NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025761

Metagenome / Metatranscriptome Family F025761

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025761
Family Type Metagenome / Metatranscriptome
Number of Sequences 200
Average Sequence Length 155 residues
Representative Sequence MKIHAIAALVLGASALKLEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKEDD
Number of Associated Samples 135
Number of Associated Scaffolds 200

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.51 %
% of genes near scaffold ends (potentially truncated) 79.00 %
% of genes from short scaffolds (< 2000 bps) 99.50 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.500 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(38.500 % of family members)
Environment Ontology (ENVO) Unclassified
(63.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(82.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 71.90%    β-sheet: 0.00%    Coil/Unstructured: 28.10%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.50 %
UnclassifiedrootN/A0.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001974|GOS2246_10081625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1539Open in IMG/M
3300004097|Ga0055584_101552177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300005516|Ga0066831_10028354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1519Open in IMG/M
3300005599|Ga0066841_10022450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum995Open in IMG/M
3300006356|Ga0075487_1049018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300006374|Ga0075512_1272782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum897Open in IMG/M
3300006379|Ga0075513_1385568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum916Open in IMG/M
3300006393|Ga0075517_1478947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum929Open in IMG/M
3300006402|Ga0075511_1561285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300009422|Ga0114998_10080598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1630Open in IMG/M
3300009550|Ga0115013_10406726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum869Open in IMG/M
3300009593|Ga0115011_10970764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300009599|Ga0115103_1062972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum928Open in IMG/M
3300009606|Ga0115102_10629592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum930Open in IMG/M
3300009606|Ga0115102_10707793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum958Open in IMG/M
3300009608|Ga0115100_11023613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum929Open in IMG/M
3300009677|Ga0115104_10803993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1024Open in IMG/M
3300009677|Ga0115104_11229788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300009677|Ga0115104_11282314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum827Open in IMG/M
3300009679|Ga0115105_10014887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum920Open in IMG/M
3300009679|Ga0115105_11303236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300009679|Ga0115105_11434344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300010981|Ga0138316_10578987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300010981|Ga0138316_10809870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300010981|Ga0138316_10905961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum913Open in IMG/M
3300010981|Ga0138316_11134147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum828Open in IMG/M
3300010981|Ga0138316_11674438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300010985|Ga0138326_11252289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300010985|Ga0138326_11389549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300010987|Ga0138324_10228083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300010987|Ga0138324_10232582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum863Open in IMG/M
3300010987|Ga0138324_10375509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300010987|Ga0138324_10694011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300012524|Ga0129331_1332084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300012920|Ga0160423_10510503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300012952|Ga0163180_11863602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300012953|Ga0163179_10180334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1602Open in IMG/M
3300012953|Ga0163179_11661527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300012953|Ga0163179_12033707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300012969|Ga0129332_1278247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300013110|Ga0171652_1094246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300018622|Ga0188862_1007595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani927Open in IMG/M
3300018628|Ga0193355_1005840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1021Open in IMG/M
3300018628|Ga0193355_1007711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum923Open in IMG/M
3300018725|Ga0193517_1030684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1037Open in IMG/M
3300018726|Ga0194246_1024333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum952Open in IMG/M
3300018742|Ga0193138_1022179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum823Open in IMG/M
3300018765|Ga0193031_1029902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300018765|Ga0193031_1030986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum842Open in IMG/M
3300018765|Ga0193031_1040216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300018765|Ga0193031_1087724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300018779|Ga0193149_1019668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum932Open in IMG/M
3300018779|Ga0193149_1019753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum930Open in IMG/M
3300018779|Ga0193149_1059090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300018796|Ga0193117_1032481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum885Open in IMG/M
3300018871|Ga0192978_1028789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1034Open in IMG/M
3300018873|Ga0193553_1077006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum889Open in IMG/M
3300018928|Ga0193260_10043615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum962Open in IMG/M
3300018975|Ga0193006_10213557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018977|Ga0193353_10085477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum951Open in IMG/M
3300018980|Ga0192961_10076127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1000Open in IMG/M
3300018982|Ga0192947_10090445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1007Open in IMG/M
3300018982|Ga0192947_10093071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani993Open in IMG/M
3300018989|Ga0193030_10063268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1041Open in IMG/M
3300018989|Ga0193030_10065441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1030Open in IMG/M
3300018989|Ga0193030_10073073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum994Open in IMG/M
3300018989|Ga0193030_10073283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum993Open in IMG/M
3300018989|Ga0193030_10076160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum980Open in IMG/M
3300018989|Ga0193030_10077130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum976Open in IMG/M
3300018989|Ga0193030_10092939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum914Open in IMG/M
3300018989|Ga0193030_10096221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum902Open in IMG/M
3300018989|Ga0193030_10105066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum873Open in IMG/M
3300018989|Ga0193030_10147117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300019001|Ga0193034_10142912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300019021|Ga0192982_10107241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum939Open in IMG/M
3300019024|Ga0193535_10112406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum887Open in IMG/M
3300019031|Ga0193516_10095429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1012Open in IMG/M
3300019032|Ga0192869_10123169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1036Open in IMG/M
3300019032|Ga0192869_10123620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1035Open in IMG/M
3300019032|Ga0192869_10331520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300019033|Ga0193037_10107163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum863Open in IMG/M
3300019048|Ga0192981_10098741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1139Open in IMG/M
3300019049|Ga0193082_10270561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani865Open in IMG/M
3300019051|Ga0192826_10157825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani836Open in IMG/M
3300019099|Ga0193102_1011620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum785Open in IMG/M
3300019117|Ga0193054_1021137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani937Open in IMG/M
3300019118|Ga0193157_1024948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300019118|Ga0193157_1029540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300019118|Ga0193157_1037435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300019123|Ga0192980_1033162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum988Open in IMG/M
3300019125|Ga0193104_1017066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum943Open in IMG/M
3300019133|Ga0193089_1045277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1073Open in IMG/M
3300019149|Ga0188870_10054549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum971Open in IMG/M
3300019149|Ga0188870_10120278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300021345|Ga0206688_10379913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum948Open in IMG/M
3300021345|Ga0206688_10789987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum756Open in IMG/M
3300021348|Ga0206695_1450352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum904Open in IMG/M
3300021348|Ga0206695_1594602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300021348|Ga0206695_1621980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum930Open in IMG/M
3300021350|Ga0206692_1207501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300021350|Ga0206692_1268115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum943Open in IMG/M
3300021353|Ga0206693_1109971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum922Open in IMG/M
3300021355|Ga0206690_10534334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum920Open in IMG/M
3300021355|Ga0206690_10864232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300021355|Ga0206690_10992843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300021359|Ga0206689_10603032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum932Open in IMG/M
3300021359|Ga0206689_10954861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum914Open in IMG/M
3300021359|Ga0206689_11069348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300021866|Ga0063109_101957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum910Open in IMG/M
3300021872|Ga0063132_101243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani942Open in IMG/M
3300021872|Ga0063132_102974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani835Open in IMG/M
3300021881|Ga0063117_1012009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300021883|Ga0063126_1008714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum789Open in IMG/M
3300021885|Ga0063125_1000845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani899Open in IMG/M
3300021885|Ga0063125_1005264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani874Open in IMG/M
3300021886|Ga0063114_1008627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300021893|Ga0063142_1055183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum835Open in IMG/M
3300021894|Ga0063099_1106294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300021904|Ga0063131_1037992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300021904|Ga0063131_1064148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum796Open in IMG/M
3300021911|Ga0063106_1065359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum803Open in IMG/M
3300021912|Ga0063133_1020914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani898Open in IMG/M
3300021912|Ga0063133_1039651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300021925|Ga0063096_1001413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani894Open in IMG/M
3300021927|Ga0063103_1015516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum909Open in IMG/M
3300021927|Ga0063103_1169934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300021928|Ga0063134_1020591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum918Open in IMG/M
3300021928|Ga0063134_1030158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani886Open in IMG/M
3300021934|Ga0063139_1162189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300021941|Ga0063102_1019031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum882Open in IMG/M
3300021941|Ga0063102_1019032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1441Open in IMG/M
3300021943|Ga0063094_1006069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani890Open in IMG/M
3300021950|Ga0063101_1024640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum892Open in IMG/M
3300021957|Ga0222717_10121938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1612Open in IMG/M
3300023566|Ga0228679_1023804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300023674|Ga0228697_109465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum919Open in IMG/M
3300023676|Ga0232114_110591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum898Open in IMG/M
3300023704|Ga0228684_1027993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum863Open in IMG/M
3300025138|Ga0209634_1098207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1301Open in IMG/M
3300026166|Ga0208276_1028892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300026182|Ga0208275_1015998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1616Open in IMG/M
3300026390|Ga0247558_109616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum897Open in IMG/M
3300026458|Ga0247578_1031487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum992Open in IMG/M
3300026461|Ga0247600_1040211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum907Open in IMG/M
3300026466|Ga0247598_1070705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum947Open in IMG/M
3300026470|Ga0247599_1068656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300026471|Ga0247602_1079423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum873Open in IMG/M
3300026500|Ga0247592_1061870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum912Open in IMG/M
3300026503|Ga0247605_1070019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum867Open in IMG/M
3300026513|Ga0247590_1064161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum949Open in IMG/M
3300028109|Ga0247582_1070133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum918Open in IMG/M
3300028110|Ga0247584_1071486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum877Open in IMG/M
3300028134|Ga0256411_1113060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum918Open in IMG/M
3300028134|Ga0256411_1120493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani881Open in IMG/M
3300028137|Ga0256412_1128063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum932Open in IMG/M
3300028233|Ga0256417_1079050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani889Open in IMG/M
3300028282|Ga0256413_1134926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum896Open in IMG/M
3300028334|Ga0247597_1018361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum897Open in IMG/M
3300028575|Ga0304731_10002036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300028575|Ga0304731_10320249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum913Open in IMG/M
3300028575|Ga0304731_10746527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300028575|Ga0304731_10878059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300028575|Ga0304731_11038156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum828Open in IMG/M
3300030671|Ga0307403_10280217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum885Open in IMG/M
3300030699|Ga0307398_10284441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum895Open in IMG/M
3300030702|Ga0307399_10359227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300030715|Ga0308127_1025899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani716Open in IMG/M
3300030727|Ga0308140_1064591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300030780|Ga0073988_10001856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum908Open in IMG/M
3300030780|Ga0073988_10017428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300030780|Ga0073988_12311376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum863Open in IMG/M
3300030781|Ga0073982_11749727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum883Open in IMG/M
3300030856|Ga0073990_12036250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum900Open in IMG/M
3300030912|Ga0073987_10002399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani909Open in IMG/M
3300031004|Ga0073984_11287232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300031032|Ga0073980_10001606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300031032|Ga0073980_11381219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300031062|Ga0073989_10019028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300031542|Ga0308149_1013978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1001Open in IMG/M
3300031658|Ga0307984_1067150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1088Open in IMG/M
3300031709|Ga0307385_10137754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum918Open in IMG/M
3300031710|Ga0307386_10203804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum956Open in IMG/M
3300031710|Ga0307386_10227160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum912Open in IMG/M
3300031710|Ga0307386_10316395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani788Open in IMG/M
3300031725|Ga0307381_10103391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum938Open in IMG/M
3300031725|Ga0307381_10111035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum910Open in IMG/M
3300031734|Ga0307397_10173958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum941Open in IMG/M
3300031738|Ga0307384_10132713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1052Open in IMG/M
3300031738|Ga0307384_10225919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani836Open in IMG/M
3300031738|Ga0307384_10433891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300031743|Ga0307382_10168006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum963Open in IMG/M
3300032518|Ga0314689_10241009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani942Open in IMG/M
3300032521|Ga0314680_10351186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani908Open in IMG/M
3300032540|Ga0314682_10265283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani933Open in IMG/M
3300032615|Ga0314674_10282510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani861Open in IMG/M
3300032711|Ga0314681_10359915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300032745|Ga0314704_10307061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani876Open in IMG/M
3300032751|Ga0314694_10126448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1042Open in IMG/M
3300033572|Ga0307390_10352641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum890Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine38.50%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine30.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.50%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater9.50%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.50%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.50%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.50%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.50%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.50%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.50%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.50%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005599Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91AEnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013110Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018726Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000618 (ERX1782150-ERR1711887)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021883Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S0 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021904Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300026166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91A (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026390Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030727Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_532_33.10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GOS2246_1008162523300001974MarineMKLYALVALVFGASAHKIEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKED*A*
Ga0055584_10155217723300004097Pelagic MarineMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDHQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED*
Ga0066831_1002835443300005516MarineMKFSTIALVFVGLISNTQEIKLEQPPCVYLDETQAELDYQVDRFSRTLDPRHWTNVVNLRNAMAKKSGSTPKLQVHTWELLDKAFSFPRVRRYQYVQENMDMLEHFQDNLNTNISNEVNMANFLRVAGTVKKNLSTKYHDGEFSDPAAYDCKKTTPKEC*
Ga0066841_1002245013300005599MarineMKFYALAMLCLGAEAVKIEQKAPPCIYLDETQGELDKQVDFFSKTLDPRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKE*
Ga0075487_104901813300006356AqueousFSKTMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDHQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED*
Ga0075512_127278213300006374AqueousAIAALVLGASALKIEQKAPPCVYLDETQAELDHQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED*
Ga0075513_138556813300006379AqueousSKTMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDHQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED*
Ga0075517_147894723300006393AqueousLPVETMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDHQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED*
Ga0075511_156128513300006402AqueousTMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDHQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED*
Ga0114998_1008059823300009422MarineMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNTLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNVNTNISNSVNMANFLKVANTVVKNLNTKYHNGEFADPAVDAYKE*
Ga0115013_1040672613300009550MarineMKFYALAALCLGANAVKLEQKAPPCIYLDETQAELDKQIDLFSKTLDTRHWTNVLNIAGALKKKSGVAPKLQIHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNVNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEDD*
Ga0115011_1097076413300009593MarineMKFYALAALCFSASAVKLEQKAPPCIYLDETQAELDKQIDLFSKTLDTRHWTNVLNISGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNVNTNISNSVNMANFLKVANTVKKNLNTKYHN
Ga0115103_106297213300009599MarineIYFQKTMKVYAIAALVFGASAMKVEQKAPPCVYLDETQAELDHQVDLFSKTLDVRHWTNTLNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVA*
Ga0115102_1062959213300009606MarineEIYFQKTMKVYAIAALVFGASAMKVEQKAPPCVYLDETQAELDHQVDLFSKTLDVRHWTNTLNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVA*
Ga0115102_1070779313300009606MarineMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDHQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAIDAYKED*
Ga0115100_1102361313300009608MarineYFQKTMKVYAIAALVFGASAMKVEQKAPPCVYLDETQAELDHQVDLFSKTLDVRHWTNTLNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVA*
Ga0115104_1080399313300009677MarineMKIHAIAALVLGATAVKVEQKAPPCIYLDETQAELDHQIDLFSKTLDVRHWTNTLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATDAYKKDDE*
Ga0115104_1122978823300009677MarineEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKED*
Ga0115104_1128231413300009677MarineMKFSLIALLVAAASGAEIKSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPPLKVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAAGAYDAPSDAPPRVWTGSEWGHM*
Ga0115105_1001488713300009679MarineEIMKFSAIIVFLLGATQATHVDQKAVKPPCVYLDETQAELDHQVDLFSKTLDPRHWTNTLNIAGAMKKKSGQSPKLQVHTWELLDKAFTFARIRRYQYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLATKYHNGEFVDPAIDAYKED*
Ga0115105_1130323613300009679MarineKLYALAALVLGASATKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKEKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEDD*
Ga0115105_1143434413300009679MarineMKFAKVALVFLGLMSVDAIQIKNAVEIEAEKPPCVYLDETQAELDYQVDRFSRTLDPRHWTNVVNLRNALSKKTGATPKLQVHTWELLDKAFSFPRVRRYQYVQENMDMLEHFQDNLNTNISNEVNMANFLRVASTVKKNLMTKYHDGEFTDPATYDCKAFDP
Ga0138316_1057898713300010981MarineVDAIQIKNAVELEAEKPPCVYLDETQAELDYQVDRFSRTLDPRHWTNVVNLRNALSKKTGSTPKLQVHAWELLDKAFSFPRVRRYQYVQENMDMLEHFQDNLNTNISNEVNMANFLRVASTVKKNLMTKYHDGEFTDPATYDCKAFDPPKC*
Ga0138316_1080987013300010981MarineFSSLLLVVGALSATSATEAPPCIYLDETQAELDKQIDLFSRTLDPRHWTNVLNIAEAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFKDPATDAYKDPDEECKGSACWI*
Ga0138316_1090596113300010981MarineKITMKFYSLIALLGATSAVKLEQKAPPCVYLDETTAELEKQVDLFSKTLDTRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAVDAYKDE*
Ga0138316_1113414723300010981MarineMKFSLIALLVAAASGAEIKSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPPLKVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAVGAYDAPSDAPPRVWTGSEWGHM*
Ga0138316_1167443813300010981MarineKNIIMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDHQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIKAYDPK*
Ga0138326_1125228913300010985MarineEAPPCIYLDETQAELDKQIDLFSRTLDPRHWTNVLNIAEAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFKDPATDAYKDPDEECKGSACWI*
Ga0138326_1138954913300010985MarineSVDAIQIKNAVELEAEKPPCVYLDETQAELDYQVDRFSRTLDPRHWTNVVNLRNALSKKTGSTPKLQVHAWELLDKAFSFPRVRRYQYVQENMDMLEHFQDNLNTNISNEVNMANFLRVASTVKKNLMTKYHDGEFTDPATYDCKAFDPPKC*
Ga0138324_1022808323300010987MarineMKFSLIALLVATASGAEIKSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPPLKVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAVGAYDAPSDAPPRVWTGSEWGHM*
Ga0138324_1023258213300010987MarineFIFRNMKFSLIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAVGAYDKADDKQKVWTGSGWA*
Ga0138324_1037550913300010987MarineIMRFSSLLLVVGALSATSATEAPPCIYLDETQAELDKQIDLFSRTLDPRHWTNVLNIAEAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFKDPATDAYKDPDEECKGSACWI*
Ga0138324_1069401113300010987MarineLLMLFKSKNAVELEGEKPPCVYLDETQAELDYQVDRFSRTLDPRHWTNVVNLRNALSKKTGSTPKLQVHAWELLDKAFSFPRVRRYQYVQENMDMLEHFQDNLNTNISNEVNMANFLRVASTVKKNLMTKYHDGEFTDPATYDCKAFDPPKC*
Ga0129331_133208413300012524AqueousFIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA*
Ga0160423_1051050313300012920Surface SeawaterLHNIEQMKIYAIAALFAGASATKLEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEDD*
Ga0163180_1186360213300012952SeawaterMKIYALVALVFGASAHKIEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLN
Ga0163179_1018033423300012953SeawaterMKFTSLIMLFAGATAMKVESEAPPCIYLDETQEELDKQVDLFSRTLDPRHWTNVLNIAGAMKKKSGTAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFADPAADAYKDPDAPKPNNGWS*
Ga0163179_1166152713300012953SeawaterMKFYALAALCLRANAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDTRHWTNVLNISGALKAKSGSAPKLQVHSWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPA
Ga0163179_1203370713300012953SeawaterAPPCIYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGAMKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKED*
Ga0129332_127824713300012969AqueousLKFIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA*
Ga0171652_109424613300013110MarineMKFFAMLVLTANAVKLEQKAPPCVYLDETQGELDKQVDLFSKTLDPRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED*
Ga0188862_100759513300018622Freshwater LakeLFSKTMKIHAIAALILGASALKIEQKAPPCVYLDETQAELDNQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKDD
Ga0193355_100584013300018628MarineHGEYNFIFEVYFKIINMKIAAIAALVLGTSAVKLEQKAPPCVYLDETQAELDNQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPHLTVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKKD
Ga0193355_100771113300018628MarineEQKAPPCIYLDETQGELDHQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEDXAGXXASFAGSQGFNNLALSLN
Ga0193517_103068423300018725MarineMKFFAMLVLAANAVKLEQKAPPCVYLDETQGELDKQIDLFSKTLDPRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0194246_102433323300018726MarineSTMKFYALVALVLGASAVTVEQKAPPCIYLDETQAELEKQVDLFSKTLDPRHWTNVLNIAGALKKKGGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0193138_102217913300018742MarineKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDNQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEEDE
Ga0193031_102990223300018765MarineCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPPLKVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAAGAYAAPDDTPPRVWTGSEWGHM
Ga0193031_103098613300018765MarineMGNIILYLKFIFKIFNMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDNQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIKAYDPK
Ga0193031_104021613300018765MarineLSATSATEAPPCIYLDETQAELNKQIDLFSRTLDPRHWTNVLNIADAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0193031_108772413300018765MarineVYLDETQAELDKQTDLFSKTLDTRHWTNVLNIAGAIKKKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEEDXAS
Ga0193149_101966813300018779MarineFIFKIFNMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDHQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIKAYDPK
Ga0193149_101975313300018779MarineFIFKIFNMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDHQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKE
Ga0193149_105909013300018779MarineKFYAMLALMGANAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0193117_103248113300018796MarinePPCVYLDETTAELEKQVDLFSKTLDTRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAVDAYKDE
Ga0192978_102878913300018871MarineMKFYAIAALFAATSAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDTRHWTNVLNISGALKAKSGSAPKLQVHSWELLDKSFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLGTKYHNGEFVDPALDAYKE
Ga0193553_107700613300018873MarineKLEQKAPPCIYLDETQGELDHQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0193260_1004361513300018928MarineFIFKNIIMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDHQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0193006_1021355713300018975MarineMGNNIYFENKMRFTTLALLVVGALGVKLESEAPPCIYLDETQGELDKQIDLFSKTLDPRHWTNVLNIASAMKKKSGTAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFMKVAQTVKRNLNAKYHNGEFSDPAGGAYDDPDAPKPNNGWS
Ga0193353_1008547723300018977MarineMGNIILYLKFIFKKSAMKFYALAALCLGASAVKLEQKESAPPCIYLDETQGELDNQIDLFSKTLDTRHWTNVLNIAGALKAKSGSAPKFQVHSWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKDDE
Ga0192961_1007612713300018980MarineMKVYAIAALVFGASAMKVEQKAPPCVYLDETQAELDHQVDLFSKTLDVRHWTNTLNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPATGAYDE
Ga0192947_1009044513300018982MarineMKIHAIAALVLGASAHKLEQKAPPCIYLDETTAELDKQVDLFSKTLDVRHWTNVLNISGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKEPEE
Ga0192947_1009307113300018982MarineMKIHAIAALILAASASKLEQKAPPCVYLDETQAELDNQVDLFSKTLDVRHWTNTLNIAGALKDKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKE
Ga0193030_1006326813300018989MarineTWGNIILYLKFIFKIFNMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDNQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKED
Ga0193030_1006544113300018989MarineMKFYALAALCLGASAVKLEQKAPPCVYLDETQAELDKQTDLFSKTLDTRHWTNVLNIAGAIKKKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEEDXAS
Ga0193030_1007307313300018989MarineHGELIIEVNISIIMRFSSLLLVVGALSATSATEAPPCIYLDETQAELDKQIDLFSKTLDPRHWTNVLNIADAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFKDPAADAYKDPDEECKGSACWI
Ga0193030_1007328313300018989MarineHGELIIEVYISIIMRFSSLLLVVGALSATSATEAPPCIYLDETQAELDKQIDLFSKTLDPRHWTNVLNIADAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFKDPAADAYKDPDEECKGSACWI
Ga0193030_1007616013300018989MarineTWGNIILYLKFIFKIFNMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDNQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIKAYDPK
Ga0193030_1007713013300018989MarineGIVNNFIFEIYFKTMKIHAIAALVLGASALKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATGAYDEDK
Ga0193030_1009293913300018989MarineVAAANGSQVKSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLKVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEDD
Ga0193030_1009622113300018989MarineVQLEQKAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0193030_1010506613300018989MarineKAPPCVYLDETQAELDNQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATGAYDEDK
Ga0193030_1014711723300018989MarineETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFGDPAVGAYDKADAKEKVWTGSGWA
Ga0193034_1014291213300019001MarinePPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAVGAYDKADAKEKVWTGSGWA
Ga0192982_1010724113300019021MarineHGEYNFLFEVYFQKITMKFYAIAALFAATSAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDTRHWTNVLNISGALKAKSGSAPKLQVHSWELLDKSFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLGTKYHNGEFVDPALDAYKE
Ga0193535_1011240613300019024MarineCLGASAVKLEQKAPPCVYLDETQAELDKQTDLFSKTLDTRHWTNVFNIAGAIKKKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKRMNELHDEPASTGSMGFNKNGTFS
Ga0193516_1009542923300019031MarineMGNIILYLKFISKKSTMKFYALVALVLGANAVTVEQKAPPCIYLDETQAELDKQIDLFSKTLDPRHWTNVLNIAGALKKKGGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0192869_1012316923300019032MarineMKIAAIAALVIEASAHKVEQKAPPCIYLDETTAELNKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLAVHTWELYDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKSDDE
Ga0192869_1012362013300019032MarineMKIAAIAALVIEASAHKVEQKAPPCIYLDETTAELNKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLAVHTWELYDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKSDDEXIXLSSQXTLVPSNYKGLMIGTLLN
Ga0192869_1033152013300019032MarineMKIAAIAALVIEASAHKVEQKAPPCIYLDETTAELNKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLAVHTWELYDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKEDE
Ga0193037_1010716323300019033MarineKLESEAPPCIYLDETQGELDKQIDLFSKTLDPRHWTNVLNIASAMKKKSGTAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFMKVAQTVKRNLNAKYHNGEFNDPAGGAYDDPDAPKPNNGWS
Ga0192981_1009874113300019048MarineMKFYAIAALFAATSAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNTLNIAGALKKKSGVAPKLQVHTWELLDAAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAADAYKE
Ga0193082_1027056113300019049MarineVLGASALKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEDE
Ga0192826_1015782513300019051MarineQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKGMTEYDCRASEFXLKQLYKG
Ga0193102_101162023300019099MarineMGNIILYLKFIFKKITMKFYALAALCLGASAVKLEQKAPPCVYLDETQAELDKQTDLFSKTLDTRHWTNVLNIAGAIKKKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEDDEK
Ga0193054_102113713300019117MarineMKIYALAALVLGASATKLEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0193157_102494813300019118MarineMSVDAIQIKNAVEIEAEKPPCVYLDETQAELDYQVDRFSRTLDPRHWTNVVNLRNALSKKTGATPKLQVHTWELLDKAFSFPRVRRYQYVQENMDMLEHFQDNLNTNISNEVNMANFLRVASTVKKNLGTKYHDGEFTDPASYDCKAFDPPKC
Ga0193157_102954013300019118MarineNAVKLEQKAPPCIYLDETSAELDKQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0193157_103743513300019118MarineLDETQAELDKQVDLFSKTLDTRHWTNVLNIAGALKKKSGVAPKLQIHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEE
Ga0192980_103316213300019123MarineHGEYNFLFEVYFQKITMKFYAIAALFAATSAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNTLNIAGALKKKSGVAPKLQVHTWELLDAAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAADAYKE
Ga0193104_101706613300019125MarineNGNIILYLKFIFKIFNMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDNQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIKAYDPK
Ga0193089_104527713300019133MarineHGEYNFIFEIYFQKTMKVYAIAALVFGASAMKVEQKAPPCVYLDETQAELDHQVDLFSKTLDVRHWTNTLNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPATGAYDE
Ga0188870_1005454923300019149Freshwater LakeMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0188870_1012027813300019149Freshwater LakeLFSKTMKIHAIAALILGASALKIEQKAPPCVYLDETQAELDNQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAAGAYA
Ga0206688_1037991313300021345SeawaterKMRFTTLALLVVGALGVKLESEAPPCIYLDETQGELDKQIDLFSKTLDPRHWTNVLNIASAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFMKVAQTVKRNLNAKYHNGEFSDPAGGAYDDPDAPKPNNGWS
Ga0206688_1078998713300021345SeawaterLFSNNMKFKSLIMLIAGAAAVKIESEAPPCIYLDETQKELDNQVDLFSKTLDPRHWTNVLNIAGAMKKKSGTAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFSDPAAGAYDDPDADKPNNGWS
Ga0206695_145035213300021348SeawaterMGANAVKVEQKAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNTLNIAGALKKKSGVAPKLQVHTWELLDAAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0206695_159460213300021348SeawaterFKEIMKFSAIIVFLLGATQATQVDQKAVKPPCVYLDETQAELDHQVDLFSKTLDPRHWTNTLNIAGAMKKKSGQSPKLQVHTWELLDKAFTFARIRRYQYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLATKYHNGEFVDPAIDAYKED
Ga0206695_162198013300021348SeawaterEIYFQKTMKVYAIAALVFGASAMKVEQKAPPCVYLDETQAELDHQVDLFSKTLDVRHWTNTLNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVA
Ga0206692_120750113300021350SeawaterMKITAIAALVFGASALKVEQKAPPCIYLDETTAELNKQVDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLAVHTWELYDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEEDE
Ga0206692_126811513300021350SeawaterMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDSAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0206693_110997123300021353SeawaterRFTTLALLVVGALGVKLESEAPPCIYLDETQGELDKQIDLFSKTLDPRHWTNVLNIASAMKKKSGSAPKLQVHTWELLDKAFTFLRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFMKVAQTVKRNLNAKYHNGEFSDPAGGAYDDPDAPKANNGWS
Ga0206693_175282013300021353SeawaterFQKTMKVYAIAALVFGASAMKVEQKAPPCVYLDETQAELDHQVDLFSKTLDVRHWTNTLNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVA
Ga0206690_1053433413300021355SeawaterMKFYALAMLCLGANAVKLEQKAPPCIYLDETQGELDKQVTFFSKTLDPRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKDE
Ga0206690_1086423213300021355SeawaterKFIFKKSTMKFYALAALFIGASAVKIEQKAPPCIYLDETQAELYKQVDLFSKTLDPRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKE
Ga0206690_1099284313300021355SeawaterQGELDNQIDLFSKTLDPRHWTNVLNIASAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTAKRNLNAKYHNGEFSDPAGGAYDDPDAPKANNGWS
Ga0206689_1060303213300021359SeawaterYFKEIMKFSAIIVFLLGATQATHVDQKAVKPPCVYLDETQAELDHQVDLFSKTLDPRHWTNTLNIAGAMKKKSGQSPKLQVHTWELLDKAFTFARIRRYQYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLATKYHNGEFVDPAIDAYKED
Ga0206689_1095486113300021359SeawaterFSNNMKFTSLIMLIAGAAAVKIESEAPPCIYLDETQKELDNQVDLFSKTLDPRHWTNVLNIAGAMKKKSGTAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFSDPAAGAYDDPDADKPNNGWS
Ga0206689_1106934813300021359SeawaterMKFYALAMLVVASTEAVKVEQKAPPCIYLDETQGELDKQVDLFSKTLDTRHWTNVLNIAGALKAKSGVAPKLQVHTWELLDKSFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKE
Ga0063109_10195713300021866MarineIFKKITMKFYSLIALLGATSAVKLEQKAPPCVYLDETTAELEKQVDLFSKTLDTRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAVDAYKDE
Ga0063132_10124313300021872MarineVYFKIINMKIAAIAALVLGTSAVKLEQKAPPCVYLDETQAELDNQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPHLTVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKKD
Ga0063132_10297413300021872MarineDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKEKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEDE
Ga0063117_101200913300021881MarineIIMRFSSLLLVVGALSATSATEAPPCIYLDETQAELDKQIDLFSRTLDPRHWTNVLNIAEAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFKDPATDAYKDPDEECKGSACWI
Ga0063126_100871413300021883MarineLFNKKMKFSLIALLVATASGAQIKSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPPLKVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAVGAYDAPSDAPPRVWTGSEWGHM
Ga0063125_100084513300021885MarineLFSKNMKIHAIAALVLGASALKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKED
Ga0063125_100526413300021885MarineMKLYALAALVLGASATKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKED
Ga0063114_100862713300021886MarineMKIHAIAALVLGASALKLEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKEDD
Ga0063142_105518313300021893MarineKLEQKAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNVLNISGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0063099_110629413300021894MarineKITAIAALVAAATAVKLEQKAPPCIYLDETQGELDKQLDFFSKTLDVRHWTNVMNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVTAYDD
Ga0063131_103799213300021904MarineSKTMKIHAIAALVLGASALKLDTQKPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFXDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAXDAYKEEE
Ga0063131_106414813300021904MarineKFYALAALCLGANAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDTRHWTNVLNIAGALKKKSGVAPKLQIHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNVNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0063106_106535913300021911MarineFKNMKFSMIALLVAAANGAQVQTAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVSTTVKKNLNAKYHNGEFADPAVGAYDKADAHTKVWTGSGWA
Ga0063133_102091413300021912MarineSKTMKIYAIAALVLGASALKLEQKKPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEEE
Ga0063133_103965113300021912MarineKNMKLYALAALVLGASATKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKED
Ga0063096_100141313300021925MarineQKTMKITAIAALVAAATAVKLEQKAPPCIYLDETQGELDKQLDFFSKTLDVRHWTNVMNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVTAYDD
Ga0063103_101551613300021927MarineLKFIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVSTTVKKNLNAKYHNGEFADPAVGAYDKADAHTKVWTGSGWA
Ga0063103_116993413300021927MarineTAVKIEQKAPPCIYLDETQAELDNQLDLFSKTLDVRHWTNVMNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAASAY
Ga0063134_102059113300021928MarineKKITMKFYSLIALLGATSAVKLEQKAPPCVYLDETTAELEKQVDLFSKTLDTRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAVDAYKDE
Ga0063134_103015813300021928MarineQKTMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNISGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEED
Ga0063139_116218913300021934MarineKFSLIALLVAAANGSQVKSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLKVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAAGAYAAPDDTPPRVWTGSEWGHM
Ga0063102_101903113300021941MarineKFIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVSTTVKKNLNAKYHNGEFADPAVGAYDKADAHTKVWTGSGWA
Ga0063102_101903213300021941MarineMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVSTTVKKNLNAKYHNGEFADPAVGAYDKADAHTKVWTGSGWA
Ga0063094_100606913300021943MarineLFQKTMKITAIAALVAAATAVKLEQKAPPCIYLDETQGELDKQLDFFSKTLDVRHWTNVMNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVTAYDD
Ga0063101_102464013300021950MarineKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVSTTVKKNLNAKYHNGEFADPAVGAYDKADAHTKVWTGSGWA
Ga0222717_1012193813300021957Estuarine WaterMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDHQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAIDAYKED
Ga0228679_102380413300023566SeawaterVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0228697_10946513300023674SeawaterMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0232114_11059113300023676SeawaterFIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0228684_102799313300023704SeawaterKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0209634_109820713300025138MarineMKIHAIAALVLGASALKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKEKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEPEE
Ga0208276_102889213300026166MarineMKFYALAMLCLGAEAVKIEQKAPPCIYLDETQGELDKQVDFFSKTLDPRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKE
Ga0208275_101599813300026182MarineMKFSTIALVFVGLISNTQEIKLEQPPCVYLDETQAELDYQVDRFSRTLDPRHWTNVVNLRNAMAKKSGSTPKLQVHTWELLDKAFSFPRVRRYQYVQENMDMLEHFQDNLNTNISNEVNMANFLRVAGTVKKNLSTKYHDGEFSDPAAYDCKKTTPKEC
Ga0247558_10961613300026390SeawaterIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0247578_103148713300026458SeawaterYLKFIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0247600_104021113300026461SeawaterKFIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0247598_107070513300026466SeawaterLRFISKTMKIAAIAALVLAASATKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEDE
Ga0247599_106865613300026470SeawaterQTTMKIHAIAALVLGATAVKVEQKAPPCIYLDETQAELDHQIDLFSKTLDVRHWTNTLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATDAYKKDDE
Ga0247602_107942313300026471SeawaterLAASATKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEDE
Ga0247592_106187013300026500SeawaterLKFIFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0247605_107001913300026503SeawaterAPPCIYLDETQAELDHQIDLFSKTLDVRHWTNTLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATDAYKKDDE
Ga0247590_106416113300026513SeawaterIYFQTTMKIHAIAALVLGATAVKVEQKAPPCIYLDETQAELDHQIDLFSKTLDVRHWTNTLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATDAYKKDDE
Ga0247582_107013313300028109SeawaterEIYFQTTMKIHAIAALVLGATAVKVEQKAPPCIYLDETQAELDHQIDLFSKTLDVRHWTNTLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATDAYKKDDE
Ga0247584_107148613300028110SeawaterSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0256411_111306013300028134SeawaterISKTMKIAAIAALVLAASATKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKEPEE
Ga0256411_112049313300028134SeawaterKMKIHAIAALVLGASALKLEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEDDEK
Ga0256412_112806313300028137SeawaterKIHAIAALVLGATAVKVEQKAPPCIYLDETQAELDHQIDLFSKTLDVRHWTNTLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATDAYKKDDE
Ga0256417_107905013300028233SeawaterKKMKIHAIAALVLGASALKLEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAVDAYKEDDEK
Ga0256413_113492613300028282SeawaterGATAVKVEQKAPPCIYLDETQAELDHQIDLFSKTLDVRHWTNTLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVVKNLSTKYHNGEFANPATDAYKKDDE
Ga0247597_101836113300028334SeawaterFKNMKFSMIALLVAAANGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKRNLNAKYHNGEFADPAVGAYDKDDSKPKVWTGSGWA
Ga0304731_1000203613300028575MarineKNIIMKFYALAALCLGANAVKLEQKAPPCIYLDETQGELDHQVDLFSKTLDVRHWTNVLNIAGALKAKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIKAYDPK
Ga0304731_1032024913300028575MarineKITMKFYSLIALLGATSAVKLEQKAPPCVYLDETTAELEKQVDLFSKTLDTRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAVDAYKDE
Ga0304731_1074652713300028575MarineVDAIQIKNAVELEAEKPPCVYLDETQAELDYQVDRFSRTLDPRHWTNVVNLRNALSKKTGSTPKLQVHAWELLDKAFSFPRVRRYQYVQENMDMLEHFQDNLNTNISNEVNMANFLRVASTVKKNLMTKYHDGEFTDPATYDCKAFDPPKC
Ga0304731_1087805913300028575MarineFSSLLLVVGALSATSATEAPPCIYLDETQAELDKQIDLFSRTLDPRHWTNVLNIAEAMKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFKDPATDAYKDPDEECKGSACWI
Ga0304731_1103815623300028575MarineMKFSLIALLVAAASGAEIKSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPPLKVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFADPAVGAYDAPSDAPPRVWTGSEWGHMXAE
Ga0307403_1028021713300030671MarineYFQKITMKFYAIAALFAATSAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDTRHWTNVLNISGALKAKSGSAPKLQVHSWELLDKSFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLGTKYHNGEFVDPALDAYKE
Ga0307398_1028444113300030699MarineLFDIYSKKNMKFYTLAILAMASTEAVKVEQKAPPCIYLDETSAELEKQVDFFSKTLDPRHWTNVLNIAGALKKSSGAAPKLQVHSWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPATDAYKDE
Ga0307399_1035922713300030702MarineLKLIFKNMKFSLIALLVAAANGAQVDTAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVSTTVKRNLNAKYHNGEFADPAAGAYDKADDKQKVWTGSGWA
Ga0308127_102589913300030715MarineQKTMKITAIAALVAAATAVKLEQKAPPCIYLDETQGELDKQLDFFSKTLDVRHWTNVMNIAGALKAKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVGAYDE
Ga0308140_106459113300030727MarineYFQKITMKFFALAALVFGATSAVKIESKAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNVLNIAGALKAKSGSAPGLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVGAYD
Ga0073988_1000185613300030780MarineSALKLEQKAPPCVYLDETQAELDKQMDLFSKTLDVRHWTNVLNIAGALKEKSGTAPKLSVHTWELYDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFLKVANTVRKNLNTKYHNGEFVDPAVDAYKEDDE
Ga0073988_1001742813300030780MarineLFQKTMKIHAIAALVLGASALKLEQKAPPCVYLDETQAELSKQIDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKED
Ga0073988_1231137613300030780MarineAVKLEQKAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNVLNIAGALKKKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKED
Ga0073982_1174972713300030781MarineSKTMKIYALVALVFGASAHKIEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFVDPAVDAYKED
Ga0073990_1203625013300030856MarineMKIAAIAALVLGASALKLEQKAPPCVYLDETQAELDKQMDLFSKTLDVRHWTNVLNIAGALKEKSGTAPKLSVHTWELYDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNVSNSVNMANFLKVANTVRKNLNTKYHNGEFVDPAVDAYKEDDE
Ga0073987_1000239913300030912MarineMKIYALVALVFGASAHKIEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKEDXLXLPSQXILTPSNYKG
Ga0073984_1128723213300031004MarineQAELDKQIDLFSKTLDVRHWTNVLNIAGALKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEDXVXL
Ga0073980_1000160613300031032MarineLFQKNMKIHAIAALVLGASALKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNIAGAMKEKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKPDE
Ga0073980_1138121913300031032MarineSATKLEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNVLNISGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFQDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKEED
Ga0073989_1001902813300031062MarineAIAALVLGASATKLEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFVDPAIDAYKEDE
Ga0308149_101397813300031542MarineMKFSMIALLVAAPNGAQVQSAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNTLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFGDPAVGAYDKADAKTKVWTGSGWA
Ga0307984_106715013300031658MarineAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNTLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFGDPAAGAYDKADAKTKVWTGSGWA
Ga0307385_1013775413300031709MarineKIHAIAALVLGASAVKIEQKAPPCVYLDETQAELANQVDLFSKTLDVRHWTNVLNIAGALKEKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKVDE
Ga0307386_1020380413300031710MarineVVFEIYFKTMKIHAIAALVLGASAVKIEQKAPPCVYLDETQAELANQVDLFSKTLDVRHWTNVLNIAGALKEKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKVDE
Ga0307386_1022716013300031710MarineFKNMKFSLIALLVAAANGAQVDTAVEGPPCVYLDETQAELDNQIDLFSKTLDPRHWTNVLNIAGAMKAKSGVAPKLQVHTWELLDNAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFIKVATTVKKNLNAKYHNGEFGDPAVGAYDKADAKTKVWTGSGWA
Ga0307386_1031639513300031710MarineMKIHAIAALVFGASALKIEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNTLNIAGALKDKSGAAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKED
Ga0307381_1010339113300031725MarineIYFKTMKIHAIAALVLGASAVKIEQKAPPCVYLDETQAELANQVDLFSKTLDVRHWTNVLNIAGALKEKSGAAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKVDE
Ga0307381_1011103513300031725MarineIHAIAALVLGASAVKIEQKAPPCIYLDETQAELDHQVDLFSKTLDVRHWTNVLNIAGALKAKSGVAPHLTVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNGKYHNGEFADPAVGAYDP
Ga0307397_1017395813300031734MarineMKLYAILALATANAVKVESQAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNTLNIAGALKKKSGVAPKLQVHTWELLDAAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAADAYKE
Ga0307384_1013271313300031738MarineSSKYKQNQHQTCLNSIDILNHIQMCINNLIFNLYRTMKIHAIAALVLGASAVKIEQKAPPCVYLDETQAELANQVDLFSKTLDVRHWTNVLNIAGALKEKSGAAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKVDE
Ga0307384_1022591913300031738MarineQKTMKVYAIAALVFGASALKIEQKAPPCVYLDETQAELDKQVDLFSKTLDVRHWTNTLNIAGALKDKSGAAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKED
Ga0307384_1043389123300031738MarineKIHTIAALVLGASAHKLEQKTPPCIYLDETTAELDKQVDLFSKTLDVRHWTNVLNISGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNANISNSVNMANFLKVANTVKKNLNAKYHNGEFADPAVDAYKEPEEXIXLLSQXTLAQTIIKGLIIWHLS
Ga0307382_1016800613300031743MarineMKIHAIAALVLGASAVKIEQKAPPCVYLDETQAELANQVDLFSKTLDVRHWTNVLNIAGALKEKSGSAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKVDE
Ga0314689_1024100913300032518SeawaterFSKTMKIHAIAALILGASALKIEQKAPPCVYLDETQAELDNQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKDD
Ga0314680_1035118633300032521SeawaterSKTMKIHAIAALVLGASALKIEQKAPPCVYLDETQAELDNQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKDD
Ga0314682_1026528313300032540SeawaterLFSKTMKIHAIAALILGASALKIEQKAPPCVYLDETQAELDNQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKDD
Ga0314674_1028251013300032615SeawaterKTMKIHAIAALILGASALKIEQKAPPCVYLDETQAELDNQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKDD
Ga0314681_1035991523300032711SeawaterSKTMKIHAIAALILGASALKIEQKAPPCVYLDETQAELDNQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHTGEFADPAVDAYKKDD
Ga0314704_1030706113300032745SeawaterHAIAALILGASALKIEQKAPPCVYLDETQAELDNQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKDD
Ga0314694_1012644833300032751SeawaterMPVETMKIHAIAALILGASALKIEQKAPPCVYLDETQAELDNQVDLFSKTLDVRHWTNVLNIAGALKDKSGVAPRLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKKDD
Ga0307390_1035264113300033572MarineTANAVKVESQAPPCIYLDETQAELDKQVDLFSKTLDPRHWTNTLNIAGALKKKSGVAPKLQVHTWELLDAAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAADAYKE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.