Metagenome Family F025672

Basic Information
Family ID	F025672
Family Type	Metagenome
Number of Sequences	200
Average Sequence Length	41 residues
Representative Sequence	FFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Number of Associated Samples	33
Number of Associated Scaffolds	200

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	29.59 %
% of genes near scaffold ends (potentially truncated)	72.50 %
% of genes from short scaffolds (< 2000 bps)	53.50 %
Associated GOLD sequencing projects	33
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Eukaryota (55.000 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (74.000 % of family members)
Environment Ontology (ENVO)	Unclassified (95.500 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (77.500 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 200 Family Scaffolds
PF13966	zf-RVT	8.00
PF00078	RVT_1	6.50
PF03732	Retrotrans_gag	5.00
PF00612	IQ	2.00
PF00665	rve	1.00
PF09337	zf-H2C2	1.00
PF00098	zf-CCHC	1.00
PF03641	Lysine_decarbox	1.00
PF00385	Chromo	0.50
PF13456	RVT_3	0.50
PF14111	DUF4283	0.50

COG ID	Name	Functional Category	% Frequency in 200 Family Scaffolds
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	1.00
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	1.00
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	1.00
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	1.00
COG4584	Transposase	Mobilome: prophages, transposons [X]	1.00

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	68.00 %
Unclassified	root	N/A	32.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	67.50 %
Unclassified	root	N/A	32.00 %
Viruses	superkingdom	All Organisms → Viruses	0.50 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	55.00 %
Unclassified	root	N/A	32.00 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	54.50 %
Unclassified	root	N/A	32.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	12.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	54.50 %
Unclassified	root	N/A	32.00 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	12.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	46.00 %
Unclassified	root	N/A	32.00 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	10.00 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	1.50 %
Vibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	46.00 %
Unclassified	root	N/A	32.00 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	10.00 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.50 %
Vibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	39.00 %
Unclassified	root	N/A	32.00 %
Klebsiella/Raoultella group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group	10.00 %
Methylomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas	1.50 %
Vibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	39.00 %
Unclassified	root	N/A	32.00 %
Klebsiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella	10.00 %
unclassified Methylomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas	1.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	39.00 %
Unclassified	root	N/A	32.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	39.00 %
Unclassified	root	N/A	32.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	34.50 %
Unclassified	root	N/A	32.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	34.50 %
Unclassified	root	N/A	32.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	34.50 %
Unclassified	root	N/A	32.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	34.50 %
Unclassified	root	N/A	32.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	31.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	3.50 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	30.50 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Ericales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales	2.50 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
lamiids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids	1.00 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	27.50 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	3.00 %
Theaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae	2.50 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Lamiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales	1.00 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	27.50 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	3.00 %
Camellia	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia	2.50 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Oleaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae	1.00 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	25.50 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	3.00 %
Camellia sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2.50 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Oleeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae	1.00 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	20.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	3.00 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	3.00 %
Camellia sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2.50 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Olea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea	1.00 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	17.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	3.00 %
Camellia sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2.50 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	2.00 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	2.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Olea europaea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea	1.00 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	1.00 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.50 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	17.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	3.00 %
Camellia sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2.50 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	2.00 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	2.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Olea europaea subsp. europaea	subspecies	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea	1.00 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	1.00 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.50 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	17.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	3.00 %
Camellia sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2.50 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	2.00 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	2.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Olea europaea var. sylvestris	varietas	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea → Olea europaea var. sylvestris	1.00 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	1.00 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.50 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	17.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	3.00 %
Camellia sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2.50 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	2.00 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	2.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Olea europaea var. sylvestris	varietas	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea → Olea europaea var. sylvestris	1.00 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	1.00 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.50 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	17.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	3.00 %
Camellia sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2.50 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	2.00 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	2.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Olea europaea var. sylvestris	varietas	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea → Olea europaea var. sylvestris	1.00 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	1.00 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.50 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.00 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	17.00 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	10.00 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	3.00 %
Camellia sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2.50 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	2.00 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	2.00 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.50 %
Olea europaea var. sylvestris	varietas	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea → Olea europaea var. sylvestris	1.00 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	1.00 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.50 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.50 %
Vibrio ouci	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	0.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.50 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002243\|C687J29039_10228859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	649	Open in IMG/M
3300004481\|Ga0069718_15243080	Not Available	1046	Open in IMG/M
3300006854\|Ga0075425_100134112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2832	Open in IMG/M
3300006871\|Ga0075434_100274275	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	1706	Open in IMG/M
3300006904\|Ga0075424_100108421	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2932	Open in IMG/M
3300019871\|Ga0193702_1023818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	788	Open in IMG/M
3300025119\|Ga0209126_1032720	Not Available	1578	Open in IMG/M
3300028786\|Ga0307517_10005034	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	20097	Open in IMG/M
3300028786\|Ga0307517_10012523	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	11628	Open in IMG/M
3300028786\|Ga0307517_10022199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7965	Open in IMG/M
3300028786\|Ga0307517_10033296	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5925	Open in IMG/M
3300028786\|Ga0307517_10046778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	4502	Open in IMG/M
3300028786\|Ga0307517_10064604	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3399	Open in IMG/M
3300028786\|Ga0307517_10070370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3152	Open in IMG/M
3300028786\|Ga0307517_10071097	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3124	Open in IMG/M
3300028786\|Ga0307517_10283119	Not Available	943	Open in IMG/M
3300028786\|Ga0307517_10308149	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	883	Open in IMG/M
3300028786\|Ga0307517_10321653	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	855	Open in IMG/M
3300028786\|Ga0307517_10515073	Not Available	605	Open in IMG/M
3300028786\|Ga0307517_10607740	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	537	Open in IMG/M
3300028786\|Ga0307517_10671804	Not Available	501	Open in IMG/M
3300028794\|Ga0307515_10042135	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea → Olea europaea var. sylvestris	7152	Open in IMG/M
3300028794\|Ga0307515_10056961	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5665	Open in IMG/M
3300028794\|Ga0307515_10068221	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	4889	Open in IMG/M
3300028794\|Ga0307515_10073079	Not Available	4616	Open in IMG/M
3300028794\|Ga0307515_10077178	Not Available	4403	Open in IMG/M
3300028794\|Ga0307515_10108873	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3260	Open in IMG/M
3300028794\|Ga0307515_10115194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3099	Open in IMG/M
3300028794\|Ga0307515_10127221	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2835	Open in IMG/M
3300028794\|Ga0307515_10142758	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2557	Open in IMG/M
3300028794\|Ga0307515_10151708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2418	Open in IMG/M
3300028794\|Ga0307515_10158837	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2317	Open in IMG/M
3300028794\|Ga0307515_10197097	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1902	Open in IMG/M
3300028794\|Ga0307515_10349619	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1125	Open in IMG/M
3300028794\|Ga0307515_10387090	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1028	Open in IMG/M
3300028794\|Ga0307515_10410245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	977	Open in IMG/M
3300028794\|Ga0307515_10480020	Not Available	855	Open in IMG/M
3300028794\|Ga0307515_10523222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	795	Open in IMG/M
3300028794\|Ga0307515_10548831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	765	Open in IMG/M
3300028794\|Ga0307515_10559315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci	753	Open in IMG/M
3300028794\|Ga0307515_10590715	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	720	Open in IMG/M
3300028794\|Ga0307515_10831168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	548	Open in IMG/M
3300028794\|Ga0307515_10833249	Not Available	547	Open in IMG/M
3300030521\|Ga0307511_10010277	Not Available	9306	Open in IMG/M
3300030521\|Ga0307511_10018117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6737	Open in IMG/M
3300030521\|Ga0307511_10036930	Not Available	4231	Open in IMG/M
3300030521\|Ga0307511_10043671	Not Available	3738	Open in IMG/M
3300030521\|Ga0307511_10059092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2953	Open in IMG/M
3300030521\|Ga0307511_10069006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2603	Open in IMG/M
3300030521\|Ga0307511_10074772	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2438	Open in IMG/M
3300030521\|Ga0307511_10074809	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2437	Open in IMG/M
3300030521\|Ga0307511_10116783	All Organisms → cellular organisms → Eukaryota	1670	Open in IMG/M
3300030521\|Ga0307511_10120042	Not Available	1630	Open in IMG/M
3300030521\|Ga0307511_10241728	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	879	Open in IMG/M
3300030521\|Ga0307511_10266332	Not Available	806	Open in IMG/M
3300030521\|Ga0307511_10447994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	511	Open in IMG/M
3300030522\|Ga0307512_10092345	Not Available	2100	Open in IMG/M
3300030522\|Ga0307512_10103576	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1913	Open in IMG/M
3300030522\|Ga0307512_10209350	Not Available	1039	Open in IMG/M
3300030522\|Ga0307512_10209578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1038	Open in IMG/M
3300030522\|Ga0307512_10319485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	707	Open in IMG/M
3300030522\|Ga0307512_10334362	Not Available	679	Open in IMG/M
3300030522\|Ga0307512_10447896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	522	Open in IMG/M
3300031456\|Ga0307513_10020670	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	7798	Open in IMG/M
3300031456\|Ga0307513_10021781	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7559	Open in IMG/M
3300031456\|Ga0307513_10040407	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	5158	Open in IMG/M
3300031456\|Ga0307513_10054071	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	4308	Open in IMG/M
3300031456\|Ga0307513_10123436	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2551	Open in IMG/M
3300031456\|Ga0307513_10161225	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2135	Open in IMG/M
3300031456\|Ga0307513_10168566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2070	Open in IMG/M
3300031456\|Ga0307513_10179242	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1984	Open in IMG/M
3300031456\|Ga0307513_10198727	Not Available	1848	Open in IMG/M
3300031456\|Ga0307513_10254029	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1552	Open in IMG/M
3300031456\|Ga0307513_10276156	Not Available	1460	Open in IMG/M
3300031456\|Ga0307513_10362246	Not Available	1194	Open in IMG/M
3300031456\|Ga0307513_10490241	Not Available	947	Open in IMG/M
3300031456\|Ga0307513_10567783	Not Available	845	Open in IMG/M
3300031456\|Ga0307513_10705568	Not Available	714	Open in IMG/M
3300031456\|Ga0307513_10779588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	661	Open in IMG/M
3300031456\|Ga0307513_10940766	Not Available	572	Open in IMG/M
3300031456\|Ga0307513_10995801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	547	Open in IMG/M
3300031507\|Ga0307509_10066271	Not Available	3789	Open in IMG/M
3300031507\|Ga0307509_10082455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3317	Open in IMG/M
3300031507\|Ga0307509_10083685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	3288	Open in IMG/M
3300031507\|Ga0307509_10100534	Not Available	2929	Open in IMG/M
3300031507\|Ga0307509_10191211	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1897	Open in IMG/M
3300031507\|Ga0307509_10329495	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1259	Open in IMG/M
3300031507\|Ga0307509_10387020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1109	Open in IMG/M
3300031507\|Ga0307509_10395998	Not Available	1089	Open in IMG/M
3300031507\|Ga0307509_10415031	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1048	Open in IMG/M
3300031507\|Ga0307509_10678622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	697	Open in IMG/M
3300031507\|Ga0307509_10739353	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	649	Open in IMG/M
3300031616\|Ga0307508_10100977	Not Available	2480	Open in IMG/M
3300031616\|Ga0307508_10123417	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2192	Open in IMG/M
3300031616\|Ga0307508_10134227	Not Available	2078	Open in IMG/M
3300031616\|Ga0307508_10191653	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1645	Open in IMG/M
3300031616\|Ga0307508_10395302	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	973	Open in IMG/M
3300031616\|Ga0307508_10786329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	567	Open in IMG/M
3300031616\|Ga0307508_10915686	Not Available	504	Open in IMG/M
3300031649\|Ga0307514_10053651	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3109	Open in IMG/M
3300031649\|Ga0307514_10067051	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2710	Open in IMG/M
3300031649\|Ga0307514_10081771	Not Available	2386	Open in IMG/M
3300031649\|Ga0307514_10084232	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2340	Open in IMG/M
3300031649\|Ga0307514_10108578	Not Available	1972	Open in IMG/M
3300031649\|Ga0307514_10129381	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1741	Open in IMG/M
3300031649\|Ga0307514_10213713	Not Available	1193	Open in IMG/M
3300031649\|Ga0307514_10229156	Not Available	1128	Open in IMG/M
3300031649\|Ga0307514_10276726	Not Available	965	Open in IMG/M
3300031649\|Ga0307514_10292526	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	920	Open in IMG/M
3300031649\|Ga0307514_10323819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	843	Open in IMG/M
3300031649\|Ga0307514_10481739	Not Available	597	Open in IMG/M
3300031649\|Ga0307514_10538986	Not Available	542	Open in IMG/M
3300031649\|Ga0307514_10584320	Not Available	506	Open in IMG/M
3300031649\|Ga0307514_10590144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	502	Open in IMG/M
3300031730\|Ga0307516_10088861	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2921	Open in IMG/M
3300031730\|Ga0307516_10128632	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2314	Open in IMG/M
3300031730\|Ga0307516_10158389	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea → Olea europaea var. sylvestris	2016	Open in IMG/M
3300031730\|Ga0307516_10251783	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	1460	Open in IMG/M
3300031730\|Ga0307516_10292342	Not Available	1307	Open in IMG/M
3300031730\|Ga0307516_10325352	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1207	Open in IMG/M
3300031730\|Ga0307516_10354472	Not Available	1132	Open in IMG/M
3300031730\|Ga0307516_10669503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	693	Open in IMG/M
3300031730\|Ga0307516_10733745	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	646	Open in IMG/M
3300031730\|Ga0307516_10872971	Not Available	564	Open in IMG/M
3300031838\|Ga0307518_10009352	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6988	Open in IMG/M
3300031838\|Ga0307518_10027359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4112	Open in IMG/M
3300031838\|Ga0307518_10087244	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2248	Open in IMG/M
3300031838\|Ga0307518_10120025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1861	Open in IMG/M
3300031838\|Ga0307518_10144738	Not Available	1652	Open in IMG/M
3300031838\|Ga0307518_10185471	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1400	Open in IMG/M
3300031838\|Ga0307518_10191923	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1367	Open in IMG/M
3300031838\|Ga0307518_10223491	Not Available	1226	Open in IMG/M
3300031838\|Ga0307518_10456644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	680	Open in IMG/M
3300031838\|Ga0307518_10490519	Not Available	637	Open in IMG/M
3300031838\|Ga0307518_10586053	Not Available	538	Open in IMG/M
3300032354\|Ga0325403_1003805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13863	Open in IMG/M
3300032354\|Ga0325403_1015954	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6983	Open in IMG/M
3300032354\|Ga0325403_1020570	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	5962	Open in IMG/M
3300032354\|Ga0325403_1021073	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5869	Open in IMG/M
3300032354\|Ga0325403_1026834	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4963	Open in IMG/M
3300032354\|Ga0325403_1030207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4555	Open in IMG/M
3300032354\|Ga0325403_1041803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3477	Open in IMG/M
3300032354\|Ga0325403_1051785	Not Available	2821	Open in IMG/M
3300032354\|Ga0325403_1056685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	2564	Open in IMG/M
3300032354\|Ga0325403_1071640	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	1932	Open in IMG/M
3300032354\|Ga0325403_1077767	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1731	Open in IMG/M
3300032354\|Ga0325403_1095066	All Organisms → Viruses → Predicted Viral	1284	Open in IMG/M
3300032354\|Ga0325403_1100691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	1172	Open in IMG/M
3300032354\|Ga0325403_1114465	Not Available	957	Open in IMG/M
3300032354\|Ga0325403_1116283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	934	Open in IMG/M
3300032354\|Ga0325403_1122706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	863	Open in IMG/M
3300032354\|Ga0325403_1127354	Not Available	818	Open in IMG/M
3300032355\|Ga0325401_1019111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	6423	Open in IMG/M
3300032355\|Ga0325401_1025774	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	5317	Open in IMG/M
3300032355\|Ga0325401_1060141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2713	Open in IMG/M
3300032355\|Ga0325401_1123101	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1206	Open in IMG/M
3300032355\|Ga0325401_1220796	Not Available	585	Open in IMG/M
3300032374\|Ga0325400_1071574	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	2572	Open in IMG/M
3300032374\|Ga0325400_1130550	Not Available	1433	Open in IMG/M
3300032374\|Ga0325400_1146740	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1262	Open in IMG/M
3300032389\|Ga0325405_1002857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	17814	Open in IMG/M
3300032389\|Ga0325405_1039953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	3232	Open in IMG/M
3300032389\|Ga0325405_1109243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	737	Open in IMG/M
3300032390\|Ga0325404_1039961	Not Available	3194	Open in IMG/M
3300032735\|Ga0325410_1015095	All Organisms → cellular organisms → Bacteria	7707	Open in IMG/M
3300032740\|Ga0325411_1002230	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	21819	Open in IMG/M
3300032740\|Ga0325411_1007901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11571	Open in IMG/M
3300033159\|Ga0326758_122773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	523	Open in IMG/M
3300033160\|Ga0325402_1001101	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	21330	Open in IMG/M
3300033160\|Ga0325402_1019862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	6048	Open in IMG/M
3300033160\|Ga0325402_1060230	Not Available	2356	Open in IMG/M
3300033160\|Ga0325402_1071641	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1900	Open in IMG/M
3300033179\|Ga0307507_10090212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	2631	Open in IMG/M
3300033179\|Ga0307507_10112135	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2222	Open in IMG/M
3300033179\|Ga0307507_10164003	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	1633	Open in IMG/M
3300033179\|Ga0307507_10185423	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1476	Open in IMG/M
3300033179\|Ga0307507_10299214	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	988	Open in IMG/M
3300033179\|Ga0307507_10331923	Not Available	907	Open in IMG/M
3300033179\|Ga0307507_10382076	Not Available	810	Open in IMG/M
3300033179\|Ga0307507_10474614	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	682	Open in IMG/M
3300033179\|Ga0307507_10497192	Not Available	658	Open in IMG/M
3300033180\|Ga0307510_10004521	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16371	Open in IMG/M
3300033180\|Ga0307510_10004689	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	16139	Open in IMG/M
3300033180\|Ga0307510_10051165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4372	Open in IMG/M
3300033180\|Ga0307510_10106095	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	2574	Open in IMG/M
3300033180\|Ga0307510_10113344	Not Available	2445	Open in IMG/M
3300033180\|Ga0307510_10187038	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1625	Open in IMG/M
3300033180\|Ga0307510_10250238	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1260	Open in IMG/M
3300033180\|Ga0307510_10647007	Not Available	514	Open in IMG/M
3300034389\|Ga0325419_007792	Not Available	11558	Open in IMG/M
3300034389\|Ga0325419_015637	Not Available	7345	Open in IMG/M
3300034389\|Ga0325419_057187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2019	Open in IMG/M
3300034688\|Ga0325420_004154	Not Available	13738	Open in IMG/M
3300034688\|Ga0325420_037657	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3386	Open in IMG/M
3300034817\|Ga0373948_0002055	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	2913	Open in IMG/M
3300034818\|Ga0373950_0005710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Camellia → Camellia sinensis	1866	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.00%
Environmental	Environmental	3.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	97.00%
Terrestrial	Environmental → Terrestrial	2.00%
Aquatic	Environmental → Aquatic	1.00%

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	74.00%
Wood	Host-Associated → Plants → Wood	18.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.50%
Phylloplane	Host-Associated → Plants → Phylloplane	2.50%
Soil	Environmental → Terrestrial → Soil	2.00%
Freshwater	Environmental → Aquatic → Freshwater	0.50%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.50%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	74.00%
Unclassified	Host-Associated → Plants → Wood → Unclassified	18.00%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	2.50%
Loam	Environmental → Terrestrial → Soil → Loam	1.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.50%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.00%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.50%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	0.50%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.50%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F025672

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002120	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2	Environmental	Open in IMG/M
3300002243	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300019871	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1	Environmental	Open in IMG/M
3300025119	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes)	Environmental	Open in IMG/M
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated	Open in IMG/M
3300032740	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4	Host-Associated	Open in IMG/M
3300033159	Hot spring sediment microbial communities from Geyser Creek Basin, Yellowstone National Park, WY, United States - GCR.JH_S	Environmental	Open in IMG/M
3300033160	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M
3300034688	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1	Host-Associated	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M
3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Host-Associated	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
C687J26616_100893631	3300002120	Soil	VRFRFWRKIFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG*
C687J29039_102288592	3300002243	Soil	LFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG*
Ga0069718_152430801	3300004481	Sediment	SFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAIG*
Ga0075425_1001341121	3300006854	Populus Rhizosphere	DYLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG*
Ga0075434_1002742752	3300006871	Populus Rhizosphere	FFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG*
Ga0075424_1001084212	3300006904	Populus Rhizosphere	FFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG*
Ga0193702_10238181	3300019871	Soil	FFGKLTYVLKENDTKNIMGIPKIYNVNRNENQQMATG
Ga0209126_10327202	3300025119	Soil	FVSSSFFFGKLKYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307517_1000503414	3300028786	Ectomycorrhiza	MTLFLGKLTNVLKEEDTKIIRGIPQIYNVNRNVKQQMATS
Ga0307517_1001252313	3300028786	Ectomycorrhiza	MENWNKSTFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATG
Ga0307517_100221991	3300028786	Ectomycorrhiza	MKYGGLLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQHMATG
Ga0307517_100332961	3300028786	Ectomycorrhiza	MKAVCFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307517_100467787	3300028786	Ectomycorrhiza	MGYFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307517_100646042	3300028786	Ectomycorrhiza	MQNHTFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307517_100703705	3300028786	Ectomycorrhiza	VLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQM
Ga0307517_100710971	3300028786	Ectomycorrhiza	LFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAIG
Ga0307517_102831191	3300028786	Ectomycorrhiza	MLDYFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307517_103081491	3300028786	Ectomycorrhiza	LGKLTYVLKEEDTKIIRGIPQIYNENRNIKQQMAT
Ga0307517_103216531	3300028786	Ectomycorrhiza	MQILLQVILFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQ
Ga0307517_104840191	3300028786	Ectomycorrhiza	MEGRLSHKHFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307517_105150731	3300028786	Ectomycorrhiza	VKLPAPNQFDAQFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307517_106077402	3300028786	Ectomycorrhiza	VDSFFFGKLTYVLKEEDTNIIRGISQIYNDNRNIK
Ga0307517_106718041	3300028786	Ectomycorrhiza	MICLLKEFVFFFGKLTYVLKEEDTNIIRGISQIYNDNRNIKQ
Ga0307515_100421351	3300028794	Ectomycorrhiza	MVFLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRKIKQQM
Ga0307515_100569618	3300028794	Ectomycorrhiza	GKLTYVLKEEDTKIIRGIPQIYNENRNIKQQMATG
Ga0307515_100682211	3300028794	Ectomycorrhiza	MDLSILFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIK
Ga0307515_100730791	3300028794	Ectomycorrhiza	MNSTHFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307515_100771783	3300028794	Ectomycorrhiza	VDQPRNFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307515_101088734	3300028794	Ectomycorrhiza	VPYLCTIIMKLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQM
Ga0307515_101151943	3300028794	Ectomycorrhiza	VSWLVFFFGKLMYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307515_101272212	3300028794	Ectomycorrhiza	MEVLFVGKLTYVLKEEDTKIIRGIPQIYNENRNIKQQMATG
Ga0307515_101427581	3300028794	Ectomycorrhiza	MKAVCFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNI
Ga0307515_101517086	3300028794	Ectomycorrhiza	VFLDQFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307515_101588373	3300028794	Ectomycorrhiza	FGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATC
Ga0307515_101970973	3300028794	Ectomycorrhiza	KSFFLGKLTYVLKEEDTKIIRGIPQIYNENKNIKQQMATS
Ga0307515_103099431	3300028794	Ectomycorrhiza	MEGRLSHKHFFFGKLTYVLKEEDTNIIRGIPQIYNDNRN
Ga0307515_103496193	3300028794	Ectomycorrhiza	MFFLGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307515_103870901	3300028794	Ectomycorrhiza	FDKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307515_104102452	3300028794	Ectomycorrhiza	LVWNDEISFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307515_104800201	3300028794	Ectomycorrhiza	VKLPAPNQFDAQFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAIG
Ga0307515_105232221	3300028794	Ectomycorrhiza	GKLTYVLKEEDTNIIRGIPQICNDNRNIKQQMATG
Ga0307515_105488312	3300028794	Ectomycorrhiza	FGKLTYVLKEEDTNIIRAIPQIYNDNRNIKQQMATG
Ga0307515_105593151	3300028794	Ectomycorrhiza	VIFFEDFGSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307515_105907152	3300028794	Ectomycorrhiza	LEWEKKADWIFYFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307515_108311681	3300028794	Ectomycorrhiza	MEGRLSLFFFGKLMYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307515_108332491	3300028794	Ectomycorrhiza	MVNVHLFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRKIKQQMATG
Ga0307511_1001027711	3300030521	Ectomycorrhiza	MLLRIQGFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQ
Ga0307511_1001811710	3300030521	Ectomycorrhiza	MVYFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQM
Ga0307511_100369303	3300030521	Ectomycorrhiza	MFFFCKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307511_100436717	3300030521	Ectomycorrhiza	MVKVDMLVCMSFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQ
Ga0307511_100590921	3300030521	Ectomycorrhiza	MNXIXLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMA
Ga0307511_100690064	3300030521	Ectomycorrhiza	QATPVTNLKEYTFFLGKLTYVLKEEDTNIIRGIPQIYNENRNIKQQMATG
Ga0307511_100747723	3300030521	Ectomycorrhiza	FGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307511_100748091	3300030521	Ectomycorrhiza	LTIETHFSKHSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMA
Ga0307511_101167834	3300030521	Ectomycorrhiza	MGYNIVFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIK
Ga0307511_101200423	3300030521	Ectomycorrhiza	LVYVVSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMA
Ga0307511_102417281	3300030521	Ectomycorrhiza	MVNNFFFGKLTCVLKEEDTNIIRGIPQIYNDNRNIKQQ
Ga0307511_102663321	3300030521	Ectomycorrhiza	VDFFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307511_104479941	3300030521	Ectomycorrhiza	VWLCPHFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307512_100923451	3300030522	Ectomycorrhiza	LFPSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307512_101035761	3300030522	Ectomycorrhiza	LLVFFGKLTYVLKEEDTKIIRGIPQIYNENRNIKQQMATG
Ga0307512_102093501	3300030522	Ectomycorrhiza	MLRSGKELFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307512_102095781	3300030522	Ectomycorrhiza	VFLDQFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQ
Ga0307512_103194853	3300030522	Ectomycorrhiza	SKSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307512_103343621	3300030522	Ectomycorrhiza	MQLIIFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATG
Ga0307512_104478961	3300030522	Ectomycorrhiza	NKSTFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATG
Ga0307513_1002067011	3300031456	Ectomycorrhiza	FFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAIG
Ga0307513_100217811	3300031456	Ectomycorrhiza	MSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQ
Ga0307513_100316761	3300031456	Ectomycorrhiza	MRPTFFWVGLFFLGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307513_100404076	3300031456	Ectomycorrhiza	MLAMMFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307513_100540714	3300031456	Ectomycorrhiza	MLFPSFFFGKLTYVLKEEDTKIIRGIPQIYNENRNIKQQMATC
Ga0307513_101234361	3300031456	Ectomycorrhiza	MENWNKSTFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMA
Ga0307513_101612251	3300031456	Ectomycorrhiza	MQNHTFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQM
Ga0307513_101685661	3300031456	Ectomycorrhiza	MVEAHFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307513_101792421	3300031456	Ectomycorrhiza	MKAVCFFFGKLTYVLKEEDTNIIRGIPQIYNDNRN
Ga0307513_101987271	3300031456	Ectomycorrhiza	MDLSILFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307513_102540291	3300031456	Ectomycorrhiza	MDFLFGNNFFFGKLTYVLKKEDTNIIRGIPQIYNDNRNIKQQMA
Ga0307513_102761561	3300031456	Ectomycorrhiza	GKLTYVLKEEETKSIRGIPHIYNVNRNIKQQMAIS
Ga0307513_103622461	3300031456	Ectomycorrhiza	MLESDIFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIEQ
Ga0307513_104902413	3300031456	Ectomycorrhiza	MCAIYYLFSFFFGKLTYVLKEEDTKIIRGIPQIYNENRNIK
Ga0307513_105677831	3300031456	Ectomycorrhiza	CFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307513_107055681	3300031456	Ectomycorrhiza	MGYFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMA
Ga0307513_107795881	3300031456	Ectomycorrhiza	MPFIFYGKLTNVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307513_109407661	3300031456	Ectomycorrhiza	MGGVDFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQ
Ga0307513_109958011	3300031456	Ectomycorrhiza	FFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATC
Ga0307509_100662711	3300031507	Ectomycorrhiza	MQIMGCSFFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIK
Ga0307509_100824551	3300031507	Ectomycorrhiza	MQISEGIDVFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307509_100836854	3300031507	Ectomycorrhiza	MPSQTFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307509_101005344	3300031507	Ectomycorrhiza	MWQLVFEIFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQHMA
Ga0307509_101912111	3300031507	Ectomycorrhiza	TYIMMFFFSGKLTHVLKEEDTKIIKGIPQIYIENRNIKQQMVTG
Ga0307509_103294951	3300031507	Ectomycorrhiza	MELAFLSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307509_103870201	3300031507	Ectomycorrhiza	VLLVFFGKLTYVLKEEDTKIIRGIPQIYNENRNIKQQMATG
Ga0307509_103959981	3300031507	Ectomycorrhiza	FGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATG
Ga0307509_104150314	3300031507	Ectomycorrhiza	MVNNFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307509_106786222	3300031507	Ectomycorrhiza	MFFFFGKLRYVLKEEDTNIIRGIPQIYNDNKNIKQQMATG
Ga0307509_107393531	3300031507	Ectomycorrhiza	MPRKIHISFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307508_101009771	3300031616	Ectomycorrhiza	MCDVFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATG
Ga0307508_101234171	3300031616	Ectomycorrhiza	MQNHTFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIK
Ga0307508_101342271	3300031616	Ectomycorrhiza	MQLIIFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATGK
Ga0307508_101916534	3300031616	Ectomycorrhiza	MFFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKKQMATG
Ga0307508_103953021	3300031616	Ectomycorrhiza	MVFLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQM
Ga0307508_107863292	3300031616	Ectomycorrhiza	MTPFFLGKLTYVLKEEDTKIIRGIPQIYNENGNIKQQMATAID
Ga0307508_109156861	3300031616	Ectomycorrhiza	LFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307514_100536511	3300031649	Ectomycorrhiza	VLVLRYKLSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNI
Ga0307514_100670516	3300031649	Ectomycorrhiza	VVWKKICFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307514_100817712	3300031649	Ectomycorrhiza	LFPSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307514_100842324	3300031649	Ectomycorrhiza	MRVNFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307514_101085781	3300031649	Ectomycorrhiza	MCDVFVFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307514_101293814	3300031649	Ectomycorrhiza	MQISEGIDVFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307514_102137131	3300031649	Ectomycorrhiza	MNFVIYFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQ
Ga0307514_102291561	3300031649	Ectomycorrhiza	MSLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQM
Ga0307514_102767262	3300031649	Ectomycorrhiza	MENWNKSTFFFGKLTYVLKEEDTNIIRGIPQIYNDN
Ga0307514_102925261	3300031649	Ectomycorrhiza	VSWLVFFFGKLMYVLKEEDTNIIRGIPQIYNDNRNIKQQ
Ga0307514_103238192	3300031649	Ectomycorrhiza	LQTLFFFGKLTYVLKEEDTNIIRGIPHIYNDNRNIKQQMATG
Ga0307514_104817391	3300031649	Ectomycorrhiza	MKAVCFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQ
Ga0307514_105389861	3300031649	Ectomycorrhiza	FFFYKLMYVLKEKDTNIIRGIPQIYNDNRNIKQHMATS
Ga0307514_105843201	3300031649	Ectomycorrhiza	MIFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMA
Ga0307514_105901441	3300031649	Ectomycorrhiza	VDSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307516_100888616	3300031730	Ectomycorrhiza	VFLDQFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIK
Ga0307516_101286321	3300031730	Ectomycorrhiza	PIFFFGKLTYVLKEDTKIIKGIPQIYNENKNIKQQMATG
Ga0307516_101583891	3300031730	Ectomycorrhiza	MVFLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307516_102517831	3300031730	Ectomycorrhiza	MKLFDSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307516_102923421	3300031730	Ectomycorrhiza	LFSFFFFLGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMA
Ga0307516_103253521	3300031730	Ectomycorrhiza	MVIFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKEQMATG
Ga0307516_103544721	3300031730	Ectomycorrhiza	MKAVCFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATG
Ga0307516_106695031	3300031730	Ectomycorrhiza	MCAIYYLFSFFFGKLTYVLKEEDTKIIRGIPQIYNENRNIKQ
Ga0307516_107337451	3300031730	Ectomycorrhiza	VDSFFFGKLTYVLKEEDTNIIRGISQIYNDNRNIKQQ
Ga0307516_108729711	3300031730	Ectomycorrhiza	MPLFYFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307518_100093521	3300031838	Ectomycorrhiza	MHFFFGKLTYVLKEKDTNIIRGIPQIYNDNRNIKQQMAT
Ga0307518_100273597	3300031838	Ectomycorrhiza	MNSTHFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIK
Ga0307518_100872446	3300031838	Ectomycorrhiza	SKTFFFGKLTYVLKEEDTKIIRSIPHIYNENRNIKQ
Ga0307518_101200254	3300031838	Ectomycorrhiza	FGKLTYVLKEEDTKIIRGIPQIYNENRSIKQQMATG
Ga0307518_101447381	3300031838	Ectomycorrhiza	MEGRLSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307518_101854712	3300031838	Ectomycorrhiza	SLRNSFFFGNLTYVLKEEDTKIIRGIPQIYNENRNIKQQMATG
Ga0307518_101919231	3300031838	Ectomycorrhiza	MPFLVLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQM
Ga0307518_102234911	3300031838	Ectomycorrhiza	VFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQRMATC
Ga0307518_104566441	3300031838	Ectomycorrhiza	FFGKLTYVLKEEDTNIIRGIPQIYNDNINIKEQMATG
Ga0307518_104905191	3300031838	Ectomycorrhiza	CGFTFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATG
Ga0307518_105860531	3300031838	Ectomycorrhiza	MMPTYNFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQM
Ga0325403_10038051	3300032354	Xylem	MEGHFLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_10159541	3300032354	Xylem	VPRHKLSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_10205701	3300032354	Xylem	MAEVKPKKQTFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_10210731	3300032354	Xylem	MASSLYFSFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQ
Ga0325403_10268341	3300032354	Xylem	MASMFFFFGKLTYVLKEEDTNIIRGIPQIYNDNKNIKQQMATG
Ga0325403_10302079	3300032354	Xylem	MIYHQWLIINYFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_10418034	3300032354	Xylem	MHFFFCKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_10517855	3300032354	Xylem	GKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_10566852	3300032354	Xylem	MREHGFFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNKKQQMAT
Ga0325403_10716401	3300032354	Xylem	MDFCFGKLTYVLKEEDTNIIRGIPQIYNDNKNIKQQMATG
Ga0325403_10777673	3300032354	Xylem	MIASSISFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_10950663	3300032354	Xylem	MNSVLISFFFGKLTSVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_11006912	3300032354	Xylem	MDFFFGKLMYVLKEEDTNIIRGIPQIYNDNRNIKQQMATS
Ga0325403_11144652	3300032354	Xylem	MLQKYFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_11162831	3300032354	Xylem	MADHLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_11227061	3300032354	Xylem	FFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325403_11273541	3300032354	Xylem	MVMPFGLSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325401_10191112	3300032355	Xylem	LGKLTYEIKEDTKIIRGIPQIYNGIRNVKQQMATG
Ga0325401_10257742	3300032355	Xylem	MVTNLILAYFFFGKLTYVLKEEDTNIIRGIPQIYNDNINIKQQMATG
Ga0325401_10601412	3300032355	Xylem	MTNYYLIQQSFFFFKLTYVLKEEETKIIRGIPQIYNENRNIKQQMATG
Ga0325401_11231011	3300032355	Xylem	MLSSYYTYSNTISETFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQHMATG
Ga0325401_12207961	3300032355	Xylem	FFCHNTFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMAIG
Ga0325400_10715741	3300032374	Xylem	MREHGFFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325400_11305501	3300032374	Xylem	MIIYFKFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325400_11467403	3300032374	Xylem	NKIWPTFFFGKLTYVLKEEDTKIIRGIPQIYNENRNIKQHMATG
Ga0325405_10028571	3300032389	Xylem	MRESLCYTFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325405_10399538	3300032389	Xylem	MTFFLGKLTNVLKEKDAKIIRGIPQIYNVNINVKQQMATS
Ga0325405_11092432	3300032389	Xylem	FFFGKLTYVLKEEDTNIIRGIPQIYNDNKNIKQQMATG
Ga0325404_10399613	3300032390	Xylem	MVTNLILAYFFFGKLTYVLKEENTNIIRGIPQIYNDNINIKQQMATG
Ga0325410_10150958	3300032735	Xylem	MHLTSILLFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325411_100223028	3300032740	Xylem	MNPFFFGKLTYVLKEENTKIIRGIPQIYSENRNIKQQMATS
Ga0325411_100790111	3300032740	Xylem	MYSIFGKLTYVLKEKDTEIIRGISQIYNENKNIKQQIATG
Ga0326758_1227731	3300033159	Hot Spring Sediment	FFGKLTYVLKEEDTDIIRGIPQIYNDNRNIKQQMATG
Ga0325402_10011012	3300033160	Xylem	MTFFFLGKLTNVLKEKDAKIIRGIPQIYNVNINVKQQMATS
Ga0325402_10198621	3300033160	Xylem	MPFGLSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325402_10602305	3300033160	Xylem	MKLFSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325402_10716412	3300033160	Xylem	MFSVGRRRRIMSTYSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307507_100902121	3300033179	Ectomycorrhiza	MLFFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNI
Ga0307507_101121354	3300033179	Ectomycorrhiza	MHFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307507_101640031	3300033179	Ectomycorrhiza	MMPTYNFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQ
Ga0307507_101854234	3300033179	Ectomycorrhiza	MFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQ
Ga0307507_102992141	3300033179	Ectomycorrhiza	VASVFFGKLMYVLKEEDTNIIRGIPQIYNDNRNIKQ
Ga0307507_103319231	3300033179	Ectomycorrhiza	MSLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307507_103820761	3300033179	Ectomycorrhiza	MVLIIAKKQFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIK
Ga0307507_104746141	3300033179	Ectomycorrhiza	MLFISFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNI
Ga0307507_104971921	3300033179	Ectomycorrhiza	MDFNVFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307510_100045211	3300033180	Ectomycorrhiza	VSWLVFFFGKLMYVLKEEDTNIIRGIPQIYNDNRNI
Ga0307510_100046891	3300033180	Ectomycorrhiza	MKYGGLLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQHMA
Ga0307510_100511651	3300033180	Ectomycorrhiza	VRYSPLVLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNI
Ga0307510_101060951	3300033180	Ectomycorrhiza	YFFFGKLTYVLKEEETKSIRGIPHIYNVNRNIKQQMAIS
Ga0307510_101133441	3300033180	Ectomycorrhiza	MFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307510_101870381	3300033180	Ectomycorrhiza	VLVLRYKLSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIK
Ga0307510_102502381	3300033180	Ectomycorrhiza	HIWDICLFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0307510_106470071	3300033180	Ectomycorrhiza	MSGYAFIFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMA
Ga0325419_007792_3264_3386	3300034389	Leaf	MYSIFGKLTYVLKEKDTEIIRGISQIYNENRNIKQQIATG
Ga0325419_015637_7209_7343	3300034389	Leaf	MPRHKLSFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325419_057187_1857_1988	3300034389	Leaf	MPFISFFFGKLTYVLKEEDTSNIRGIPQIYNDNRNIKQQMATG
Ga0325420_004154_13603_13731	3300034688	Leaf	MLLFIFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0325420_037657_3271_3384	3300034688	Leaf	FFGKLTYVLKEEDTSNIRGIPQIYNDNRNIKQQMATG
Ga0373948_0002055_27_158	3300034817	Rhizosphere Soil	MALILFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG
Ga0373950_0005710_1_138	3300034818	Rhizosphere Soil	HPNKSSFFFFGKLTYVLKEEDTNIIRGIPQIYNDNRNIKQQMATG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign