKVQNYCYDEKNFKVPVMKAVERVLGGRK*
Ga0150984_10271805723300012469Avena Fatua RhizosphereMLDDNMSKVKNYCSDEKNFKVPVMKAVENVLGKSK*
Ga0150984_12146796333300012469Avena Fatua RhizosphereMSGYYSAKRNNRMVDLQALEDNASKLQNYCYDEKNFKVPVMKAVEELFGGRKK*
Ga0137373_1073173523300012532Vadose Zone SoilYNAKRNNSIIDLQTLEENVSKLQNHCYDEKNFKVPVMKAVEQVLGGRK*
Ga0162653_10001124613300012937SoilVAQWNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKGN*
Ga0162650_10001642113300012939SoilVAQWNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0164303_1107009223300012957SoilYNAKRNNRVIDLQMLDDNMSKVKNYCSDEKNFKVPVMKAVENVLGKSK*
Ga0164307_1173498523300012987SoilMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN*
Ga0164305_1040803113300012989SoilRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN*
Ga0163163_1082755713300014325Switchgrass RhizosphereNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN*
Ga0157376_1056847523300014969Miscanthus RhizosphereALEDNLSKVKNYCSDEKNGKVALMKAVENILGKKK*
Ga0132258_1375461613300015371Arabidopsis RhizosphereILDLQVFEENMSKVTNFCSDEKNFKVPVMKAVEQVLGKSK*
Ga0182036_1161107123300016270SoilAKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN
Ga0182041_1209260123300016294SoilNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKNN
Ga0182033_1047908923300016319SoilLSGYYNAKRNNRVIDLQALEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0182033_1074275613300016319SoilQALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN
Ga0182033_1153280813300016319SoilLQTLEENMSNVTNYCSDGKNFKVPVMKAVEQVLGKSN
Ga0182035_1014759613300016341SoilRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN
Ga0182032_1007907653300016357SoilNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN
Ga0182032_1013522563300016357SoilISGYYHAKHNNRTLDLQAFEENMNKVQSYCSDEKNSKVSVIEAVERVLGLSLDK
Ga0182032_1041261243300016357SoilNLQALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN
Ga0182037_1137541323300016404SoilYYNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN
Ga0182039_1015272653300016422SoilRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN
Ga0182039_1039168713300016422SoilAKRNNQVIDLQTFEENMSKVMNYCSDEKNFKVPVMKAVERVLGKGN
Ga0182039_1132996113300016422SoilRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK
Ga0182039_1181234313300016422SoilLSGYYNAQRNNRIVDLQALEENMNKVKNYCYDEKNFKVPVMKAVEQVLGGRK
Ga0182038_1025261713300016445SoilRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKRN
Ga0182038_1035907323300016445SoilAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0182038_1109197513300016445SoilQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK
Ga0182038_1120750713300016445SoilYHAKRNNRTLDLQAFEENMNKVQNYCYDEKNSKVPIMEAVERVLDK
Ga0182038_1140571533300016445SoilVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN
Ga0184624_1016786413300018073Groundwater SedimentMLDDNMSKVKNYCNDEKNFKVPVMKAVENVLGKSK
Ga0184639_1006036313300018082Groundwater SedimentMLDDNMSKVKNYCSDEKNFKVPVMKAVENVLGKSK
Ga0066662_1020212213300018468Grasslands SoilMKRASRFNAKRNNRMIDQQALDENMSKVKNYCSDEKNFKVPVA
Ga0190270_1053006213300018469SoilNNRVIDLETLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0210406_1077321023300021168SoilRNNRMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN
Ga0213877_1022813323300021372Bulk SoilQDSAVAQDNVSKLTNYCYNEKNFKVPIMKAVEQVLGGRK
Ga0210387_1056249813300021405SoilTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN
Ga0210402_1031778323300021478SoilVIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0126371_1078025713300021560Tropical Forest SoilQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0126371_1224727813300021560Tropical Forest SoilGYYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0222622_1026306333300022756Groundwater SedimentCVAQRNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN
Ga0207684_1083343123300025910Corn, Switchgrass And Miscanthus RhizosphereLQTLEENMSKVTNYCSDEKNFRVPVMKAVEQVLGKSN
Ga0207693_1004087513300025915Corn, Switchgrass And Miscanthus RhizosphereAKRNNRMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN
Ga0207663_1128095823300025916Corn, Switchgrass And Miscanthus RhizosphereIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN
Ga0207703_1177005813300026035Switchgrass RhizosphereQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN
Ga0207641_1040165913300026088Switchgrass RhizosphereGYYNAKRNNRVIDLQMLDDNMSKVKNYCSVEKNFKAPVMKAVENVLGKSK
Ga0209466_112644433300027646Tropical Forest SoilNRIVDLQALEENMNKVQNYCYAEKNFKVPVMNAVETVLGK
Ga0209465_1066329013300027874Tropical Forest SoilYNAKRNNRVIDLQTFEENMSKVMNYCSDEKNFKVPVMKAVERVLGKSN
Ga0209382_1155965513300027909Populus RhizosphereTLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0307280_1013099623300028768SoilLCEPRLSAAWLSGYYNAVLDLQTFEENMSKVTNFCSDEKNFKVPVMKAVEQILGK
Ga0307312_1082107323300028828SoilGYYNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318516_1014581023300031543SoilVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318516_1052497613300031543SoilALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN
Ga0318534_1085203413300031544SoilYYSAKRNNRVIDLQALEENMSKVTNYCSDEKNLKVPVMKAVEQVLGKSN
Ga0318541_1010297113300031545SoilAKRNNRVVDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310915_1019110923300031573SoilMQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGGRK
Ga0310915_1023385133300031573SoilVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN
Ga0310915_1075462233300031573SoilGYYNAKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318542_1008973513300031668SoilLEDNVSKVKNYCYDEKNFKVPIMKAVETVLGKSSNAR
Ga0318561_1039224113300031679SoilVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318561_1069477513300031679SoilDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318561_1072880513300031679SoilYNAKRNNRIVDLQALEENMNKVQNYCYDEKNFKVPVMKAVEQVLGK
Ga0318560_1038085423300031682SoilDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLCKSN
Ga0318496_1041296213300031713SoilYNAKRNNRVIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEHVLGKGN
Ga0318496_1077988013300031713SoilYYNAKRNNRVIDLQTFEENMSEVTNDCSDEKNFKVPVMKAVEQVLGKRN
Ga0306917_1054508013300031719SoilYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0306917_1131167723300031719SoilDLQALEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0306918_1032174533300031744SoilKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0306918_1035743123300031744SoilLSGYYNAKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318502_1057951013300031747SoilNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSKSVD
Ga0318492_1001692113300031748SoilSGYYNAKRNNKIVDLDTLEDNVSKVTNYCYDEKNFKVPIMKAVETVLGKSSNAR
Ga0318554_1059758233300031765SoilQTLEENMSKVTNYCSDEKSFKVPVMKAVEQVLGKSN
Ga0318521_1075083213300031770SoilYNAKRNNRVIDLQTLEENMSNVTNYCSDGKNFKVPVMKAVEQVLGKSN
Ga0318521_1104926623300031770SoilRNNRVIDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318547_1049861123300031781SoilDLQTLEENMSNVTNYCSDGKNFKVPVMKAVEQVLGKSN
Ga0318547_1066624013300031781SoilSGYYNAKRNNKIIDLETLEDNVSKVTNYCYDEKNFKVPIMKAIETVLGKSSNTR
Ga0318547_1090851213300031781SoilNNRVIDLQALEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318548_1035312633300031793SoilSGYYHAKHNNRTLDLQAFEENMNKVQSYCSDEKNSKVSVIEAVERVLGLSLDK
Ga0318503_1007265133300031794SoilAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318576_1021716313300031796SoilYSAKRNNRVIDLQALEENMSKVTNYCSDEKNLKVPVMKAVEQVLGKSN
Ga0310917_1022457213300031833SoilQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310917_1039243133300031833SoilLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310917_1092216513300031833SoilALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN
Ga0306919_1003966313300031879SoilYYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0306919_1027789113300031879SoilHNNRTLDLQAFEENMNKVESYCSDEKNSKVPVMEAVERVLGNPSNPR
Ga0306919_1035055223300031879SoilRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0306919_1127690213300031879SoilVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK
Ga0306919_1146951023300031879SoilKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN
Ga0306925_1085339223300031890SoilKRNNRVIDLQALEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318536_1020413613300031893SoilGYYNAKRNNRIVDLQALEENMNKVKNYCYDEKNFKVPVMKAVEQVLGERK
Ga0318520_1105098313300031897SoilRVLDLQAFEENMNKVQNYCYDEKNLKVPVMEAVETVLGKPSNAR
Ga0306923_1059074913300031910SoilTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0306923_1099122213300031910SoilRNNRVINLQALEENMSKVMNYCSDEKNFKVPVMKAVEQLLGKSN
Ga0306923_1162985713300031910SoilKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK
Ga0306921_1258847713300031912SoilLSGYYNAKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN
Ga0310912_1031733023300031941SoilNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSKSVD
Ga0310912_1039381213300031941SoilIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310913_1078473313300031945SoilRTLDLQAFEENMNKVESYCSDEKNSKVPVMEAVERVLGNPSNPR
Ga0310913_1089980433300031945SoilRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN
Ga0310913_1112708923300031945SoilNAKRNNQVIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310910_1005688713300031946SoilAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN
Ga0310910_1034469733300031946SoilDLQALEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310910_1049202533300031946SoilHAKHNNRTLDLQAFEENMNKVQSYCSDEKNSKVSVIEAVERVLGLSLDK
Ga0310910_1070348513300031946SoilSGYHNAKRNNRVIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310909_1011899413300031947SoilLQALEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310909_1168163713300031947SoilILEENMSNVTNYCSDGKNFKVPVMKAVEQVLGKSN
Ga0306926_1257722613300031954SoilVINLQALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN
Ga0318531_1019181513300031981SoilLSGYYNAKRNNRIVDLQALEENMNKVKNYCYDEKNFKVPVMKAVEQVLGERK
Ga0306922_1020586613300032001SoilLQALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN
Ga0306922_1083582223300032001SoilKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0306922_1190273633300032001SoilYNAKRNNKIVDLDTLEDNVSKVTNYCYDEKNFKVPIMKAVETVLGKSSNTR
Ga0318556_1044824213300032043SoilNNRVIDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318532_1021783013300032051SoilYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSKSVD
Ga0318533_1018803913300032059SoilRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK
Ga0318533_1095047933300032059SoilNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN
Ga0318533_1110921323300032059SoilSGYYNAKRNNKIIDLETLEDNVSKVTNYCYDEKNFKVPIMKAVETVLGKSSNTR
Ga0318533_1130017713300032059SoilIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318504_1017713123300032063SoilVIDLQALEENLSKVTNYCSDEKNFKVPVMKAVEQIFGKSN
Ga0318504_1035341413300032063SoilALEENMNKVKNYCYDEKNFKVPVMKAVEQVLGEHK
Ga0306924_1029004213300032076SoilAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN
Ga0306924_1043975543300032076SoilYNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN
Ga0318518_1027145323300032090SoilRNNRVIDLQTLEENMSKVTNYCSDEKNLKVPVMKAVEQVLGKSN
Ga0318577_1039718613300032091SoilDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0318577_1043670533300032091SoilLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN
Ga0306920_10112094513300032261SoilLDLQAFEENMNKVESYCSDEKNSKVPVMEAVERVLGNPSNPR
Ga0310914_1055277213300033289SoilLDTFEDNVSKVQSYCYEEKNFKVPIMKAVEQVLGGRK
Ga0310914_1159382523300033289SoilYNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310914_1179260413300033289SoilLQALEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN
Ga0310914_1189134213300033289SoilHAKRNDRNLDLQAFEENMTKVQNYCYDEKNFKVPVMEAVERVLGKPSNAR
Ga0247830_1045471233300033551SoilLQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.