Metagenome / Metatranscriptome Family F024696

Basic Information
Family ID	F024696
Family Type	Metagenome / Metatranscriptome
Number of Sequences	204
Average Sequence Length	40 residues
Representative Sequence	LGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Number of Associated Samples	93
Number of Associated Scaffolds	204

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	7.39 %
% of genes near scaffold ends (potentially truncated)	97.55 %
% of genes from short scaffolds (< 2000 bps)	96.08 %
Associated GOLD sequencing projects	93
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.14

Most Common Taxonomy
Group	Unclassified (55.392 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (95.588 % of family members)
Environment Ontology (ENVO)	Unclassified (99.510 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (51.471 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.55% β-sheet: 0.00% Coil/Unstructured: 95.45%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 204 Family Scaffolds
PF05514	HR_lesion	0.98
PF01025	GrpE	0.98
PF05764	YL1	0.98
PF03416	Peptidase_C54	0.49
PF05699	Dimer_Tnp_hAT	0.49
PF10513	EPL1	0.49
PF03552	Cellulose_synt	0.49
PF04542	Sigma70_r2	0.49
PF03194	LUC7	0.49
PF14538	Raptor_N	0.49
PF00271	Helicase_C	0.49
PF00249	Myb_DNA-binding	0.49
PF01133	ER	0.49
PF02364	Glucan_synthase	0.49
PF01148	CTP_transf_1	0.49
PF14389	Lzipper-MIP1	0.49
PF00931	NB-ARC	0.49
PF03040	CemA	0.49
PF00009	GTP_EFTU	0.49
PF13966	zf-RVT	0.49

COG ID	Name	Functional Category	% Frequency in 204 Family Scaffolds
COG0576	Molecular chaperone GrpE (heat shock protein HSP-70)	Posttranslational modification, protein turnover, chaperones [O]	0.98
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.49
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.49
COG1215	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase	Cell motility [N]	0.49
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.49
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.49

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
All Organisms	root	All Organisms	44.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
cellular organisms	root	All Organisms → cellular organisms	44.12 %
Viruses	superkingdom	All Organisms → Viruses	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	44.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	44.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	43.14 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	42.16 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	42.16 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	25.98 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	25.98 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	25.98 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	25.98 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	22.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	22.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	22.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	21.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	21.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	21.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	13.24 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.47 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	11.27 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	1.96 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.49 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	7.84 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	1.96 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.96 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.49 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	7.84 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.96 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	1.96 %
Zizaniinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae	0.49 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	5.88 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.96 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	1.47 %
Anthephorinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae	1.47 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.49 %
Zizania	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania	0.49 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	5.88 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.96 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	1.47 %
Digitaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria	1.47 %
Zizania palustris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris	0.49 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.49 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	3.92 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.96 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	1.47 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1.47 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.49 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	0.49 %
Zizania palustris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris	0.49 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.39 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3.92 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.96 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	1.47 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1.47 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	0.49 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.49 %
Zizania palustris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris	0.49 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.49 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.98 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005843\|Ga0068860_102606867	Not Available	525	Open in IMG/M
3300009992\|Ga0105120_1003395	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1281	Open in IMG/M
3300015280\|Ga0182100_1043644	Not Available	668	Open in IMG/M
3300015290\|Ga0182105_1001824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1675	Open in IMG/M
3300015290\|Ga0182105_1053355	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	645	Open in IMG/M
3300015293\|Ga0182103_1020775	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	825	Open in IMG/M
3300015293\|Ga0182103_1026894	Not Available	768	Open in IMG/M
3300015297\|Ga0182104_1026476	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	838	Open in IMG/M
3300015309\|Ga0182098_1052786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	685	Open in IMG/M
3300015309\|Ga0182098_1116060	Not Available	521	Open in IMG/M
3300015310\|Ga0182162_1029775	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	841	Open in IMG/M
3300015313\|Ga0182164_1030344	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	865	Open in IMG/M
3300015313\|Ga0182164_1104955	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	559	Open in IMG/M
3300015315\|Ga0182120_1085970	Not Available	607	Open in IMG/M
3300015317\|Ga0182136_1031736	Not Available	859	Open in IMG/M
3300015317\|Ga0182136_1035483	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	828	Open in IMG/M
3300015317\|Ga0182136_1116347	Not Available	543	Open in IMG/M
3300015319\|Ga0182130_1031601	Not Available	837	Open in IMG/M
3300015319\|Ga0182130_1061017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	675	Open in IMG/M
3300015319\|Ga0182130_1069977	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	644	Open in IMG/M
3300015320\|Ga0182165_1017666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	1067	Open in IMG/M
3300015325\|Ga0182148_1010597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	1190	Open in IMG/M
3300015325\|Ga0182148_1054710	Not Available	722	Open in IMG/M
3300015325\|Ga0182148_1111562	Not Available	559	Open in IMG/M
3300015326\|Ga0182166_1069945	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	661	Open in IMG/M
3300015326\|Ga0182166_1113310	Not Available	554	Open in IMG/M
3300015327\|Ga0182114_1081163	Not Available	666	Open in IMG/M
3300015328\|Ga0182153_1143304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	516	Open in IMG/M
3300015329\|Ga0182135_1003795	Not Available	1631	Open in IMG/M
3300015329\|Ga0182135_1066826	Not Available	696	Open in IMG/M
3300015330\|Ga0182152_1061421	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	719	Open in IMG/M
3300015331\|Ga0182131_1074600	Not Available	673	Open in IMG/M
3300015332\|Ga0182117_1000991	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2514	Open in IMG/M
3300015332\|Ga0182117_1047243	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	840	Open in IMG/M
3300015332\|Ga0182117_1154628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	524	Open in IMG/M
3300015333\|Ga0182147_1037400	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	895	Open in IMG/M
3300015333\|Ga0182147_1118724	Not Available	584	Open in IMG/M
3300015334\|Ga0182132_1143641	Not Available	539	Open in IMG/M
3300015335\|Ga0182116_1167645	Not Available	518	Open in IMG/M
3300015336\|Ga0182150_1028541	Not Available	958	Open in IMG/M
3300015337\|Ga0182151_1012115	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1234	Open in IMG/M
3300015338\|Ga0182137_1064116	Not Available	770	Open in IMG/M
3300015338\|Ga0182137_1086089	Not Available	687	Open in IMG/M
3300015339\|Ga0182149_1013073	Not Available	1261	Open in IMG/M
3300015339\|Ga0182149_1072268	Not Available	718	Open in IMG/M
3300015340\|Ga0182133_1017533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1217	Open in IMG/M
3300015340\|Ga0182133_1049385	Not Available	869	Open in IMG/M
3300015340\|Ga0182133_1067533	All Organisms → cellular organisms → Eukaryota → Viridiplantae	774	Open in IMG/M
3300015340\|Ga0182133_1185869	Not Available	510	Open in IMG/M
3300015340\|Ga0182133_1189650	Not Available	505	Open in IMG/M
3300015348\|Ga0182115_1027969	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1512	Open in IMG/M
3300015348\|Ga0182115_1092304	Not Available	944	Open in IMG/M
3300015348\|Ga0182115_1113067	Not Available	858	Open in IMG/M
3300015348\|Ga0182115_1190028	Not Available	658	Open in IMG/M
3300015349\|Ga0182185_1037878	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1215	Open in IMG/M
3300015349\|Ga0182185_1050170	Not Available	1096	Open in IMG/M
3300015349\|Ga0182185_1199669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	605	Open in IMG/M
3300015349\|Ga0182185_1255499	Not Available	534	Open in IMG/M
3300015350\|Ga0182163_1011020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1956	Open in IMG/M
3300015350\|Ga0182163_1041141	Not Available	1269	Open in IMG/M
3300015350\|Ga0182163_1092769	Not Available	909	Open in IMG/M
3300015350\|Ga0182163_1108910	Not Available	846	Open in IMG/M
3300015350\|Ga0182163_1207456	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	614	Open in IMG/M
3300015352\|Ga0182169_1093360	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	958	Open in IMG/M
3300015352\|Ga0182169_1223302	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	614	Open in IMG/M
3300015353\|Ga0182179_1053930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1106	Open in IMG/M
3300015353\|Ga0182179_1083028	Not Available	935	Open in IMG/M
3300015353\|Ga0182179_1137500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	755	Open in IMG/M
3300015353\|Ga0182179_1188942	Not Available	653	Open in IMG/M
3300015353\|Ga0182179_1299811	Not Available	523	Open in IMG/M
3300015354\|Ga0182167_1072616	Not Available	1225	Open in IMG/M
3300015354\|Ga0182167_1127180	Not Available	939	Open in IMG/M
3300015354\|Ga0182167_1133445	Not Available	916	Open in IMG/M
3300015354\|Ga0182167_1188094	Not Available	758	Open in IMG/M
3300015354\|Ga0182167_1200739	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	729	Open in IMG/M
3300015354\|Ga0182167_1228666	Not Available	675	Open in IMG/M
3300015354\|Ga0182167_1282075	Not Available	593	Open in IMG/M
3300015354\|Ga0182167_1321004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	546	Open in IMG/M
3300017412\|Ga0182199_1027860	Not Available	1035	Open in IMG/M
3300017422\|Ga0182201_1037118	Not Available	794	Open in IMG/M
3300017422\|Ga0182201_1075712	Not Available	630	Open in IMG/M
3300017435\|Ga0182194_1102200	Not Available	588	Open in IMG/M
3300017439\|Ga0182200_1095971	Not Available	608	Open in IMG/M
3300017445\|Ga0182198_1042801	Not Available	894	Open in IMG/M
3300017445\|Ga0182198_1154711	Not Available	560	Open in IMG/M
3300017693\|Ga0182216_1022978	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1171	Open in IMG/M
3300017693\|Ga0182216_1112377	Not Available	663	Open in IMG/M
3300017693\|Ga0182216_1155297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	583	Open in IMG/M
3300017693\|Ga0182216_1173711	Not Available	558	Open in IMG/M
3300020223\|Ga0182118_102162	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	883	Open in IMG/M
3300020223\|Ga0182118_107721	Not Available	617	Open in IMG/M
3300028049\|Ga0268322_1050061	Not Available	526	Open in IMG/M
3300028055\|Ga0268338_1029382	Not Available	576	Open in IMG/M
3300028058\|Ga0268332_1000695	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	2001	Open in IMG/M
3300028142\|Ga0268347_1012304	Not Available	693	Open in IMG/M
3300028248\|Ga0268312_1018939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	630	Open in IMG/M
3300028475\|Ga0268327_1017469	Not Available	578	Open in IMG/M
3300028529\|Ga0268311_1014352	Not Available	633	Open in IMG/M
3300032464\|Ga0214492_1011855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1507	Open in IMG/M
3300032464\|Ga0214492_1044372	Not Available	864	Open in IMG/M
3300032464\|Ga0214492_1064211	Not Available	708	Open in IMG/M
3300032464\|Ga0214492_1074355	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	650	Open in IMG/M
3300032464\|Ga0214492_1074743	Not Available	648	Open in IMG/M
3300032464\|Ga0214492_1099843	Not Available	540	Open in IMG/M
3300032465\|Ga0214493_1001742	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3008	Open in IMG/M
3300032465\|Ga0214493_1006901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2053	Open in IMG/M
3300032465\|Ga0214493_1019705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1449	Open in IMG/M
3300032465\|Ga0214493_1093907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	713	Open in IMG/M
3300032467\|Ga0214488_1001396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	3021	Open in IMG/M
3300032467\|Ga0214488_1019138	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1380	Open in IMG/M
3300032467\|Ga0214488_1122266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	552	Open in IMG/M
3300032469\|Ga0214491_1012263	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1778	Open in IMG/M
3300032469\|Ga0214491_1031704	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1232	Open in IMG/M
3300032469\|Ga0214491_1051167	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	993	Open in IMG/M
3300032469\|Ga0214491_1103734	Not Available	682	Open in IMG/M
3300032469\|Ga0214491_1149277	Not Available	545	Open in IMG/M
3300032490\|Ga0214495_1029166	Not Available	1243	Open in IMG/M
3300032490\|Ga0214495_1036645	Not Available	1125	Open in IMG/M
3300032490\|Ga0214495_1056184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	918	Open in IMG/M
3300032490\|Ga0214495_1072525	Not Available	802	Open in IMG/M
3300032490\|Ga0214495_1075663	Not Available	784	Open in IMG/M
3300032490\|Ga0214495_1142666	Not Available	533	Open in IMG/M
3300032502\|Ga0214490_1067527	Not Available	817	Open in IMG/M
3300032502\|Ga0214490_1079057	Not Available	753	Open in IMG/M
3300032502\|Ga0214490_1154233	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	518	Open in IMG/M
3300032514\|Ga0214502_1104097	Not Available	1079	Open in IMG/M
3300032514\|Ga0214502_1267173	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	651	Open in IMG/M
3300032514\|Ga0214502_1371840	Not Available	538	Open in IMG/M
3300032550\|Ga0321340_1022069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	898	Open in IMG/M
3300032551\|Ga0321339_1014859	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1539	Open in IMG/M
3300032551\|Ga0321339_1020102	Not Available	1387	Open in IMG/M
3300032551\|Ga0321339_1094860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	682	Open in IMG/M
3300032551\|Ga0321339_1106374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	636	Open in IMG/M
3300032591\|Ga0214484_1016814	Not Available	1401	Open in IMG/M
3300032591\|Ga0214484_1026892	Not Available	1169	Open in IMG/M
3300032591\|Ga0214484_1038336	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1002	Open in IMG/M
3300032591\|Ga0214484_1111601	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	555	Open in IMG/M
3300032592\|Ga0214504_1039267	Not Available	925	Open in IMG/M
3300032593\|Ga0321338_1113561	Not Available	956	Open in IMG/M
3300032625\|Ga0214501_1032424	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1573	Open in IMG/M
3300032625\|Ga0214501_1174032	Not Available	686	Open in IMG/M
3300032689\|Ga0214497_1090741	Not Available	668	Open in IMG/M
3300032689\|Ga0214497_1100568	Not Available	627	Open in IMG/M
3300032689\|Ga0214497_1108271	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	598	Open in IMG/M
3300032689\|Ga0214497_1138722	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	506	Open in IMG/M
3300032697\|Ga0214499_1066476	Not Available	1079	Open in IMG/M
3300032697\|Ga0214499_1073501	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	1031	Open in IMG/M
3300032697\|Ga0214499_1106317	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	862	Open in IMG/M
3300032698\|Ga0214485_1013499	Not Available	1404	Open in IMG/M
3300032758\|Ga0314746_1023678	Not Available	1332	Open in IMG/M
3300032758\|Ga0314746_1036246	All Organisms → Viruses → Predicted Viral	1119	Open in IMG/M
3300032758\|Ga0314746_1086712	Not Available	725	Open in IMG/M
3300032760\|Ga0314754_1008752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1470	Open in IMG/M
3300032761\|Ga0314733_1074938	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	645	Open in IMG/M
3300032789\|Ga0314725_1017988	Not Available	862	Open in IMG/M
3300032791\|Ga0314748_1013869	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1533	Open in IMG/M
3300032791\|Ga0314748_1051713	Not Available	874	Open in IMG/M
3300032792\|Ga0314744_1014843	Not Available	1418	Open in IMG/M
3300032792\|Ga0314744_1078605	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	634	Open in IMG/M
3300032812\|Ga0314745_1004504	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2262	Open in IMG/M
3300032812\|Ga0314745_1012667	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1609	Open in IMG/M
3300032812\|Ga0314745_1040128	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1003	Open in IMG/M
3300032821\|Ga0314719_1008549	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1248	Open in IMG/M
3300032823\|Ga0314723_1058031	Not Available	739	Open in IMG/M
3300032843\|Ga0314736_1020692	Not Available	850	Open in IMG/M
3300032843\|Ga0314736_1045634	Not Available	563	Open in IMG/M
3300032844\|Ga0314743_1144144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	527	Open in IMG/M
3300032844\|Ga0314743_1146565	Not Available	521	Open in IMG/M
3300032875\|Ga0314737_1052050	Not Available	709	Open in IMG/M
3300032889\|Ga0314751_1025556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1159	Open in IMG/M
3300032889\|Ga0314751_1031228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1064	Open in IMG/M
3300032889\|Ga0314751_1038387	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	966	Open in IMG/M
3300032889\|Ga0314751_1044140	Not Available	903	Open in IMG/M
3300032890\|Ga0314747_1059177	Not Available	555	Open in IMG/M
3300032915\|Ga0314749_1062388	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	804	Open in IMG/M
3300032916\|Ga0314734_1048823	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	855	Open in IMG/M
3300032916\|Ga0314734_1074418	Not Available	682	Open in IMG/M
3300032916\|Ga0314734_1084205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	635	Open in IMG/M
3300032934\|Ga0314741_1029205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1225	Open in IMG/M
3300032934\|Ga0314741_1069174	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	821	Open in IMG/M
3300032934\|Ga0314741_1135295	Not Available	556	Open in IMG/M
3300032959\|Ga0314738_1040713	Not Available	846	Open in IMG/M
3300032959\|Ga0314738_1063335	Not Available	666	Open in IMG/M
3300032959\|Ga0314738_1092693	Not Available	527	Open in IMG/M
3300032959\|Ga0314738_1095783	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	516	Open in IMG/M
3300032966\|Ga0314722_1056698	Not Available	617	Open in IMG/M
3300032976\|Ga0314752_1025386	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1107	Open in IMG/M
3300032976\|Ga0314752_1089061	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	593	Open in IMG/M
3300032976\|Ga0314752_1109371	Not Available	531	Open in IMG/M
3300033523\|Ga0314768_1325141	Not Available	535	Open in IMG/M
3300033526\|Ga0314761_1057230	Not Available	862	Open in IMG/M
3300033526\|Ga0314761_1059281	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	847	Open in IMG/M
3300033526\|Ga0314761_1153797	Not Available	505	Open in IMG/M
3300033530\|Ga0314760_1169039	Not Available	531	Open in IMG/M
3300033531\|Ga0314756_1011762	Not Available	1483	Open in IMG/M
3300033533\|Ga0314770_1229014	Not Available	582	Open in IMG/M
3300033534\|Ga0314757_1027531	Not Available	1305	Open in IMG/M
3300033534\|Ga0314757_1039495	Not Available	1111	Open in IMG/M
3300033535\|Ga0314759_1012021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris	2083	Open in IMG/M
3300033535\|Ga0314759_1143959	Not Available	758	Open in IMG/M
3300033535\|Ga0314759_1164403	Not Available	706	Open in IMG/M
3300033535\|Ga0314759_1255486	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	555	Open in IMG/M
3300033538\|Ga0314755_1018408	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1603	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	99.02%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.49%
Unclassified	Host-Associated → Plants → Unclassified	0.49%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	99.02%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.49%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	0.49%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	99.02%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.49%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	0.49%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	95.59%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	3.43%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.49%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	0.49%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068860_1026068671	3300005843	Switchgrass Rhizosphere	VYTVVDCIALSPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA*
Ga0105120_10033952	3300009992	Switchgrass Associated	MYRSTWLGGQVDSPRDKEGYLGITINPKLTISGVA*
Ga0182100_10436441	3300015280	Switchgrass Phyllosphere	IYMSIWLGEQVTSPRDKEGYPGITINPKLTISGVA*
Ga0182105_10018241	3300015290	Switchgrass Phyllosphere	CIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA*
Ga0182105_10533551	3300015290	Switchgrass Phyllosphere	IYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA*
Ga0182103_10207751	3300015293	Switchgrass Phyllosphere	SPLGGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA*
Ga0182103_10268941	3300015293	Switchgrass Phyllosphere	RIYRSTWLGGQVASPRDKEGYHGITINPKLTISGVA*
Ga0182104_10264761	3300015297	Switchgrass Phyllosphere	LGGIYMSTWLGGQVAFPRDKKDYPGITINPKLAISRDA*
Ga0182098_10527861	3300015309	Switchgrass Phyllosphere	LDGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA*
Ga0182098_11160601	3300015309	Switchgrass Phyllosphere	IYKSTWLGGQVASPRDKEDYFGITINPKLTISEVA*
Ga0182162_10297753	3300015310	Switchgrass Phyllosphere	LSPLGGIYRSTWLGGQVASPRDNEGYPGITINPKLTISGVA*
Ga0182164_10303442	3300015313	Switchgrass Phyllosphere	LGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA*
Ga0182164_11049551	3300015313	Switchgrass Phyllosphere	YCIEPLGRIYRSTWLGRQVASPRDKEGYPGITINPKLTISGVA*
Ga0182120_10859702	3300015315	Switchgrass Phyllosphere	IYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA*
Ga0182136_10317361	3300015317	Switchgrass Phyllosphere	TWLGGQVASPRDKEGYPGITINPKLTISRDATEVD*
Ga0182136_10354831	3300015317	Switchgrass Phyllosphere	CGRCIALSPLDGIYRSTWLEGQVVSPRDKEGYSGITINPKLTISGVA*
Ga0182136_11163472	3300015317	Switchgrass Phyllosphere	YMSTWLGGQVAFPRDKESYPRITINPKLTISGVA*
Ga0182130_10316011	3300015319	Switchgrass Phyllosphere	CGRCIALSPLDGIYRSTWLEGQVASPRDKEGYPGITINPKLIISGVD*
Ga0182130_10610171	3300015319	Switchgrass Phyllosphere	IEPLGRIYRSTWLGRQVASPRDKEGYPGITINPKLTISGVA*
Ga0182130_10699772	3300015319	Switchgrass Phyllosphere	CIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTVSGVA*
Ga0182165_10176661	3300015320	Switchgrass Phyllosphere	EPLGRIYRSTWLGGQVASPRDKEGYPGITINSKLIISGVA*
Ga0182148_10105971	3300015325	Switchgrass Phyllosphere	IYRSTWLGGQVASPRDKESYPGITINPKLTISGVA*
Ga0182148_10547101	3300015325	Switchgrass Phyllosphere	YRSTWLGGQVASPRDKEDYPGITINPKLTMSRVA*
Ga0182148_11115622	3300015325	Switchgrass Phyllosphere	IALSPLGSIYRSTWFGGQVASPRDNEGYPEITINPKLTIFGVA*
Ga0182166_10699451	3300015326	Switchgrass Phyllosphere	RCIALSPLGGICRSTWLGGQVASPRDKEGYSGITINPKLTISGVA*
Ga0182166_11133101	3300015326	Switchgrass Phyllosphere	MDCIAFELLRRIYRSTWFGGQIASPRDEEGYPEITINPKLTIFGVA*
Ga0182114_10811631	3300015327	Switchgrass Phyllosphere	YRSTWLGGQVTSPRDKEGYPGITINPKLTISGVA*
Ga0182153_11433042	3300015328	Switchgrass Phyllosphere	YRSTWLGGQVASPRDKKGYSGITINPKLTISGVA*
Ga0182135_10037952	3300015329	Switchgrass Phyllosphere	CIALRPLGGIYRSTWFGGQVSSPRDKEGYPGITINPKLIISGVA*
Ga0182135_10668261	3300015329	Switchgrass Phyllosphere	RIYSSTWLGGQVTSPRDKQGYLGITINPKLTISGVA*
Ga0182152_10614211	3300015330	Switchgrass Phyllosphere	PLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTVSGVA*
Ga0182131_10746001	3300015331	Switchgrass Phyllosphere	YRSTWFGGQIASPRDEEGYPEITINPKLTIFGVA*
Ga0182117_10009913	3300015332	Switchgrass Phyllosphere	YRSTWLGVQVASLRDKEGYPGITINPKLTISGVA*
Ga0182117_10472431	3300015332	Switchgrass Phyllosphere	LSPLGSSTWLGGQVASPRDKEGYPRITINPKLTISGVA*
Ga0182117_11546281	3300015332	Switchgrass Phyllosphere	LGGIYRSTWLGGQVAPPRDKEGYPGITINPKLPISGV
Ga0182147_10374002	3300015333	Switchgrass Phyllosphere	YRSTWLGGQVASPKDKEGYPGITINPKLTISGVA*
Ga0182147_11187242	3300015333	Switchgrass Phyllosphere	GIYRSTWLGGQVASPRDKKDYSEITINSKLIISGVG*
Ga0182132_11436411	3300015334	Switchgrass Phyllosphere	GRCIALSPLGGIYRSTWLGGQVASARDKEGYPRITINSKLTISGVA*
Ga0182116_11315731	3300015335	Switchgrass Phyllosphere	MRAIYCIEPLGQIYRSTWFGGQVVSPRDNKDYYGITINPKLTI
Ga0182116_11676451	3300015335	Switchgrass Phyllosphere	GRCIALNLLGGIYRSTWVGGHVASPRDKEGYSGIIINHKLTISEVA*
Ga0182150_10285413	3300015336	Switchgrass Phyllosphere	IALSPLGGIYRSTWLGGQVASPIDKEGYPGITINPKLTIFRVA*
Ga0182151_10121151	3300015337	Switchgrass Phyllosphere	IALSPLGGIYRSTRLGGQVASPRDKEGYPGITINPKLTISGVA*
Ga0182137_10641161	3300015338	Switchgrass Phyllosphere	GIYRSTWLGGEVASPRDKEGYPGITINPKLTISGVA*
Ga0182137_10860892	3300015338	Switchgrass Phyllosphere	LGGIYRSTWLGGQVASPRDKEGYPGITINPKLIISKVA*
Ga0182149_10130732	3300015339	Switchgrass Phyllosphere	GIYRSTWLGGQVASPRDKEGYPEITINPKLTISGVA*
Ga0182149_10722681	3300015339	Switchgrass Phyllosphere	GRCIALSPLGGIYRNTWLRGQVASPRDKEGYPGITINPKLTISGVA*
Ga0182133_10175334	3300015340	Switchgrass Phyllosphere	PLGRIYRSTWLGGQVASPRDKKGYPGITINPKVTISGVV*
Ga0182133_10493852	3300015340	Switchgrass Phyllosphere	LGGIYKGTWLGGQLTSPRDKEGYPGITMNPKLTISGVA*
Ga0182133_10675332	3300015340	Switchgrass Phyllosphere	MGCIALSLLGRIYRSAWLGGQVAPLRDKEGYPGITINPKLTISGAA*
Ga0182133_11858691	3300015340	Switchgrass Phyllosphere	GIYRSTWLGGQVASPRENEGYSGITINPKLTISGVA*
Ga0182133_11896502	3300015340	Switchgrass Phyllosphere	ALSPLGGIYRSTWLGVQVVSPKDKEGYLGITINPKLTISGVA*
Ga0182115_10279693	3300015348	Switchgrass Phyllosphere	VYCGRCIVLSPLGGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA*
Ga0182115_10923041	3300015348	Switchgrass Phyllosphere	LGGIYRSTRLGGQVASPRDKEGYPGITINPKLTISG
Ga0182115_11130671	3300015348	Switchgrass Phyllosphere	MWSIYCLSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLT
Ga0182115_11900281	3300015348	Switchgrass Phyllosphere	LGGIYKNTWLGGQVISPRDKEGYLGITINSKLTIS*
Ga0182185_10378781	3300015349	Switchgrass Phyllosphere	MGCIALSLLGRIYRSTWLGVQVAPLRDKEGYPGITINPKLTISG
Ga0182185_10501701	3300015349	Switchgrass Phyllosphere	CGQCIALSPLGGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA*
Ga0182185_11996691	3300015349	Switchgrass Phyllosphere	IELLGQIYRSTWLGGQVASPKDKKGYPIITINPKLTIPGLA*
Ga0182185_12554991	3300015349	Switchgrass Phyllosphere	GRCIALSPLDGIYRSTWLGGQVASPRDKEEGYLGITINPKLTISGVA*
Ga0182163_10110202	3300015350	Switchgrass Phyllosphere	GRCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITVNPKLTISGVA*
Ga0182163_10411411	3300015350	Switchgrass Phyllosphere	YRNTWLGGQVASPRDKEGYPGITINSKLIISGVA*
Ga0182163_10927691	3300015350	Switchgrass Phyllosphere	GRIYRSTWLGGQVASPRDKEGYPGITINPKLTISEVA*
Ga0182163_11089101	3300015350	Switchgrass Phyllosphere	PLGGIYRSTWLGGQVASPRDKEGYPEITINKLTISGVA*
Ga0182163_12074561	3300015350	Switchgrass Phyllosphere	MWSMYCLSPLGGIYRSTWLGRQVASPRDKKGYPGITINPKL
Ga0182169_10933601	3300015352	Switchgrass Phyllosphere	SPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTVSGVA*
Ga0182169_12233021	3300015352	Switchgrass Phyllosphere	IALSPLGGIYRSTWLGGQVASPRDKKGYPGITINPKLTISGVV*
Ga0182179_10539301	3300015353	Switchgrass Phyllosphere	LGGIYRSTWLGGQVASPRDKECYPEITINSKLTISGVA*
Ga0182179_10830281	3300015353	Switchgrass Phyllosphere	RIYRSTWFGGQVASPRDKEGYSGITINPKLTISGVA*
Ga0182179_11375001	3300015353	Switchgrass Phyllosphere	EPLGQIYRSTWLGGQVTSPRDKEGYPGITINTKLTIYGVA*
Ga0182179_11889421	3300015353	Switchgrass Phyllosphere	CIALSPLDGIYRSTWLGGQVASPRDKEGFLGITINPKLTISGAA*
Ga0182179_12998111	3300015353	Switchgrass Phyllosphere	CGRCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA*
Ga0182167_10726161	3300015354	Switchgrass Phyllosphere	YRSTWFGGQVASPRDKEGYPGITINPKLTISGVA*
Ga0182167_11271801	3300015354	Switchgrass Phyllosphere	CIALSPLDGIYRSTWLGGQVASPRDKEDYLGITINSELTISGVV*
Ga0182167_11334451	3300015354	Switchgrass Phyllosphere	MYCIEPLGRIYRSTWLGGQVASPRDKEGYSGITINSKLTISGVA*
Ga0182167_11880942	3300015354	Switchgrass Phyllosphere	QDAYNAVNILLEPLGPIYRSIWFGGQVASPRDKKGHLGITINSKLTIFGVV*
Ga0182167_12007391	3300015354	Switchgrass Phyllosphere	LDGIYRSTWLGGQVASPRDKEGYLGITINPKLTISGVA
Ga0182167_12286663	3300015354	Switchgrass Phyllosphere	WSIYCLSPLGGIYRSTWLGGQVASPRDKEDYPGITINPKLTISGVA*
Ga0182167_12820751	3300015354	Switchgrass Phyllosphere	GIYRSTWLGGQVASPKDKEGYPGITINSKLTISGVA*
Ga0182167_13210042	3300015354	Switchgrass Phyllosphere	IYCWSPLGGIYRSTWLGGQVASPRDKEGYLGITINPKLTVSGVA*
Ga0182199_10278601	3300017412	Switchgrass Phyllosphere	LGGIYKSTWLGGQVISPRDKEGYLGITINSKLTIS
Ga0182201_10371181	3300017422	Switchgrass Phyllosphere	LSPLGGIYRSTWLGGQVASPRDKEGYPEITINPKLTISGVA
Ga0182201_10757121	3300017422	Switchgrass Phyllosphere	LGGIYRSAWLGGQVASPRDKECYPGITINPKLTIFGV
Ga0182194_11022001	3300017435	Switchgrass Phyllosphere	LLGRIYMSTWLGGQVASHRDKEGYSGITINPKLTISGVA
Ga0182200_10959711	3300017439	Switchgrass Phyllosphere	IALNPLDGIYRSAWLEGQVAFPRDNECYPGITINPKLIMSGVA
Ga0182198_10428011	3300017445	Switchgrass Phyllosphere	YCLSPLGGIYRSTWLGGQVASPRDKEDYSGITINPKLTISGVA
Ga0182198_11547111	3300017445	Switchgrass Phyllosphere	GRCIALSPLSGIYRSTWLGGQVASPREKEGYSGITINPKLTISGVA
Ga0182216_10229781	3300017693	Switchgrass Phyllosphere	CGRCIALSPLGGIYRSTWLGGQVAFLRDKEGYPGITINPKLTIS
Ga0182216_11123771	3300017693	Switchgrass Phyllosphere	TWLGGQVASPRDKEGYPGITINPKLTISRDATEVD
Ga0182216_11552971	3300017693	Switchgrass Phyllosphere	LGGIYRSTWLEGQVASPRDKEGYPGITINAKLTISG
Ga0182216_11737111	3300017693	Switchgrass Phyllosphere	GIYRSTWLGGQVASPRDKEGYHGITINPKLTISGVA
Ga0182118_1021621	3300020223	Switchgrass Phyllosphere	GRCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0182118_1077211	3300020223	Switchgrass Phyllosphere	MYCIEPLGRIYRSTWLGGQIASPRDKEGYSGITINPKLTISGVA
Ga0268322_10500611	3300028049	Phyllosphere	GLEWLGGQVASPLRLSRDKEGYLEITINPKLTISSS
Ga0268338_10293821	3300028055	Phyllosphere	SPLGGIYRSTWFGGQVASPRDKEGYPGISINPKLTISGVA
Ga0268332_10006953	3300028058	Phyllosphere	GGIYRSTWLGVQVASPRDKEGYSGITINPKLTISRVA
Ga0268347_10123041	3300028142	Phyllosphere	LGGIYRSTWLGGQVASPRDKEGYPGITVNPKLTISG
Ga0268312_10189391	3300028248	Phyllosphere	RIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0268327_10174691	3300028475	Phyllosphere	TLGGIYRSTWVGGQVASPRDKEGYPGITINPKLTISGVA
Ga0268311_10143521	3300028529	Phyllosphere	PLGSIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214492_10118552	3300032464	Switchgrass Phyllosphere	GGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA
Ga0214492_10443721	3300032464	Switchgrass Phyllosphere	LGGIYRSTWFGGQVASPKDKEGSPGITINPKLTISGVA
Ga0214492_10642111	3300032464	Switchgrass Phyllosphere	CGRCIALNPLGGIYRSTWLGGQVASPRDKEGYPEITINPKLTISGVA
Ga0214492_10743551	3300032464	Switchgrass Phyllosphere	GRCIALSPLGGIYRSTWLGGQVASPRDKKGYPGITINPKLTISGVA
Ga0214492_10747431	3300032464	Switchgrass Phyllosphere	LGSIYRSTWLGGQVASPRDKEGYLGITINSKLTISGVA
Ga0214492_10998431	3300032464	Switchgrass Phyllosphere	IYCLSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214493_10017423	3300032465	Switchgrass Phyllosphere	IALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA
Ga0214493_10069011	3300032465	Switchgrass Phyllosphere	GIYRSTWLGGQVASPRDKEGYPEITINPKLTISRVA
Ga0214493_10197052	3300032465	Switchgrass Phyllosphere	LGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214493_10939072	3300032465	Switchgrass Phyllosphere	SPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214488_10013961	3300032467	Switchgrass Phyllosphere	CGRCIALSPLGGLYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA
Ga0214488_10191382	3300032467	Switchgrass Phyllosphere	IYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214488_11222661	3300032467	Switchgrass Phyllosphere	CGRCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214491_10122633	3300032469	Switchgrass Phyllosphere	GIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214491_10317041	3300032469	Switchgrass Phyllosphere	IYRSTWLGGQVASPRDKEGYLEITINPNLTISGVA
Ga0214491_10511671	3300032469	Switchgrass Phyllosphere	GGIYRSTWLGGQVASPSPRDKEGYPGITINPKLTISGVA
Ga0214491_11037342	3300032469	Switchgrass Phyllosphere	LGGIYRSTLFGGQVASPRDKEGYPGITINHKLTISGVA
Ga0214491_11492771	3300032469	Switchgrass Phyllosphere	RCIALSPLGGIYSTWLGGQVASPRDKEEGYLGITINPKLTISGVA
Ga0214495_10291661	3300032490	Switchgrass Phyllosphere	CIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214495_10366451	3300032490	Switchgrass Phyllosphere	IALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214495_10561841	3300032490	Switchgrass Phyllosphere	GIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA
Ga0214495_10725251	3300032490	Switchgrass Phyllosphere	GRCIALSPLGGIYRSTWLGGQVASPSPRDKEGYPGITINPKLTISGVA
Ga0214495_10756631	3300032490	Switchgrass Phyllosphere	LSPLGGIYRNTWLGGQVASPRDKEDYPGITINPKLTISGVA
Ga0214495_11426661	3300032490	Switchgrass Phyllosphere	IYRSTWLGGQVASPREKEGYSGITINPKLTISGVA
Ga0214490_10675272	3300032502	Switchgrass Phyllosphere	CIEPLGRIYRSTWLEGQVASPKDKKGYPGITINPKVTISGVV
Ga0214490_10790571	3300032502	Switchgrass Phyllosphere	PLGGIYRSAWLGGQVASPRDKKSYLGITINPKLTISGVA
Ga0214490_11542332	3300032502	Switchgrass Phyllosphere	GRCIALSPLGGIYSTWLGGQVASPRDKESYPGITINPKLTISGVA
Ga0214502_11040971	3300032514	Switchgrass Phyllosphere	PLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214502_12671732	3300032514	Switchgrass Phyllosphere	LSPLGGIYRSTWLGGQVASPRDKEGYPKITINPKLIIWS
Ga0214502_13718401	3300032514	Switchgrass Phyllosphere	LGGIYRNTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0321340_10220691	3300032550	Switchgrass Phyllosphere	LYRSTWLGGQVASPRDKEGYLGITINPKLTISGVA
Ga0321339_10148591	3300032551	Switchgrass Phyllosphere	LGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA
Ga0321339_10201021	3300032551	Switchgrass Phyllosphere	IYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA
Ga0321339_10948601	3300032551	Switchgrass Phyllosphere	ALSPLGGIYRSTWLGGQVASARDKEGYPRITINSKLTISGVA
Ga0321339_11063741	3300032551	Switchgrass Phyllosphere	GIYRSTWFGGQVASPREMEGYSGITINPKLTISGVA
Ga0214484_10168141	3300032591	Switchgrass Phyllosphere	GRIYRITWLGGQVASPRDKEGYPGSTINPKLTISRDATEVD
Ga0214484_10268921	3300032591	Switchgrass Phyllosphere	PLGSIYRSTWLGGQLASPRDKESYHGITINPKLTISGVA
Ga0214484_10383361	3300032591	Switchgrass Phyllosphere	SPLGGIYRSTWLGGQVASPSPRDKEGYPGITINPKLTISGVA
Ga0214484_11116011	3300032591	Switchgrass Phyllosphere	LGGIYRSTWLRGQVASPRDKEGYPGITINPKLTISEVV
Ga0214504_10392672	3300032592	Switchgrass Phyllosphere	GSIYRSTWFGGQVASPRDKESYPGITINPKLTISGVA
Ga0321338_11135611	3300032593	Switchgrass Phyllosphere	GRCIALSPLGSIYRSTWLGGQVASPRDKEGYPGITIKPKLTISGVA
Ga0214501_10324244	3300032625	Switchgrass Phyllosphere	IYMSTWLEGQVASHREKEGYPGITINSKLTISGVA
Ga0214501_11740321	3300032625	Switchgrass Phyllosphere	IYRSTWLGGQVAFPRDKEDYLGITINPELIISGVV
Ga0214497_10907411	3300032689	Switchgrass Phyllosphere	RCIALSPLDGIYRSTWLGGQVASPRDKEEGYLGITINPKLTISGVA
Ga0214497_11005682	3300032689	Switchgrass Phyllosphere	MYCIEPLGYIYRRTWLGGQVAFPRDKEDYLGITINPELTISGVV
Ga0214497_11082712	3300032689	Switchgrass Phyllosphere	LGGIYRSTWLGGQVASPRDKECYPEITINSKLTISGVA
Ga0214497_11387221	3300032689	Switchgrass Phyllosphere	MWSMYCLSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214499_10664761	3300032697	Switchgrass Phyllosphere	CIALSPLGSIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0214499_10735011	3300032697	Switchgrass Phyllosphere	IALSPLSGIYRSTWLGGQVASPREKEGYSGITINPKLTISGVA
Ga0214499_11063171	3300032697	Switchgrass Phyllosphere	XLYRSTXLGGQVASPRDKKGYLGITINPKLTISGVA
Ga0214485_10134991	3300032698	Switchgrass Phyllosphere	PLGGIYRSTWFGGQVASPRDKEGYPEITINPKLTISGVA
Ga0314746_10236781	3300032758	Switchgrass Phyllosphere	LSPLDGIYRSTWLGGQIASARDKEGYSEITINPKLTISGVA
Ga0314746_10362461	3300032758	Switchgrass Phyllosphere	MYCIEPLGQIYRSTWFGGQIASPRDKEGWVDKESYPRITINHKLTISEVAYYT
Ga0314746_10867121	3300032758	Switchgrass Phyllosphere	SIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA
Ga0314754_10087523	3300032760	Switchgrass Phyllosphere	GIYRSTWLGGQVTSLRDKEGYPGITINSKLTISGVA
Ga0314733_10749382	3300032761	Switchgrass Phyllosphere	GPLGGIYRSTWLGGQVASPRDKEGYPEITINPKLTISGVA
Ga0314725_10179881	3300032789	Switchgrass Phyllosphere	RCIALRPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314748_10138691	3300032791	Switchgrass Phyllosphere	CIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA
Ga0314748_10517132	3300032791	Switchgrass Phyllosphere	GRCIALSHLGGIYRSTWLGGQVTSPRDKEGYHGITINPKLTISGVA
Ga0314744_10148431	3300032792	Switchgrass Phyllosphere	QCIALRPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314744_10786051	3300032792	Switchgrass Phyllosphere	MWSMYCLSPLGGIYRSTWLGRQVASPRDKKGYPGITINPKLIISGVA
Ga0314745_10045041	3300032812	Switchgrass Phyllosphere	ALSPLGGIYRSTWLGGQVASPSPRDKEGYPGITINPKLTISGIA
Ga0314745_10126673	3300032812	Switchgrass Phyllosphere	LYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314745_10401281	3300032812	Switchgrass Phyllosphere	ARQVEGGIYRSTWLGGQIASPIDKEGYPGITINPKLTISGVA
Ga0314719_10085491	3300032821	Switchgrass Phyllosphere	IYRSTWLGGQVASPRDKEGYPGITINPKLTISEVA
Ga0314723_10580311	3300032823	Switchgrass Phyllosphere	SIYRSTWLGGQVTSPRDKEGYSGITINSKLTISGVA
Ga0314736_10206921	3300032843	Switchgrass Phyllosphere	CIALSPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314736_10456341	3300032843	Switchgrass Phyllosphere	IYRSTWLGGQVASPRENEGYSGITINPKLTISGVA
Ga0314743_11441441	3300032844	Switchgrass Phyllosphere	LLGGIYRSTWLGGQVDSPRDKEGYPGITINPKLTISGVA
Ga0314743_11465651	3300032844	Switchgrass Phyllosphere	SGIYRSTWLGGQVASPREKEGYSGITINPKLTISGVA
Ga0314737_10520501	3300032875	Switchgrass Phyllosphere	LGSIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVA
Ga0314751_10255561	3300032889	Switchgrass Phyllosphere	RIMWSMYCLSSLGGIYRSTWLGGQVASPRDKECYPEITINSKLTISGVA
Ga0314751_10312281	3300032889	Switchgrass Phyllosphere	VRLGIMRGICCIELLGRMYRSTWLGGHVASPRDKEGYPGITINPKLTVSRVA
Ga0314751_10383871	3300032889	Switchgrass Phyllosphere	GRIYRSTWLGGQVASPRDKEGYPGITINPKLTISEVA
Ga0314751_10441401	3300032889	Switchgrass Phyllosphere	LYRSTWLGGQVASPRDKKGYPGITINPKLTISGVA
Ga0314747_10591772	3300032890	Switchgrass Phyllosphere	GRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314749_10623881	3300032915	Switchgrass Phyllosphere	SSLGGIYRSTWLGGKVASHRDKECYPGITINFKLTISRVA
Ga0314734_10488232	3300032916	Switchgrass Phyllosphere	GRIYRSTWLGGQVASPRDKKGYPGITINPKVTISGVV
Ga0314734_10744181	3300032916	Switchgrass Phyllosphere	LGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314734_10842051	3300032916	Switchgrass Phyllosphere	GGIYRSTWLGGQVASARDKEGYPRITINPKLTISGVA
Ga0314741_10292051	3300032934	Switchgrass Phyllosphere	IALSPLGGIYRSIRLGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314741_10691742	3300032934	Switchgrass Phyllosphere	GRCIALSPLGGIYRSTWLGGQVASARDKEGYPRITINSKLTISGVA
Ga0314741_11352951	3300032934	Switchgrass Phyllosphere	ALSPLDGIYRSTWLGGQVASPRDKVEGYLGITINPKLTISGVA
Ga0314738_10407133	3300032959	Switchgrass Phyllosphere	SMYCIEPLGGIYRSTWLGGQVASPRDKEGYPGITINAKLTISGVA
Ga0314738_10633351	3300032959	Switchgrass Phyllosphere	RIYRSTWLGVQVAPLRDKEGYPGITINPKLTISGAA
Ga0314738_10926931	3300032959	Switchgrass Phyllosphere	SMYCIEPLGGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISVVA
Ga0314738_10957832	3300032959	Switchgrass Phyllosphere	ALSPLGGIYRSTWLGGKVASPRDKEGYPGITINPKLTISGVA
Ga0314722_10566981	3300032966	Switchgrass Phyllosphere	SIYRSTWLGGQVASPRDKEGYPGITINSKLTISGVG
Ga0314752_10253861	3300032976	Switchgrass Phyllosphere	LYRSTWLGEQVASPRDKGGYPGITINPKLTVSRVA
Ga0314752_10890611	3300032976	Switchgrass Phyllosphere	LGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISG
Ga0314752_11093711	3300032976	Switchgrass Phyllosphere	FGXLYRSTWHGEQVASPRDKEGYPGITINLKLTISGGA
Ga0314768_13251412	3300033523	Switchgrass Phyllosphere	VYTVVDCIALSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKLTI
Ga0314761_10572302	3300033526	Switchgrass Phyllosphere	MWSIYCLSPLGGIYRSTWLGGQVASPRDKEGYPGITINPKL
Ga0314761_10592811	3300033526	Switchgrass Phyllosphere	RCIALSPLGGIYRSTWFGGQVASPRDKKGYPGITINPKLTISGVA
Ga0314761_11537972	3300033526	Switchgrass Phyllosphere	GIYRSTWLGGQVVSPRDKEGYPGITINPKLTISGVA
Ga0314760_11690391	3300033530	Switchgrass Phyllosphere	CIALSPLGGIYRSTWLGGQVASPRDKKGYPGITINPKLTISGVA
Ga0314756_10117621	3300033531	Switchgrass Phyllosphere	PLGRIYRSTWLGGKVASPRDKEGYSGITINPKLTISGVA
Ga0314770_12290141	3300033533	Switchgrass Phyllosphere	LYRSTWLGGQVASPRDKEGYPEIAINSKLTIPGVA
Ga0314757_10275311	3300033534	Switchgrass Phyllosphere	PLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314757_10394952	3300033534	Switchgrass Phyllosphere	GIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA
Ga0314759_10120211	3300033535	Switchgrass Phyllosphere	TALSPLDGIYRSTLFGGQVASPRDKEGYPGITINHKLTISGVA
Ga0314759_11439591	3300033535	Switchgrass Phyllosphere	PGRIYRSTWLGGQVASPRDKKSYPGITINPKATISGVV
Ga0314759_11644031	3300033535	Switchgrass Phyllosphere	GRYIALSPLGGICRSTWLGGQVASPRDKEGYSGITINPKLTISGVA
Ga0314759_12554861	3300033535	Switchgrass Phyllosphere	GRCIALSLLGGIYRSTWLGGQVDSPRDKEGYPGITINPKLTISGVA
Ga0314755_10184081	3300033538	Switchgrass Phyllosphere	IALSPLGSIYRSTWLGGQVTSPRDKEGYPGITINSKLTISGVA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.14
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.14
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F024696

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032464	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032550	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032592	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032593	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032698	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032760	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032789	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032791	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032821	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032823	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032843	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032844	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032875	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032889	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032890	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032959	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032966	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032976	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033523	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033531	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033533	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033538	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign