Metagenome Family F024935

Basic Information
Family ID	F024935
Family Type	Metagenome
Number of Sequences	203
Average Sequence Length	42 residues
Representative Sequence	MYDLGLYVGLFEILRDFIGLLGLYGLKYDGLIASVIAIVLVLL
Number of Associated Samples	68
Number of Associated Scaffolds	203

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.51 %
% of genes near scaffold ends (potentially truncated)	44.33 %
% of genes from short scaffolds (< 2000 bps)	97.04 %
Associated GOLD sequencing projects	68
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Unclassified (89.655 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.044 % of family members)
Environment Ontology (ENVO)	Unclassified (98.522 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (97.044 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 203 Family Scaffolds
PF13650	Asp_protease_2	0.49
PF04195	Transposase_28	0.49

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
All Organisms	root	All Organisms	10.34 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
cellular organisms	root	All Organisms → cellular organisms	10.34 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	10.34 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	9.85 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	9.85 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	9.85 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9.85 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	7.88 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	7.88 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	7.88 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7.88 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	7.88 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	7.88 %
Spirurina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	7.88 %
Spiruromorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	7.88 %
Filarioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	7.88 %
Setariidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	7.88 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	5.42 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	5.42 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	2.46 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	2.96 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	2.46 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	2.96 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	1.48 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	1.48 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.49 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.48 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	1.48 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.49 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.48 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	0.49 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.99 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.66 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.48 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	0.49 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.49 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.99 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.99 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005459\|Ga0068867_101743546	Not Available	585	Open in IMG/M
3300015267\|Ga0182122_1035504	Not Available	614	Open in IMG/M
3300015267\|Ga0182122_1042363	Not Available	585	Open in IMG/M
3300015267\|Ga0182122_1048893	Not Available	563	Open in IMG/M
3300015267\|Ga0182122_1064080	Not Available	520	Open in IMG/M
3300015268\|Ga0182154_1008242	Not Available	904	Open in IMG/M
3300015268\|Ga0182154_1015798	Not Available	764	Open in IMG/M
3300015268\|Ga0182154_1015860	Not Available	763	Open in IMG/M
3300015269\|Ga0182113_1009483	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	981	Open in IMG/M
3300015269\|Ga0182113_1038865	Not Available	663	Open in IMG/M
3300015269\|Ga0182113_1050362	Not Available	615	Open in IMG/M
3300015274\|Ga0182188_1011883	Not Available	770	Open in IMG/M
3300015274\|Ga0182188_1060870	Not Available	506	Open in IMG/M
3300015275\|Ga0182172_1014812	Not Available	792	Open in IMG/M
3300015276\|Ga0182170_1035680	Not Available	629	Open in IMG/M
3300015276\|Ga0182170_1046560	Not Available	584	Open in IMG/M
3300015276\|Ga0182170_1061444	Not Available	539	Open in IMG/M
3300015277\|Ga0182128_1010475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	880	Open in IMG/M
3300015277\|Ga0182128_1065309	Not Available	533	Open in IMG/M
3300015277\|Ga0182128_1071671	Not Available	519	Open in IMG/M
3300015279\|Ga0182174_1042429	Not Available	620	Open in IMG/M
3300015282\|Ga0182124_1007678	Not Available	966	Open in IMG/M
3300015282\|Ga0182124_1041578	Not Available	614	Open in IMG/M
3300015282\|Ga0182124_1044797	Not Available	601	Open in IMG/M
3300015283\|Ga0182156_1012544	Not Available	873	Open in IMG/M
3300015283\|Ga0182156_1032763	Not Available	671	Open in IMG/M
3300015285\|Ga0182186_1009313	Not Available	938	Open in IMG/M
3300015285\|Ga0182186_1078556	Not Available	511	Open in IMG/M
3300015285\|Ga0182186_1079622	Not Available	509	Open in IMG/M
3300015286\|Ga0182176_1054041	Not Available	582	Open in IMG/M
3300015286\|Ga0182176_1072793	Not Available	530	Open in IMG/M
3300015286\|Ga0182176_1084088	Not Available	505	Open in IMG/M
3300015287\|Ga0182171_1018520	Not Available	782	Open in IMG/M
3300015288\|Ga0182173_1030566	Not Available	677	Open in IMG/M
3300015289\|Ga0182138_1028608	Not Available	697	Open in IMG/M
3300015289\|Ga0182138_1037965	Not Available	646	Open in IMG/M
3300015289\|Ga0182138_1045078	Not Available	615	Open in IMG/M
3300015289\|Ga0182138_1059589	Not Available	567	Open in IMG/M
3300015289\|Ga0182138_1064095	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	555	Open in IMG/M
3300015291\|Ga0182125_1054636	Not Available	593	Open in IMG/M
3300015291\|Ga0182125_1057120	Not Available	586	Open in IMG/M
3300015292\|Ga0182141_1055204	Not Available	590	Open in IMG/M
3300015294\|Ga0182126_1021870	Not Available	771	Open in IMG/M
3300015294\|Ga0182126_1055481	Not Available	593	Open in IMG/M
3300015294\|Ga0182126_1058783	Not Available	583	Open in IMG/M
3300015294\|Ga0182126_1083745	Not Available	524	Open in IMG/M
3300015295\|Ga0182175_1003965	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1249	Open in IMG/M
3300015295\|Ga0182175_1044383	Not Available	638	Open in IMG/M
3300015295\|Ga0182175_1068446	Not Available	563	Open in IMG/M
3300015296\|Ga0182157_1054835	Not Available	610	Open in IMG/M
3300015298\|Ga0182106_1064414	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	581	Open in IMG/M
3300015298\|Ga0182106_1070525	Not Available	565	Open in IMG/M
3300015298\|Ga0182106_1073591	Not Available	558	Open in IMG/M
3300015298\|Ga0182106_1094349	Not Available	516	Open in IMG/M
3300015299\|Ga0182107_1033635	Not Available	706	Open in IMG/M
3300015299\|Ga0182107_1058265	Not Available	602	Open in IMG/M
3300015300\|Ga0182108_1046975	Not Available	646	Open in IMG/M
3300015300\|Ga0182108_1062576	Not Available	593	Open in IMG/M
3300015300\|Ga0182108_1101718	Not Available	510	Open in IMG/M
3300015300\|Ga0182108_1108010	Not Available	500	Open in IMG/M
3300015302\|Ga0182143_1040784	Not Available	667	Open in IMG/M
3300015302\|Ga0182143_1060125	Not Available	596	Open in IMG/M
3300015302\|Ga0182143_1101146	Not Available	507	Open in IMG/M
3300015302\|Ga0182143_1101361	Not Available	507	Open in IMG/M
3300015303\|Ga0182123_1028596	Not Available	716	Open in IMG/M
3300015303\|Ga0182123_1065116	Not Available	569	Open in IMG/M
3300015303\|Ga0182123_1075863	Not Available	545	Open in IMG/M
3300015303\|Ga0182123_1084056	Not Available	528	Open in IMG/M
3300015303\|Ga0182123_1089196	Not Available	518	Open in IMG/M
3300015305\|Ga0182158_1011640	Not Available	940	Open in IMG/M
3300015305\|Ga0182158_1012991	Not Available	913	Open in IMG/M
3300015305\|Ga0182158_1026387	Not Available	752	Open in IMG/M
3300015307\|Ga0182144_1041850	Not Available	670	Open in IMG/M
3300015307\|Ga0182144_1082525	Not Available	548	Open in IMG/M
3300015308\|Ga0182142_1050531	Not Available	647	Open in IMG/M
3300015314\|Ga0182140_1063604	Not Available	607	Open in IMG/M
3300015322\|Ga0182110_1061560	Not Available	627	Open in IMG/M
3300015322\|Ga0182110_1064591	Not Available	618	Open in IMG/M
3300015341\|Ga0182187_1040335	Not Available	877	Open in IMG/M
3300015341\|Ga0182187_1068793	Not Available	735	Open in IMG/M
3300015341\|Ga0182187_1148578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	561	Open in IMG/M
3300015341\|Ga0182187_1159516	Not Available	547	Open in IMG/M
3300015341\|Ga0182187_1172472	Not Available	531	Open in IMG/M
3300015342\|Ga0182109_1088863	Not Available	710	Open in IMG/M
3300015342\|Ga0182109_1136242	Not Available	607	Open in IMG/M
3300015342\|Ga0182109_1158284	Not Available	574	Open in IMG/M
3300015342\|Ga0182109_1209036	Not Available	515	Open in IMG/M
3300015343\|Ga0182155_1016057	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1225	Open in IMG/M
3300015343\|Ga0182155_1036848	Not Available	949	Open in IMG/M
3300015343\|Ga0182155_1080688	Not Available	729	Open in IMG/M
3300015343\|Ga0182155_1210069	Not Available	515	Open in IMG/M
3300015343\|Ga0182155_1215169	Not Available	511	Open in IMG/M
3300015344\|Ga0182189_1062300	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	811	Open in IMG/M
3300015344\|Ga0182189_1074394	Not Available	762	Open in IMG/M
3300015344\|Ga0182189_1110939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	660	Open in IMG/M
3300015344\|Ga0182189_1145954	Not Available	597	Open in IMG/M
3300015344\|Ga0182189_1163649	Not Available	572	Open in IMG/M
3300015345\|Ga0182111_1115898	Not Available	671	Open in IMG/M
3300015345\|Ga0182111_1172766	Not Available	576	Open in IMG/M
3300015345\|Ga0182111_1197577	Not Available	547	Open in IMG/M
3300015346\|Ga0182139_1112187	Not Available	679	Open in IMG/M
3300015346\|Ga0182139_1127388	Not Available	648	Open in IMG/M
3300015346\|Ga0182139_1129955	Not Available	643	Open in IMG/M
3300015346\|Ga0182139_1139196	Not Available	627	Open in IMG/M
3300015346\|Ga0182139_1177510	Not Available	571	Open in IMG/M
3300015347\|Ga0182177_1109744	Not Available	687	Open in IMG/M
3300015347\|Ga0182177_1116059	Not Available	673	Open in IMG/M
3300015347\|Ga0182177_1153416	Not Available	606	Open in IMG/M
3300015347\|Ga0182177_1156925	Not Available	601	Open in IMG/M
3300015347\|Ga0182177_1174383	Not Available	577	Open in IMG/M
3300015347\|Ga0182177_1249591	Not Available	501	Open in IMG/M
3300015351\|Ga0182161_1016871	Not Available	1384	Open in IMG/M
3300015351\|Ga0182161_1087171	Not Available	780	Open in IMG/M
3300015351\|Ga0182161_1115474	Not Available	701	Open in IMG/M
3300015351\|Ga0182161_1133915	Not Available	662	Open in IMG/M
3300015351\|Ga0182161_1237895	Not Available	527	Open in IMG/M
3300015351\|Ga0182161_1244554	Not Available	521	Open in IMG/M
3300015355\|Ga0182159_1109252	Not Available	828	Open in IMG/M
3300015355\|Ga0182159_1178352	Not Available	675	Open in IMG/M
3300015355\|Ga0182159_1213881	Not Available	624	Open in IMG/M
3300015355\|Ga0182159_1214079	Not Available	624	Open in IMG/M
3300015355\|Ga0182159_1218896	Not Available	618	Open in IMG/M
3300015355\|Ga0182159_1219931	Not Available	617	Open in IMG/M
3300015355\|Ga0182159_1308076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	532	Open in IMG/M
3300015355\|Ga0182159_1320366	Not Available	523	Open in IMG/M
3300015355\|Ga0182159_1339286	Not Available	510	Open in IMG/M
3300015361\|Ga0182145_1098826	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	631	Open in IMG/M
3300015361\|Ga0182145_1102261	Not Available	624	Open in IMG/M
3300015361\|Ga0182145_1152786	Not Available	545	Open in IMG/M
3300017404\|Ga0182203_1016619	Not Available	1021	Open in IMG/M
3300017404\|Ga0182203_1035282	Not Available	818	Open in IMG/M
3300017404\|Ga0182203_1041410	Not Available	780	Open in IMG/M
3300017404\|Ga0182203_1102012	Not Available	588	Open in IMG/M
3300017404\|Ga0182203_1116032	Not Available	564	Open in IMG/M
3300017407\|Ga0182220_1070179	Not Available	570	Open in IMG/M
3300017407\|Ga0182220_1083037	Not Available	543	Open in IMG/M
3300017407\|Ga0182220_1085504	Not Available	539	Open in IMG/M
3300017409\|Ga0182204_1069717	Not Available	594	Open in IMG/M
3300017409\|Ga0182204_1090489	Not Available	549	Open in IMG/M
3300017409\|Ga0182204_1091554	Not Available	547	Open in IMG/M
3300017410\|Ga0182207_1034323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	858	Open in IMG/M
3300017410\|Ga0182207_1058657	Not Available	725	Open in IMG/M
3300017410\|Ga0182207_1071895	Not Available	679	Open in IMG/M
3300017410\|Ga0182207_1120034	Not Available	574	Open in IMG/M
3300017410\|Ga0182207_1121508	Not Available	572	Open in IMG/M
3300017410\|Ga0182207_1155097	Not Available	525	Open in IMG/M
3300017411\|Ga0182208_1055856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	653	Open in IMG/M
3300017411\|Ga0182208_1056281	Not Available	651	Open in IMG/M
3300017411\|Ga0182208_1113178	Not Available	525	Open in IMG/M
3300017411\|Ga0182208_1124117	Not Available	509	Open in IMG/M
3300017413\|Ga0182222_1066333	Not Available	572	Open in IMG/M
3300017413\|Ga0182222_1091611	Not Available	525	Open in IMG/M
3300017417\|Ga0182230_1074698	Not Available	609	Open in IMG/M
3300017417\|Ga0182230_1075835	Not Available	605	Open in IMG/M
3300017417\|Ga0182230_1076049	Not Available	604	Open in IMG/M
3300017420\|Ga0182228_1115419	Not Available	524	Open in IMG/M
3300017424\|Ga0182219_1046280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	709	Open in IMG/M
3300017425\|Ga0182224_1020992	Not Available	948	Open in IMG/M
3300017425\|Ga0182224_1089469	Not Available	614	Open in IMG/M
3300017425\|Ga0182224_1114867	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	567	Open in IMG/M
3300017425\|Ga0182224_1126392	Not Available	550	Open in IMG/M
3300017425\|Ga0182224_1154548	Not Available	514	Open in IMG/M
3300017427\|Ga0182190_1035504	Not Available	844	Open in IMG/M
3300017427\|Ga0182190_1086388	Not Available	628	Open in IMG/M
3300017427\|Ga0182190_1158571	Not Available	509	Open in IMG/M
3300017433\|Ga0182206_1048511	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	733	Open in IMG/M
3300017433\|Ga0182206_1122042	Not Available	548	Open in IMG/M
3300017433\|Ga0182206_1122833	Not Available	547	Open in IMG/M
3300017433\|Ga0182206_1157167	Not Available	504	Open in IMG/M
3300017436\|Ga0182209_1097989	Not Available	606	Open in IMG/M
3300017442\|Ga0182221_1098714	Not Available	597	Open in IMG/M
3300017442\|Ga0182221_1112269	Not Available	573	Open in IMG/M
3300017442\|Ga0182221_1163433	Not Available	509	Open in IMG/M
3300017442\|Ga0182221_1172198	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	500	Open in IMG/M
3300017443\|Ga0182193_1041393	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	845	Open in IMG/M
3300017443\|Ga0182193_1073461	Not Available	704	Open in IMG/M
3300017682\|Ga0182229_1101015	Not Available	513	Open in IMG/M
3300017683\|Ga0182218_1035121	Not Available	787	Open in IMG/M
3300017683\|Ga0182218_1069401	Not Available	643	Open in IMG/M
3300017683\|Ga0182218_1109591	Not Available	559	Open in IMG/M
3300017684\|Ga0182225_1074477	Not Available	618	Open in IMG/M
3300017684\|Ga0182225_1094585	Not Available	574	Open in IMG/M
3300017684\|Ga0182225_1108247	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	551	Open in IMG/M
3300017684\|Ga0182225_1118432	Not Available	535	Open in IMG/M
3300017684\|Ga0182225_1138724	Not Available	509	Open in IMG/M
3300017685\|Ga0182227_1113375	Not Available	538	Open in IMG/M
3300017685\|Ga0182227_1131124	Not Available	509	Open in IMG/M
3300017686\|Ga0182205_1030347	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	887	Open in IMG/M
3300017686\|Ga0182205_1045155	Not Available	781	Open in IMG/M
3300017689\|Ga0182231_1099951	Not Available	559	Open in IMG/M
3300017689\|Ga0182231_1124467	Not Available	505	Open in IMG/M
3300017690\|Ga0182223_1047436	Not Available	656	Open in IMG/M
3300017690\|Ga0182223_1076448	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	576	Open in IMG/M
3300017690\|Ga0182223_1103583	Not Available	529	Open in IMG/M
3300017690\|Ga0182223_1105073	Not Available	527	Open in IMG/M
3300025942\|Ga0207689_10603507	Not Available	923	Open in IMG/M
3300026023\|Ga0207677_12140256	Not Available	520	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.04%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.48%
Roots	Host-Associated → Plants → Roots	1.48%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.04%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.48%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.48%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.48%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.48%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	97.04%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.48%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	1.48%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068867_1017435461	3300005459	Miscanthus Rhizosphere	MYDLGLYVGLFEILRDFIGLPGLYGLKYDGLIASAIAIVLVLL*
Ga0182004_101205652	3300014486	Root	MLNHYDLGLYVSWFEIPRDFIGLPELYGLKYDKLIASVIVFVLVLL*
Ga0182004_101733071	3300014486	Root	MLNHYDLGLYVGWFEIPHDFVGLPELYGLKYDKLITSMIVFVLVLL*
Ga0182004_102222641	3300014486	Root	MLNHYDLGLYVGWFEIPHDFVGLPDLYGLKYDKFIAWVIVFVLVLL*
Ga0182122_10355041	3300015267	Miscanthus Phyllosphere	VVCWGLFEILCDTRWTTGLYGLKYDSVIAPVVAIVLILL*
Ga0182122_10423631	3300015267	Miscanthus Phyllosphere	MYDLALYVCWFEILCDFIGLTGLYGLKYDSLIASVIAIILVLL*
Ga0182122_10488931	3300015267	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIELQCLYGLKYDGLIASVIAIVLVLL*
Ga0182122_10640801	3300015267	Miscanthus Phyllosphere	MYDLGLYVGLFEILCDFIGLPGLYGLKYDGLIAPVITIVPVLL*
Ga0182154_10082422	3300015268	Miscanthus Phyllosphere	LFEILRDFIGLPGLYGFKYDSLITSVIAIVLVLL*
Ga0182154_10157981	3300015268	Miscanthus Phyllosphere	MYDLGLYVYLFEILRDFIELLGLYGFKFDGSITSMIAIVLVLL
Ga0182154_10158601	3300015268	Miscanthus Phyllosphere	MYDLGLYYSLFEILYDFIGLPGLYGLKYDGLIALMIAIVFVLL*
Ga0182154_10450771	3300015268	Miscanthus Phyllosphere	FVCWLFEIFRDFVGLLGLYGLKYDGSITSVIAIVLVLL*
Ga0182113_10094831	3300015269	Miscanthus Phyllosphere	YVGWFEILRDFIGLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182113_10388651	3300015269	Miscanthus Phyllosphere	MYDLGLYVGWFEILHDFIGLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182113_10503621	3300015269	Miscanthus Phyllosphere	MYDLGLYVGLFEIPRDFTGLPGLYGLTYDGLIASAIAIVLVLL*
Ga0182188_10118831	3300015274	Miscanthus Phyllosphere	IGLFEILHDFIRLPGLYWFKYDGSITLVVAIVLVLL*
Ga0182188_10608701	3300015274	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLPGLYGFKYDGLIASVIDIILVLL*
Ga0182172_10148121	3300015275	Miscanthus Phyllosphere	MYDLGLYVGLFEIPHDLTGLPGLYGPKYDGLIALAIAIVLALL*
Ga0182170_10356801	3300015276	Miscanthus Phyllosphere	MYNLGLYVGLFEIPRDFTGLPGLYGLKYDGLIASVIAIVLVL
Ga0182170_10465602	3300015276	Miscanthus Phyllosphere	WLFEILRDFIRLPGLYGLEYDGLIASVIAIVLVLL*
Ga0182170_10614441	3300015276	Miscanthus Phyllosphere	MYVLGLYVGLFEILRDFIGLSGLYGLKYDSLIALVIAIVLV
Ga0182128_10104752	3300015277	Miscanthus Phyllosphere	DLGLYVGLFEIPRDFTRLPGLYGLKYDGLIASAIAIILVLL*
Ga0182128_10653091	3300015277	Miscanthus Phyllosphere	MYDLGLYVGLFEILHDFIRLPGLYGLKYHSLIASVIAIILVL
Ga0182128_10716711	3300015277	Miscanthus Phyllosphere	DWLCIIYNLGLYVGLFEIPHDFTGLPGLYGLKYDRLIASAIAIVLVLL
Ga0182174_10424291	3300015279	Miscanthus Phyllosphere	MYDLGLYVGLFEILHDFIRLPGFYGLNYDSLITSVIAIVLLLL*
Ga0182124_10076781	3300015282	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLPGLYGLKYDSLIASMIANVLVLL*
Ga0182124_10415781	3300015282	Miscanthus Phyllosphere	MYGLGLYAGLFEILRDFIRLPGLYVLKYDSLIASVIAI
Ga0182124_10447971	3300015282	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLPGLYGFKYDGSIASIIAIVLVLL*
Ga0182156_10125441	3300015283	Miscanthus Phyllosphere	MYDLGLYVGLFEILHYFIGLPGLYGLKYDGLIALVIAIVLVLL*
Ga0182156_10327631	3300015283	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLLGLYGLKYDGLITSVIAIVLVLL*
Ga0182186_10093133	3300015285	Miscanthus Phyllosphere	MYDLGFYVGLFEILHDFIGLPGLYGLKYDGLIALVIAIVLVLL*
Ga0182186_10785562	3300015285	Miscanthus Phyllosphere	YDLGLYVGLFEILRDFIGLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182186_10796221	3300015285	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLPGLYGLKYDSLIATVIAIALVLL*
Ga0182176_10540411	3300015286	Miscanthus Phyllosphere	MYDLGLYVGLIEIIHDFIGLPGLYGLKYDSAIAPMVAIVLVFL*
Ga0182176_10727931	3300015286	Miscanthus Phyllosphere	MYNLGLYVGLFEILHDFIRLPGLYGLKYDSLIALMI
Ga0182176_10840881	3300015286	Miscanthus Phyllosphere	YVGLFEILHDFIGLPGLYGLTYDGLIASAIAIVLVLL*
Ga0182171_10185201	3300015287	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLPGLYGLKYDNLMASVIAIVLVFL*
Ga0182173_10305661	3300015288	Miscanthus Phyllosphere	MYDLSLYVGLFEIPRDFIRLPGLYGLKYDGLIALAIAIILVLL*
Ga0182138_10286081	3300015289	Miscanthus Phyllosphere	MYDLGLYVGLFKILRDFIGLPGLYGIKYDSLIVSVIAIILVHL*
Ga0182138_10379651	3300015289	Miscanthus Phyllosphere	MYDLGLYVDLFEILRDFIGLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182138_10450782	3300015289	Miscanthus Phyllosphere	MYDLGLYVGLFVTPRDFIGLPGLYGLKYDGLIASAIAIVLMLL*
Ga0182138_10595891	3300015289	Miscanthus Phyllosphere	MYDLGLYVGLFDIPHDFARLPSLYGLKYDGLIALAIAIVLVLL*
Ga0182138_10640951	3300015289	Miscanthus Phyllosphere	DLGLYVGLFEILRDFIGLPGLYGFKYDGSIVSVIAIVLVLL*
Ga0182125_10546361	3300015291	Miscanthus Phyllosphere	MYDLGLYVGLFKILRDFIGLSGLYGLKYDSLISSVIAIVLVLL*
Ga0182125_10571201	3300015291	Miscanthus Phyllosphere	MYDLGLYVGLFEIIHDFIGLLGLYGFKYDGSIVSVIAIVLVLL*
Ga0182141_10552041	3300015292	Miscanthus Phyllosphere	DLSLYDGLFEIPRDLTRLPSLYGLQCDGLIASAIAIVLMLL*
Ga0182126_10218701	3300015294	Miscanthus Phyllosphere	YDLDLYVGFFEIHHDFIILPDLYELKYDGLIASVIAIILVLL*
Ga0182126_10554811	3300015294	Miscanthus Phyllosphere	MYALGLYVGLFEILRDFIRLPDLYGFKYDGLITSVIAIVLV
Ga0182126_10587831	3300015294	Miscanthus Phyllosphere	MYDLGLYVGLFEILHDFIGVPDLYGFKYEGLIALVIAIVLMLL*
Ga0182126_10837451	3300015294	Miscanthus Phyllosphere	MYDLGLYVGLIEIPRDFIGLTGLYGLKYDGLIASLIAIVLVLL*
Ga0182175_10039651	3300015295	Miscanthus Phyllosphere	DLGLYIGLFEILHDFIGLPGLYWLKCDGLIASVIAIVLVLL*
Ga0182175_10443832	3300015295	Miscanthus Phyllosphere	GLFEILHDFIRLPGLYGLKYDGLVASVIAIVLVLL*
Ga0182175_10684462	3300015295	Miscanthus Phyllosphere	LFEILRDFIGLPGLYGLKYDSLIASVIAIVLVLI*
Ga0182157_10548351	3300015296	Miscanthus Phyllosphere	MYDLGLYVGFFEILRDFIGLPGLYGFKYGGLITSVIAIVL
Ga0182106_10644141	3300015298	Miscanthus Phyllosphere	DLGLYIAQFEILRDFIGLSGLYGFKYDDLIALVIAIVLVLL*
Ga0182106_10705251	3300015298	Miscanthus Phyllosphere	LYVGLFEILHDFIGLSGLYRLKYDSLIASVIAIVLVLL*
Ga0182106_10735911	3300015298	Miscanthus Phyllosphere	MYDLGLYVGLFEIPHDFTRLSGLYGLKYDGLIASAIAIVLVLL*
Ga0182106_10943491	3300015298	Miscanthus Phyllosphere	IMYDLGLYVSWFELLRDFIGLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182107_10336351	3300015299	Miscanthus Phyllosphere	YVGLFEIHHDFTGLPGLYGLKYDGLISSVIAIVLVLL*
Ga0182107_10582651	3300015299	Miscanthus Phyllosphere	MYDLGLYVGLLEIPRDFIGLPGLYGFKYDSLIASVIAIVLVVL*
Ga0182108_10469751	3300015300	Miscanthus Phyllosphere	MYDLGLYIGLFEILHDFIGLLSLYGFKYDGLIASVIAIVLVLL*
Ga0182108_10625761	3300015300	Miscanthus Phyllosphere	MYDLGFYVGWFEILRDFIGLPGLYGLKYDSLIALVIAIVLVLL*
Ga0182108_11017181	3300015300	Miscanthus Phyllosphere	MYDLSLYVGLFEIPRDFTGLPGLYGLKYDGLIASVIAIVLVLL*
Ga0182108_11080101	3300015300	Miscanthus Phyllosphere	MYDLGLYVGLLEILRDFIGLPGLYGFKYDGLIALVIAFVFMLL*
Ga0182143_10407841	3300015302	Miscanthus Phyllosphere	MYDLSLYDGLFEIPRDLTRLPSLYGLQCDGLIASAIAIVLMLL*
Ga0182143_10601251	3300015302	Miscanthus Phyllosphere	VLNLYDLGLYVGWFEILRDFIELSDLYGLKYDSLIASVIAIVLVLL*
Ga0182143_11011461	3300015302	Miscanthus Phyllosphere	MYDLVLYVGLFEILRDFIGLPDLYGFKYDCLIASVI
Ga0182143_11013611	3300015302	Miscanthus Phyllosphere	MYDLGLYVGWCEIFHDFIELPGLYGLKYDSLISLVIAIVLVLL*
Ga0182123_10285961	3300015303	Miscanthus Phyllosphere	MYDLGLYVGLFEIFHDFIGLSGLYGLRYDGLVASVIAIVLVLL*
Ga0182123_10651161	3300015303	Miscanthus Phyllosphere	MYDLGLYVGLFEILRGFIRQPGLYGFKYDGLIALVIAI
Ga0182123_10758631	3300015303	Miscanthus Phyllosphere	MYDLGLFEIPHDFTGLPGLYGLKYDGLIASVIAIVLVL
Ga0182123_10840562	3300015303	Miscanthus Phyllosphere	GLFEILRDFIGLPGLYGLKYDSLIALVIAIVLVLL*
Ga0182123_10891962	3300015303	Miscanthus Phyllosphere	MYDIGLYVGLFEILCDFTRLPGLYGFKYDGLIALVIAIVLVLL*
Ga0182158_10116402	3300015305	Miscanthus Phyllosphere	MYDLGLYVGLFEILHDFIGLPGLYGFKYDGLIASVIAIVLVLL*
Ga0182158_10129911	3300015305	Miscanthus Phyllosphere	MYDLGLYVGLFEIPRDFIGLLGLYGFKYDGSIALVIAIVLVLL*
Ga0182158_10263871	3300015305	Miscanthus Phyllosphere	MYDLGLYAGLFEILRDFTGLPGLYGLKYDGLIASAIAIVLVLL*
Ga0182144_10418502	3300015307	Miscanthus Phyllosphere	MLTLYDLGLYVGWFEILCDFIGLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182144_10825251	3300015307	Miscanthus Phyllosphere	MYDLGLYVGLFEILHDFIGLPGLYGFKYDGLIASVIAIVL
Ga0182142_10505311	3300015308	Miscanthus Phyllosphere	MYDPGLYVGLFEILRDFIGLLGLYGFKYDSLIASVIAIVLV
Ga0182140_10636042	3300015314	Miscanthus Phyllosphere	MYDLGLYVGWFEILRDFIGLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182110_10615601	3300015322	Miscanthus Phyllosphere	CIMYDLDLYVGLFEILCDFIGLPGLYGLKYDSLIASVIDIVLVLL
Ga0182110_10645911	3300015322	Miscanthus Phyllosphere	VGWFEILHDFIGLPGLYELKYDSLIASVIAIILVLL*
Ga0182129_11172941	3300015323	Miscanthus Phyllosphere	VCWLFEILHNFVGLPGLYGLKYNGLIASVIAIVLVLL*
Ga0182187_10403351	3300015341	Miscanthus Phyllosphere	LGLYVGLFEILHGFIELPDLYGFKYDSLIALVIAIVLLLL*
Ga0182187_10687931	3300015341	Miscanthus Phyllosphere	MYDLGLYVGWFEILRDFIGLPGLYWLKYDSLIASVIAIVLVLL*
Ga0182187_11485782	3300015341	Miscanthus Phyllosphere	VGLFEILRDFIGLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182187_11595162	3300015341	Miscanthus Phyllosphere	LGLYVELFEIFCDFTGLLGLYGLKYDSLIASAISIVLVLL*
Ga0182187_11724721	3300015341	Miscanthus Phyllosphere	MYDLGLYVDLFEILHDFIGLPCLYGLKYDSLIASVIAIVLVLL*
Ga0182109_10888633	3300015342	Miscanthus Phyllosphere	MYDLGLYVGWFEILHDFIGLPGLYGLKYDSLITSVIAIIHVLL*
Ga0182109_11362421	3300015342	Miscanthus Phyllosphere	VYDLGLYVGLFEIPHDFTGLLGLYGLKYDGLIALAIAIVLVLL*
Ga0182109_11582842	3300015342	Miscanthus Phyllosphere	GLFEILHDFIELPGLYGLKYDSLIALVIAILLVLL*
Ga0182109_12090361	3300015342	Miscanthus Phyllosphere	MYDLGLYVGLFEIPRDFTGLPGLYGLKYDGLIASVIAIILVLL*
Ga0182155_10160573	3300015343	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLPGLYGFKYDGSIVSVIAIVLVLL*
Ga0182155_10368481	3300015343	Miscanthus Phyllosphere	MYDLGLYVGWFEILCDFIGLSGLYGLKYDSLIASVIAVVLVLL*
Ga0182155_10806881	3300015343	Miscanthus Phyllosphere	LGLYVGWFEILRDFIGLPGLYGLKYDSLIASVIAIILVLL*
Ga0182155_12100693	3300015343	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLLGLYGFKYDGSIASVIAIVLVLL*
Ga0182155_12151692	3300015343	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLPGLYGLKYDGLIVLVIAIVLVLL*
Ga0182189_10623002	3300015344	Miscanthus Phyllosphere	CIMYDLGLYVGLFEILRDFIRLPGLYGLKYDGFIALVIAIVLVLLYIGWF
Ga0182189_10743941	3300015344	Miscanthus Phyllosphere	VGWFEILRDFIELSDLYGLKYDSLIASVIAIVLVLL*
Ga0182189_11109392	3300015344	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIELPGLYGLKYDSLIASVIAIVLVLS*
Ga0182189_11459541	3300015344	Miscanthus Phyllosphere	DLGLHVGLFEILRDFIGLLGLYGLKYDGLITSAIAIILVLL*
Ga0182189_11636491	3300015344	Miscanthus Phyllosphere	MYDLSLYVGLFEIPHDFTKLPGLYGLKYDGLIALAIAIVLVLL*
Ga0182111_11158981	3300015345	Miscanthus Phyllosphere	MYDLGLYVGWFEILHDFIGLPGLYGLKYDSLIASVIAIVLV
Ga0182111_11727661	3300015345	Miscanthus Phyllosphere	DLGLYVGLFEILRDFIGLPGLYGLKYDGFIALVIAIVLVLL*
Ga0182111_11975771	3300015345	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLLGLYGFKYDGSIASVIAIVLV
Ga0182139_11121872	3300015346	Miscanthus Phyllosphere	MYDLGLYVGWFEIHRDFIGLPGLYGLKYDSLIALVIAIVLVLL*
Ga0182139_11273881	3300015346	Miscanthus Phyllosphere	DLLCCSMYDLDLYVSWFEILRDFIGLPGLYGLKYEGLIASVIAIVLVLL*
Ga0182139_11299552	3300015346	Miscanthus Phyllosphere	GLFEIPHDFIGLPSLYGLKYDGLITSAIAIVLVLL*
Ga0182139_11391961	3300015346	Miscanthus Phyllosphere	LGLYIGLFEILHDFIGLLRLYGLKYDGLIALMIAIVLVLL*
Ga0182139_11775101	3300015346	Miscanthus Phyllosphere	MYDLGLFVGLFEILHDFIGLPGLYGLKYDGLIAPVIATVLVLL*
Ga0182177_11097441	3300015347	Miscanthus Phyllosphere	MYNIGLYIGLFEILHDFIGLPGLYGLKYDSLIASVIAIILVLL*
Ga0182177_11160591	3300015347	Miscanthus Phyllosphere	IMYDLGLYVGLFEIPHDFTRLPGLYGLKYHGLIASAIAIVLVLL*
Ga0182177_11534161	3300015347	Miscanthus Phyllosphere	MYDLGLYVGWFEILYDFIGLLGLYGLKYDGLITSVIAIVLVLL*
Ga0182177_11569251	3300015347	Miscanthus Phyllosphere	MYDLGLYVGLFEIPRDFTGLPGLYGLKYDGLIASAIAIVLVLL*
Ga0182177_11743831	3300015347	Miscanthus Phyllosphere	MYDLGLYVGWFEILHDFIGLPGLYGLKYDSLITLVIAIVLVLL*
Ga0182177_12495911	3300015347	Miscanthus Phyllosphere	MYDLGLYVGLFEILCDFIGLPGLYGLKYDGLIALTIAIILVLL*
Ga0182161_10168711	3300015351	Miscanthus Phyllosphere	MCDLGFYVGLFEILHDFIRLLGLYGLKYDSLITLVIAIVLVLL*
Ga0182161_10871711	3300015351	Miscanthus Phyllosphere	MYDLDLYVGLFEILHDFIGLPGLYGLKYYGLIASVIAIVFVLL*
Ga0182161_11154742	3300015351	Miscanthus Phyllosphere	MYDLGLYVGWFEILRDFVGLPGLYWLKYDSLIASVIAIVLVLL*
Ga0182161_11339152	3300015351	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLTGLYGLKYDGLIVSVIAIVLVLL*
Ga0182161_12378951	3300015351	Miscanthus Phyllosphere	MYDLSLYVGLFEILHDFIRLPGFYGLNYDSLITSVIAIVLLLL*
Ga0182161_12445541	3300015351	Miscanthus Phyllosphere	MYDLRLYVGLFEIPHDFTGLLSLYGLKYDGLIASV
Ga0182159_11092521	3300015355	Miscanthus Phyllosphere	YDWLCRIMYDLGLYVGLFEILRDFIGLSGLYGLKYDGLIALVIAIVLVLL*
Ga0182159_11783522	3300015355	Miscanthus Phyllosphere	MYDLDLYVSLFEILRDFIGLPGLYGLKYDGLIALVIAIALVLL*
Ga0182159_12138811	3300015355	Miscanthus Phyllosphere	MYDLGLYVGLFGILHDFIGLPGLYRLKYDGLIASVIAIVLVLL*
Ga0182159_12140791	3300015355	Miscanthus Phyllosphere	MYDLVLYVGWFEIFCDFNGLPGLYGLKYESLIPLVIAIVLVLLLIGWFYYNH*
Ga0182159_12188961	3300015355	Miscanthus Phyllosphere	YDLGLYVGLFEIPRDFTGLPGLYGLKYDGLIASTIAIVLVLL*
Ga0182159_12199311	3300015355	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIRLPSLYGFKYDGLIASVIAVVLVLL*
Ga0182159_13080761	3300015355	Miscanthus Phyllosphere	MYDLGLYVGLFETRRDFIGLLGLYGSKYDSLIASPIAIVPVLL*
Ga0182159_13203661	3300015355	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLLGLYGLKYDGLIASVIAIVLVLL*
Ga0182159_13392861	3300015355	Miscanthus Phyllosphere	LGFYVGWFEILRDFIRLPGLYGLKYDSLIASVIAIVLVLL*
Ga0182145_10988262	3300015361	Miscanthus Phyllosphere	FVCWLFEILHDFIGLPGLYGLKYNGLITLVIAIVLMLL*
Ga0182145_11022611	3300015361	Miscanthus Phyllosphere	MYDLGLYVSLFEILRDFIGLPGLNGLKYDSLIASVIAIVLVLL*
Ga0182145_11527861	3300015361	Miscanthus Phyllosphere	MYDLGLYAGLFEILCDFIGLLGLYGFKYDGSIASVIAIVLVLL*
Ga0182203_10166191	3300017404	Miscanthus Phyllosphere	MYDLGLYVGLFEIPHDFTGLPGLYGLKYDGLIASAIAIVLVLL
Ga0182203_10352821	3300017404	Miscanthus Phyllosphere	MYDLGLYVGWFEILRDFVGLPGLYGLKYDSLIALVIAILLVLL
Ga0182203_10414103	3300017404	Miscanthus Phyllosphere	MYDLGLYVGLFEIPRDLTGLPGLYGLKYVCLITSVIAIVLVHL
Ga0182203_11020122	3300017404	Miscanthus Phyllosphere	MYNLGLYVGLFEILHDFIGLPGLYGFKYDGSITSLIAIVLVLL
Ga0182203_11160321	3300017404	Miscanthus Phyllosphere	MYDLDLYVGLFEIPRDFTGLSGLYGLKYDGLIALAIAIVLVLL
Ga0182220_10701791	3300017407	Miscanthus Phyllosphere	MYNLGLYVGLFEISHDFIGLPGLYGFKYDGLIALV
Ga0182220_10830371	3300017407	Miscanthus Phyllosphere	CXIMYDLGLYVGLFEIIRDFTRLPGLYGLKYDGLIASGIAIVLVLL
Ga0182220_10855041	3300017407	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLPGLYGLKYDSTIALVIAIVLVLL
Ga0182204_10697171	3300017409	Miscanthus Phyllosphere	MYDLGLYVGLFEILCDFIGLPGLYGLKYDGLIASVIAIVLVL
Ga0182204_10904892	3300017409	Miscanthus Phyllosphere	MYDLDLYVGLFEILHDFIRLPGLYRLKYDGLITLVIVPVLVFL
Ga0182204_10915542	3300017409	Miscanthus Phyllosphere	VGLFEIPHDFTRLPSLYGLKYDGLIASAIAIVLVLL
Ga0182207_10343231	3300017410	Miscanthus Phyllosphere	MYDFGWYVCLFEIPHDFIGLLALYGLKYDGLIASAIAIVLVLL
Ga0182207_10586571	3300017410	Miscanthus Phyllosphere	MYDLGLYVGLFGILHDFIGLSGLYGLKYDGLIASVIAIVL
Ga0182207_10718952	3300017410	Miscanthus Phyllosphere	MYDIGLYVGLFEILHDFTALPSLYGFKYDGLIALVIAIVLVLL
Ga0182207_11200342	3300017410	Miscanthus Phyllosphere	YDLGLYVGLFEILRDFIGLLGLYGLKYDGLIASVIAIVLVLL
Ga0182207_11215082	3300017410	Miscanthus Phyllosphere	MYDLGLYIGLFEILHDFIGLPSLYGLKYEGLIISVIAIVLVPL
Ga0182207_11550971	3300017410	Miscanthus Phyllosphere	IMYDLDLYVGLFEILRDFIGLPGLYGLKYDSLIASMIAIVLVFL
Ga0182208_10558561	3300017411	Miscanthus Phyllosphere	YVGLFEILCDFIRLLDLYGFKYDGLIALVIAFVFMLL
Ga0182208_10562811	3300017411	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLLGLYGFKYDGSIASVIAIVLVLL
Ga0182208_11131781	3300017411	Miscanthus Phyllosphere	LGLYVGWFEILCDFIGLSGLYGLKYDSLIASVIAIVLVLL
Ga0182208_11241171	3300017411	Miscanthus Phyllosphere	MYDLGLYVGWFEILHDFIGLSGLYGLKCDSLIASV
Ga0182222_10663331	3300017413	Miscanthus Phyllosphere	IMYDLGLYVGLFEIPLDFTGLPGLYGLKYDGLIASVIAIVLVLL
Ga0182222_10916111	3300017413	Miscanthus Phyllosphere	MYDLDLCIGLFEILHDFIGLLGLYGLKYDGLIASVIAIVLVLL
Ga0182202_10278871	3300017415	Miscanthus Phyllosphere	WLFEILRDFVGLPGLYRLTYDGLIASVIAIVLVFL
Ga0182230_10746981	3300017417	Miscanthus Phyllosphere	MYDIGLYVGLFEILHDFIGLLGLYGFKYDSSIASVIAIVLVLL
Ga0182230_10758351	3300017417	Miscanthus Phyllosphere	MYDLGLYVGLFEIPSDFTRLPSLYGLKYDGLIASVIAIILVLL
Ga0182230_10760491	3300017417	Miscanthus Phyllosphere	VGLFEILCDFIGLPGLYGLKYDSLIALVIAIVLVLL
Ga0182228_11154192	3300017420	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLSGLYGFKYDGSITSVIAIVLVLL
Ga0182219_10462802	3300017424	Miscanthus Phyllosphere	MYDLGLYVGLLEILHDFIGLPGLYGLKYDSLIASVIAIILVLL
Ga0182224_10209921	3300017425	Miscanthus Phyllosphere	VGLFEIPRDFTGLPGLYGLKYDGLIASAIAIVLVLL
Ga0182224_10894691	3300017425	Miscanthus Phyllosphere	MYDLGLYVGLLEIPRDFIGLPGLYGFKYDSSITSVVAIVLVLL
Ga0182224_11148672	3300017425	Miscanthus Phyllosphere	GLYVGLFEILRDFIRLPSLYGFKYDSLIALVIAIVLMLL
Ga0182224_11263921	3300017425	Miscanthus Phyllosphere	MYALGLYVGLFEILHDFIGLPGLYGLKYDSLIALVIAIVLVLL
Ga0182224_11545481	3300017425	Miscanthus Phyllosphere	MYDLALYVGLFEILRDFIGLPGLYGLKYDGLIASVIAIVLVLL
Ga0182190_10355041	3300017427	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIRLPSLYGFKYDSLIALVIAIVLMLL
Ga0182190_10863881	3300017427	Miscanthus Phyllosphere	MYDLGLYVGLFKIPCDFTRLLGLYGLKYDGLIASVIAIV
Ga0182190_11585712	3300017427	Miscanthus Phyllosphere	GCFEILRDFIRLPGLYGLKYDGLITSMIVIVLVLL
Ga0182206_10485112	3300017433	Miscanthus Phyllosphere	GLFEILHDFIRLPGLYGLKYDGLIASVIAIVLVLL
Ga0182206_11220422	3300017433	Miscanthus Phyllosphere	MYDLGLYVGWFEILHDFIGLPGLYGLKYDSLITSVIAIIHVLL
Ga0182206_11228332	3300017433	Miscanthus Phyllosphere	MYDLGLYIGLFDILSDFIRLPGLYGFRYDGLITSVIAIVLVLL
Ga0182206_11571671	3300017433	Miscanthus Phyllosphere	YIGLFEILHDFIRLPGLYWFKYDGSITLVVAIVLVLL
Ga0182209_10979891	3300017436	Miscanthus Phyllosphere	LYVGLFEILRDFIGLLGIYGLKYDSLIASVIAIVLVLL
Ga0182221_10987141	3300017442	Miscanthus Phyllosphere	MYDLVLYAGLFEIPSDFIRLPGLYELKYDGLIASVIAIVFVLL
Ga0182221_11122691	3300017442	Miscanthus Phyllosphere	MYDLSLYVGLFEILRDFIGLPGLFGLKYDGSIASEIAIVLVLL
Ga0182221_11634331	3300017442	Miscanthus Phyllosphere	MYDLGLYVDLFEILRNFIGLPGLYGLKYDSLIASVIATVLVLL
Ga0182221_11721981	3300017442	Miscanthus Phyllosphere	DIALYVGLFEILCDFIRLSGLYGLKYNGLIALVIATVLVLL
Ga0182193_10413931	3300017443	Miscanthus Phyllosphere	YDLGLYVGLFEILRDFIGLPGLYGLKYDSLIASVIAIILMLL
Ga0182193_10734611	3300017443	Miscanthus Phyllosphere	MYDLGLYVGLFEILHDFIGLPGLYGLKYDGLIASAIAIVLVLL
Ga0182229_11010152	3300017682	Miscanthus Phyllosphere	MYDLGLYVGLFEILHDFIGLPGLYGFKYDGLIASVIAIVLVLL
Ga0182218_10351211	3300017683	Miscanthus Phyllosphere	DLSLYVGLFKILHDFIRLPGLYGLKYDGLIASVIAIVLVLL
Ga0182218_10694011	3300017683	Miscanthus Phyllosphere	MYDLGLYVGLFEIFRDFIGLAGLYGLKYDGLIASVIAIVLVLL
Ga0182218_11095911	3300017683	Miscanthus Phyllosphere	MYDLGLYVGLFEIPHDFTSLPDLYGLKYNGLIAWAIAIVLELL
Ga0182225_10744772	3300017684	Miscanthus Phyllosphere	LYVGLFEILSDFIRLSGLYRLKYDSLIDSVIAIVLVLL
Ga0182225_10945851	3300017684	Miscanthus Phyllosphere	LYVGWFEILRDFIGLPGLYGLKYESLITSVIAIVLVLL
Ga0182225_11082471	3300017684	Miscanthus Phyllosphere	MYDLGLYVSLFEILHDFIGLSGLYGLKYDGLITSVIAIILVLL
Ga0182225_11184321	3300017684	Miscanthus Phyllosphere	IMYDLGLYVGLFEILHDFIELPSLYGLKYDSLIASVIATVLVLL
Ga0182225_11387241	3300017684	Miscanthus Phyllosphere	MYDLGLYVGLFEIPRDFTRLPGLYGVKYDDLIASVIAIVLVLL
Ga0182227_11133751	3300017685	Miscanthus Phyllosphere	MYDLGLYVGWFEILRDFIGLPGLYGLKYNSLIASVIAIVLVLL
Ga0182227_11311241	3300017685	Miscanthus Phyllosphere	IMYDLGLYVSLFEILRDFIGLPNLYGFKYDGLITSVIAIVPVLL
Ga0182205_10303471	3300017686	Miscanthus Phyllosphere	MYDLDLYVGLFEILRDFIGLPGLYGLKYDSLIASVIAIVLVLL
Ga0182205_10451551	3300017686	Miscanthus Phyllosphere	XIMYDLGLYVGLFEILRDFIGLPGLYGLQYDGLIALVIAIVLVLL
Ga0182231_10999511	3300017689	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLSGLYGFKYDGSITSVIAIVLVLI
Ga0182231_11244672	3300017689	Miscanthus Phyllosphere	MYDLGLYVGLFEKLHDFIGLLGLYGLKYDGLIASVIAIVLVLL
Ga0182223_10474361	3300017690	Miscanthus Phyllosphere	MYDLGLYIGLFEILHDFIELLGLYGLKYDGFVALVIAIVLVLL
Ga0182223_10764482	3300017690	Miscanthus Phyllosphere	DLGLYVGLFKILHDFIGLPSLYGLKYDSLIASLIAIVLVLL
Ga0182223_11035831	3300017690	Miscanthus Phyllosphere	MYDLGLYVGLFEILRDFIGLLGLYGFKYDGSIASVIAIVFVLL
Ga0182223_11050731	3300017690	Miscanthus Phyllosphere	MYDLGLYVGWFEILHDFIGLPGLYGLKYDSLITSMIAIIHVLL
Ga0207689_106035072	3300025942	Miscanthus Rhizosphere	MYDLGFYVGLFEIPHDFIGLPGLYGFKYDSLITSVIAIVLVL
Ga0207677_121402561	3300026023	Miscanthus Rhizosphere	HVRSWLYVGLFEILHDFIGLSGLYRLKYDSLIASVIAIVLVLL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F024935

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign