NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027057

Metagenome / Metatranscriptome Family F027057

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027057
Family Type Metagenome / Metatranscriptome
Number of Sequences 196
Average Sequence Length 43 residues
Representative Sequence GTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK
Number of Associated Samples 167
Number of Associated Scaffolds 196

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.65 %
% of genes near scaffold ends (potentially truncated) 91.84 %
% of genes from short scaffolds (< 2000 bps) 89.80 %
Associated GOLD sequencing projects 157
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.918 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(10.714 % of family members)
Environment Ontology (ENVO) Unclassified
(37.755 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(32.143 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.86%    β-sheet: 0.00%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 196 Family Scaffolds
PF09084NMT1 27.55
PF08028Acyl-CoA_dh_2 11.22
PF07883Cupin_2 7.14
PF13379NMT1_2 4.59
PF00441Acyl-CoA_dh_1 4.59
PF07969Amidohydro_3 2.55
PF04909Amidohydro_2 1.53
PF03401TctC 1.02
PF01979Amidohydro_1 1.02
PF04199Cyclase 0.51
PF01112Asparaginase_2 0.51
PF00571CBS 0.51
PF15919HicB_lk_antitox 0.51
PF02771Acyl-CoA_dh_N 0.51
PF00596Aldolase_II 0.51
PF04349MdoG 0.51
PF00005ABC_tran 0.51
PF01850PIN 0.51
PF06029AlkA_N 0.51
PF00933Glyco_hydro_3 0.51
PF03972MmgE_PrpD 0.51
PF00881Nitroreductase 0.51
PF07690MFS_1 0.51
PF01266DAO 0.51
PF13378MR_MLE_C 0.51
PF13537GATase_7 0.51
PF03918CcmH 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 196 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 27.55
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 27.55
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 16.33
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.02
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.51
COG1446Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamilyAmino acid transport and metabolism [E] 0.51
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.51
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.51
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.51
COG3088Cytochrome c-type biogenesis protein CcmH/NrfFPosttranslational modification, protein turnover, chaperones [O] 0.51
COG3131Periplasmic glucan biosynthesis protein OpgGCell wall/membrane/envelope biogenesis [M] 0.51

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.92 %
UnclassifiedrootN/A4.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG01ANN2IAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
2228664022|INPgaii200_c0699644All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0501142All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101286655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium793Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101988622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1357Open in IMG/M
3300000559|F14TC_100343548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3077Open in IMG/M
3300000789|JGI1027J11758_12855424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1159Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1003991All Organisms → cellular organisms → Bacteria2082Open in IMG/M
3300000891|JGI10214J12806_10704329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium986Open in IMG/M
3300000953|JGI11615J12901_10127771All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300001431|F14TB_103430814All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300002223|C687J26845_10170166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium780Open in IMG/M
3300003997|Ga0055466_10262233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300004013|Ga0055465_10334620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300004049|Ga0055493_10047806All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300004050|Ga0055491_10096360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300004114|Ga0062593_100648888All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1018Open in IMG/M
3300004114|Ga0062593_103136668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300004157|Ga0062590_102652030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300004463|Ga0063356_102726812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300004778|Ga0062383_10087317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1310Open in IMG/M
3300004780|Ga0062378_10157081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300005169|Ga0066810_10184218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300005178|Ga0066688_10370916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium927Open in IMG/M
3300005180|Ga0066685_10166192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1505Open in IMG/M
3300005183|Ga0068993_10291150All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300005186|Ga0066676_10198878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1287Open in IMG/M
3300005186|Ga0066676_10485477All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005294|Ga0065705_10681178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300005295|Ga0065707_10992920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300005295|Ga0065707_11030642All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300005330|Ga0070690_100681464All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300005332|Ga0066388_105405316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria647Open in IMG/M
3300005364|Ga0070673_101239372All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria699Open in IMG/M
3300005447|Ga0066689_10360057All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium908Open in IMG/M
3300005526|Ga0073909_10021197All Organisms → cellular organisms → Bacteria2121Open in IMG/M
3300005536|Ga0070697_102059137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300005553|Ga0066695_10745567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300005558|Ga0066698_10815259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300005563|Ga0068855_100372489All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300005568|Ga0066703_10713242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300005617|Ga0068859_102576302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria560Open in IMG/M
3300005836|Ga0074470_10745841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1215Open in IMG/M
3300005836|Ga0074470_11566258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium923Open in IMG/M
3300005843|Ga0068860_101670793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300006755|Ga0079222_10132010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1383Open in IMG/M
3300006796|Ga0066665_10655915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium835Open in IMG/M
3300006804|Ga0079221_10339214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria901Open in IMG/M
3300006806|Ga0079220_10882418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300006844|Ga0075428_100214914All Organisms → cellular organisms → Bacteria2077Open in IMG/M
3300006844|Ga0075428_100961395All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium905Open in IMG/M
3300006845|Ga0075421_101194441All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300006854|Ga0075425_100114513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3076Open in IMG/M
3300006865|Ga0073934_10297531All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1033Open in IMG/M
3300006871|Ga0075434_100397827All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300006871|Ga0075434_101145312All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300006904|Ga0075424_100129584All Organisms → cellular organisms → Bacteria → Proteobacteria2668Open in IMG/M
3300006954|Ga0079219_10498466All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300007076|Ga0075435_100421464All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300009012|Ga0066710_103246433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300009012|Ga0066710_104260517All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300009053|Ga0105095_10401754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium756Open in IMG/M
3300009053|Ga0105095_10732150Not Available552Open in IMG/M
3300009087|Ga0105107_11135341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300009092|Ga0105250_10269313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium731Open in IMG/M
3300009094|Ga0111539_10198156All Organisms → cellular organisms → Bacteria2342Open in IMG/M
3300009100|Ga0075418_10100222All Organisms → cellular organisms → Bacteria3076Open in IMG/M
3300009100|Ga0075418_10488479All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300009101|Ga0105247_11526303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300009137|Ga0066709_102840398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300009147|Ga0114129_10174499All Organisms → cellular organisms → Bacteria2928Open in IMG/M
3300009156|Ga0111538_10112198All Organisms → cellular organisms → Bacteria3463Open in IMG/M
3300009156|Ga0111538_12709041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria621Open in IMG/M
3300009157|Ga0105092_10399073Not Available782Open in IMG/M
3300009157|Ga0105092_10616101All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300009162|Ga0075423_10061126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3898Open in IMG/M
3300009162|Ga0075423_10668962All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300009167|Ga0113563_12456194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300009609|Ga0105347_1283354All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300009678|Ga0105252_10152759All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300009792|Ga0126374_10022614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2791Open in IMG/M
3300009810|Ga0105088_1008816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1466Open in IMG/M
3300010043|Ga0126380_10226966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1273Open in IMG/M
3300010043|Ga0126380_10243676All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300010304|Ga0134088_10102867All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300010323|Ga0134086_10074798All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1173Open in IMG/M
3300010333|Ga0134080_10097950All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300010335|Ga0134063_10539026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300010359|Ga0126376_13084617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300010360|Ga0126372_11311697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium753Open in IMG/M
3300010361|Ga0126378_11926540Not Available673Open in IMG/M
3300010398|Ga0126383_10872931All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria985Open in IMG/M
3300010398|Ga0126383_11931073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium678Open in IMG/M
3300010400|Ga0134122_11288817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300011119|Ga0105246_11836325All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300011403|Ga0137313_1095878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria537Open in IMG/M
3300011421|Ga0137462_1133876All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300011423|Ga0137436_1179862Not Available560Open in IMG/M
3300011434|Ga0137464_1168468All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300012039|Ga0137421_1111216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300012096|Ga0137389_11333216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300012171|Ga0137342_1099519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300012172|Ga0137320_1025538All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1182Open in IMG/M
3300012199|Ga0137383_10835761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300012199|Ga0137383_10863994All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300012211|Ga0137377_10677017All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300012349|Ga0137387_10853965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300012349|Ga0137387_10907890All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300012353|Ga0137367_10982531All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300012354|Ga0137366_10181483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1578Open in IMG/M
3300012354|Ga0137366_11115640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300012495|Ga0157323_1011189All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300012501|Ga0157351_1004172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1104Open in IMG/M
3300012509|Ga0157334_1074401All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300012532|Ga0137373_10360512All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300012685|Ga0137397_10121251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1926Open in IMG/M
3300012918|Ga0137396_10266196All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1266Open in IMG/M
3300012925|Ga0137419_10503001All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium962Open in IMG/M
3300012958|Ga0164299_11550077All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012985|Ga0164308_10779182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M
3300013306|Ga0163162_11461218All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300014262|Ga0075301_1018007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1162Open in IMG/M
3300014263|Ga0075324_1163257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300014269|Ga0075302_1056688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium802Open in IMG/M
3300014870|Ga0180080_1028420All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium843Open in IMG/M
3300014877|Ga0180074_1022862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1228Open in IMG/M
3300014881|Ga0180094_1051141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria883Open in IMG/M
3300015372|Ga0132256_100023084All Organisms → cellular organisms → Bacteria5543Open in IMG/M
3300015372|Ga0132256_101253858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium854Open in IMG/M
3300015373|Ga0132257_100903310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1107Open in IMG/M
3300015373|Ga0132257_104441095Not Available510Open in IMG/M
3300015374|Ga0132255_103593781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300017939|Ga0187775_10194596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium749Open in IMG/M
3300018084|Ga0184629_10181406All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1081Open in IMG/M
3300018084|Ga0184629_10447461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria677Open in IMG/M
3300019878|Ga0193715_1034806All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1091Open in IMG/M
3300020003|Ga0193739_1045898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1127Open in IMG/M
3300020003|Ga0193739_1167578All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300020004|Ga0193755_1082924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1027Open in IMG/M
3300020064|Ga0180107_1230709All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300021081|Ga0210379_10090820All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300021081|Ga0210379_10326718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium673Open in IMG/M
3300022214|Ga0224505_10298684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300025326|Ga0209342_10120597All Organisms → cellular organisms → Bacteria2398Open in IMG/M
3300025549|Ga0210094_1113715All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300025899|Ga0207642_10412753All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria810Open in IMG/M
3300025917|Ga0207660_11516111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300025920|Ga0207649_11113457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria623Open in IMG/M
3300025933|Ga0207706_10575620Not Available968Open in IMG/M
3300025933|Ga0207706_10758645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium826Open in IMG/M
3300025946|Ga0210126_130479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300025959|Ga0210116_1007261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1971Open in IMG/M
3300025972|Ga0207668_12035833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300026089|Ga0207648_11408920All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300026142|Ga0207698_12711020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300026343|Ga0209159_1086750All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300026529|Ga0209806_1189197All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium732Open in IMG/M
3300026536|Ga0209058_1065832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1970Open in IMG/M
3300026536|Ga0209058_1161268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1029Open in IMG/M
3300027277|Ga0209846_1039324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium740Open in IMG/M
3300027560|Ga0207981_1036882All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300027840|Ga0209683_10310445All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300027843|Ga0209798_10073321All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300027875|Ga0209283_10933476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300027907|Ga0207428_11055716All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300027907|Ga0207428_11130465Not Available547Open in IMG/M
3300027909|Ga0209382_11767875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300028803|Ga0307281_10129917All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium870Open in IMG/M
3300028807|Ga0307305_10321003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium704Open in IMG/M
3300030606|Ga0299906_10204100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1560Open in IMG/M
3300031226|Ga0307497_10561541All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031226|Ga0307497_10777846All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300031716|Ga0310813_12356964All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031720|Ga0307469_12058372All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300031820|Ga0307473_10895222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium640Open in IMG/M
3300031858|Ga0310892_10407498All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300031901|Ga0307406_11483437All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031908|Ga0310900_10211776All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300031910|Ga0306923_11761671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300031912|Ga0306921_11168856All Organisms → cellular organisms → Bacteria → Proteobacteria859Open in IMG/M
3300031941|Ga0310912_10628122All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300031949|Ga0214473_11350258All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300031965|Ga0326597_10089336All Organisms → cellular organisms → Bacteria → Proteobacteria3769Open in IMG/M
3300031965|Ga0326597_10442033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1433Open in IMG/M
3300032012|Ga0310902_11219674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300032126|Ga0307415_102020933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300032157|Ga0315912_10040089All Organisms → cellular organisms → Bacteria3733Open in IMG/M
3300032157|Ga0315912_10207325All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300032174|Ga0307470_10769725Not Available742Open in IMG/M
3300032180|Ga0307471_100026263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4391Open in IMG/M
3300032205|Ga0307472_100254542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1380Open in IMG/M
3300033004|Ga0335084_10090863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3168Open in IMG/M
3300033412|Ga0310810_10430174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1347Open in IMG/M
3300033434|Ga0316613_10070653All Organisms → cellular organisms → Bacteria2062Open in IMG/M
3300033815|Ga0364946_104078All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300034149|Ga0364929_0002596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4405Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.18%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.14%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil6.12%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.08%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.55%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.04%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.04%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.53%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.53%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.02%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.02%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.02%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.02%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.02%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.02%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.02%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.02%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.51%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.51%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.51%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.51%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.51%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.51%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.51%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.51%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002223Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004049Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012172Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025946Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_006586202067725004SoilMTDAEIEFQMERLAEKKRPLDEVRDFSFARQAWKELESGK
INPgaii200_069964412228664022SoilSYDAELKTLTRDGQMTDAELEALILRVGEKKRPLDEVRDFTLARQAMKELQ
ICChiseqgaiiDRAFT_050114223300000033SoilSDAELEALMVKLGDKKRPVDEVRDFSLARQAMKELESGR*
INPhiseqgaiiFebDRAFT_10128665523300000364SoilELEGQLERLADKKRPLDEIRDFSFARQALKELESNK*
INPhiseqgaiiFebDRAFT_10198862213300000364SoilAEIETIIARVGEKKRPLDEVRDFSFARQAMKELEAGK*
F14TC_10034354813300000559SoilLAKDGQMNDAEIEFQMERLADKKRPLDEVRDFSFARQALKELEQGK*
JGI1027J11758_1285542423300000789SoilDAELEALILRVGEKKRPLDEVRDFTLARQAMKELQ*
AP72_2010_repI_A100DRAFT_100399113300000837Forest SoilLARDGLMTDAEVESLIVRLAEKKRPLDEIRDFTPARQALKELQ*
JGI10214J12806_1070432923300000891SoilNSLIEKLADKKRPLDEVRDFSFARQAMKEWEAGR*
JGI11615J12901_1012777123300000953SoilLRGLSRDGLMSDAELEALMVKLGDKKRPVDEVRDFSLARQAMKELESGR*
F14TB_10343081423300001431SoilKDGQMTDAEMENLMERLSDKKRPLDEVRDFSYARLALKELEAGK*
C687J26845_1017016623300002223SoilAKDGPMTDAEIEFQMERFAEKKRPLDEIRDFSFARRALKELEQNK*
Ga0055466_1026223313300003997Natural And Restored WetlandsKTLSRDGIMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK*
Ga0055465_1033462023300004013Natural And Restored WetlandsHSYDSELKTLSRDGILSDAEIEAIIARVGEKKRPLAEVRDFSFAREALKELEAK*
Ga0055493_1004780623300004049Natural And Restored WetlandsMSDAKLEALIVKLGDKKRPFDEVRDFSLARQALDDLGAK*
Ga0055491_1009636023300004050Natural And Restored WetlandsMSDANLEALIVKLADKKRPFDEVRDFSLARQALDDLGAK*
Ga0062593_10064888823300004114SoilMSDAELKALMIKLGDKKRPLDEVRDFSLARQALRELESSR*
Ga0062593_10313666813300004114SoilELKTLSRDGTMTDAEINSIIERIGEKKRPLDEVRDFSFAREAFKELGLR*
Ga0062590_10265203023300004157SoilLKALAKDGIMSDPEIEAQMERLADRKRPLDEIRDFSFARQAVRELEAAK*
Ga0063356_10272681213300004463Arabidopsis Thaliana RhizosphereTMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQAMKELDSGR*
Ga0062383_1008731713300004778Wetland SedimentYDNELKNINRDGTMTDAEIESIIERIGEKKRPLNEVRDFSFAREALKELGKQ*
Ga0062378_1015708123300004780Wetland SedimentGTMTDAEIEFQMERLAEKKRPLDEVRDFSFARAALKELESAR*
Ga0066810_1018421823300005169SoilIMTDLEIDAIIARVGEKKRPLDEVRDFSFARQAMKELEAAK*
Ga0066688_1037091613300005178SoilLKTLTRDGQMTDAELEALILRVGEKKRPLDEVRDFTLARQAMKELQ*
Ga0066685_1016619213300005180SoilIRKDGQMTDAEMESFLERLGDKKRPLDEVRDFSLVRQTLKELEANK*
Ga0068993_1029115013300005183Natural And Restored WetlandsLKTLARDGQMTDAEVESLINRLAEKKRPLDEVRDFTFARQ
Ga0066676_1019887823300005186SoilTIRKDGQMTDAEMESFIERLSDKKRPLDEVRDFSLVRQALKELEANK*
Ga0066676_1048547713300005186SoilMTDAEMESFLERLGDKKRPLDEVRDFSLVRQALKELEANK*
Ga0065705_1068117813300005294Switchgrass RhizosphereGQMTDAEMESLMERLSDKKRPLDEVRDFSYARLALKELEGGK*
Ga0065707_1099292013300005295Switchgrass RhizosphereAKDGQMTDAEIESLMERLSDKKRPLDEVRDFSYARLALKELEAGK*
Ga0065707_1103064213300005295Switchgrass RhizosphereGTMTDAEINSIIERIGEKKRPLDEVRDFSFAREASKELGLR*
Ga0070690_10068146413300005330Switchgrass RhizosphereSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGK*
Ga0066388_10540531613300005332Tropical Forest SoilDSELKTLSRDGTMTDAEVEAIIVRVGEKKRPLDEVRDFSFARQAMKEIEAGR*
Ga0070673_10123937223300005364Switchgrass RhizosphereYDSELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK*
Ga0066689_1036005723300005447SoilKDGQMTDAEIEFQMERLAEKRRPLDEIRDFSFARQAFKEIELNK*
Ga0073909_1002119733300005526Surface SoilKTLSKDGTMTDAEIETIIARVGEKKRPLDEVRDFSFARQAMKELEAGK*
Ga0070697_10205913723300005536Corn, Switchgrass And Miscanthus RhizosphereRDGTMTDAEIDAIITRLGEKKRPLDEIRDFSFARQAMKELRTER*
Ga0066695_1074556723300005553SoilSYDGELKTLSRDGIMTDGEIETIIARVGEKKRPLDEVRDFSFARQAMKELETGK*
Ga0066698_1081525913300005558SoilEIEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK*
Ga0068855_10037248933300005563Corn RhizosphereAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK*
Ga0066703_1071324213300005568SoilMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEANK*
Ga0068859_10257630223300005617Switchgrass RhizosphereSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK*
Ga0074470_1074584123300005836Sediment (Intertidal)LKAHAKDGTMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELER*
Ga0074470_1156625813300005836Sediment (Intertidal)LKTLNRDGTMTDAEIEAIIDRVGEKKRPLNEVRDFSFARDALKELSVK*
Ga0068860_10167079313300005843Switchgrass RhizosphereIDAIIARVGEKKRPLDEVRDFSFARQAMKELQSEK*
Ga0079222_1013201033300006755Agricultural SoilLARDGQMTDSEIEFQMERLADKKRPLDEIRDFSFARAVVKELEAGK*
Ga0066665_1065591513300006796SoilGQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEASK*
Ga0079221_1033921413300006804Agricultural SoilTLSRDGTMTDAEVEAIIARVGEKKRPLNEVRDFSFARQAMKEVDAGK*
Ga0079220_1088241813300006806Agricultural SoilALARDGQMTDAEIEFQMERLADKKRPLDEVRDFSIARQVVKELESGK*
Ga0075428_10021491433300006844Populus RhizosphereKALAKDGQMTDAEMENLMERLSDKKRPLDEVRDFSYARLALKELEAGK*
Ga0075428_10096139513300006844Populus RhizosphereMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELESGK*
Ga0075421_10119444123300006845Populus RhizosphereEIEAIIERVGDKKRPLDEVRDFSFARAALKELGR*
Ga0075425_10011451313300006854Populus RhizosphereESFIERLGDKKRPLDEVRDFSLVRQALKELDANK*
Ga0073934_1029753133300006865Hot Spring SedimentTDAEIEAIIARVGEKKRPLDEVRDFSFARDALKELNLK*
Ga0075434_10039782723300006871Populus RhizosphereVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR*
Ga0075434_10114531223300006871Populus RhizosphereMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR*
Ga0075424_10012958433300006904Populus RhizosphereGQMTDAEMEGFIERLGDKKRPLDEVRDFSLVRQALKELEGGK*
Ga0079219_1049846613300006954Agricultural SoilKDGQMTDAEVEFQMERLSEKKRPLDEVRDFSFARQALKELEGK*
Ga0075435_10042146413300007076Populus RhizosphereQMTDAEIEFQMERLSDKKRPLDEVRDFSFARQALKELGM*
Ga0066710_10324643313300009012Grasslands SoilGQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEASK
Ga0066710_10426051713300009012Grasslands SoilKDGQMTDAEIEFQMERLAEKRRPLDEIRDFSFARQALKEIENK
Ga0105095_1040175413300009053Freshwater SedimentMTDAEIEAIIERVGEKKRPLDEVRDFSFARAALKELGR*
Ga0105095_1073215013300009053Freshwater SedimentLKGLSRDGLMSDAELEALMVKLGDKKRPIDEVCDFSLARQALKELESSR*
Ga0105107_1113534113300009087Freshwater SedimentDGTMTDAEIEGQMERLADKKRPLDEVRDFSFARAAWKELEAGK*
Ga0105250_1026931313300009092Switchgrass RhizosphereRDGQMTDAEIEFQMERLADKKRPLAEVRDFSFARGAFKELEAGK*
Ga0111539_1019815613300009094Populus RhizosphereSELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEGK*
Ga0075418_1010022243300009100Populus RhizosphereDNELKSLSRDGTMTDAEVEAIIVRVGEKKRPLDEVRDFSFARQAMKELEAGK*
Ga0075418_1048847913300009100Populus RhizosphereVEFKALAKDGQMTDAEMENLMERLSDKKRPLDEVRDFSYARLALKELEAGK*
Ga0105247_1152630313300009101Switchgrass RhizosphereTDAEIEFQMERLADKKRPLDEVRDFSFARGAFKELEAGK*
Ga0066709_10284039813300009137Grasslands SoilEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK*
Ga0114129_1017449913300009147Populus RhizosphereTLSRDGIMTDLEIDAIIARVGEKKRPLDEVRDFSFARQAMKELEAAK*
Ga0111538_1011219813300009156Populus RhizosphereDAEIEFQMERLADKKRPLDEVRDFSFARGAFKELEAGK*
Ga0111538_1270904123300009156Populus RhizosphereLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR*
Ga0105092_1039907323300009157Freshwater SedimentKAITPDGQMTDAEMESLIERLGEKKKPLDEVRDFSPVRQAIKELAVGK*
Ga0105092_1061610113300009157Freshwater SedimentTDLEIDAIIARVGEKKRPLDEVRDFSFARQAMKELQ*
Ga0075423_1006112613300009162Populus RhizosphereAEVEFQMDRLAEKKRPLDEIRDFSFARQALKELEAGK*
Ga0075423_1066896213300009162Populus RhizosphereELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR*
Ga0113563_1245619413300009167Freshwater WetlandsHSYDGELKTLNRDGTMTDAEINSIIERVGDKKRNLDEVRDLSFARDAFKKMGLR*
Ga0105347_128335413300009609SoilDAELKNLNRDGLLTDAEIEAIIERVGDKKRPLDEVRDFSFARAALKELGR*
Ga0105252_1015275913300009678SoilGLSRDGLMSDAELEALMIKLGDKKRPIDEVRDFSLARQALKELESSR*
Ga0126374_1002261413300009792Tropical Forest SoilMTDAEIEGQLERLADKKRPLDEIRDFSFARQALKEIESGK*
Ga0105088_100881613300009810Groundwater SandLSRDGIMTDAEIDAIIARVGEKKRPLDEVRDFSFARQAMKELQ*
Ga0126380_1022696623300010043Tropical Forest SoilMTDAEIEAIIARVGEKRRPLDEVRDFSFARDALKELGR*
Ga0126380_1024367633300010043Tropical Forest SoilTDPEIEAIIARVGEKKRPLDEVRDFSFARQAMKELQ*
Ga0134088_1010286733300010304Grasslands SoilQMTDAEMESFLERLGDKKRPLDEVRDFSLVRQTLKELEANK*
Ga0134086_1007479823300010323Grasslands SoilEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK*
Ga0134080_1009795013300010333Grasslands SoilKDGQMTDAELESYLERLGDKKRPPDEERDFSLMRQALKELQANK*
Ga0134063_1053902613300010335Grasslands SoilRKDGQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEANK*
Ga0126376_1308461723300010359Tropical Forest SoilAKDGTMTDAEIEGQLERLADKKRPLDEIRDFSFARQALKEIESGK*
Ga0126372_1131169723300010360Tropical Forest SoilGIMTDAEIEGQLERLADKKRPLDEIRDFSFARQALKELESGK*
Ga0126378_1192654013300010361Tropical Forest SoilEFQMERLTDKKRPLDEVRDFSFARAVFKELEAGK*
Ga0126383_1087293113300010398Tropical Forest SoilLKTLARDGLMTDAEVESLIVRLAEKKRPLDEIRDFAPARQALKELQ*
Ga0126383_1193107333300010398Tropical Forest SoilSYDGELKTLSRDGIMTDPEIEAIIARVGEKKRPLDEVRDFSFARQAMKELQ*
Ga0134122_1128881733300010400Terrestrial SoilFKALAKDGQMTDGEIEFQMDRLADKKRPLDEIRDFSFARQALKELESGK*
Ga0105246_1183632523300011119Miscanthus RhizosphereYDSELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEGK*
Ga0137313_109587823300011403SoilLAKDGQMTDSEIEFQMERLADKKRPLDEIRDFSFARQALKELDSGK*
Ga0137462_113387613300011421SoilKTMTKDGLMSDAELEAVMVKLGDKKRPLDEVRDFSLARQAMKELEGGR*
Ga0137436_117986233300011423SoilLKTLAKDGTMTDAEIEGQMERLADKKRPLDEVRDFSFARAAWKELESGK*
Ga0137464_116846813300011434SoilKNINRDGTMTDAEINSIIERVGEKKRPLDEVRDFSFARDAMKELGLR*
Ga0137421_111121623300012039SoilTDLEIDAIIARVGDKKRPLDEVRDFSFARDAMKELGLAR*
Ga0137389_1133321613300012096Vadose Zone SoilEFQMERLADKKRPLDEIRDFSFARQALKEIESSK*
Ga0137342_109951923300012171SoilTDAEIEFQMDRLAEKRRPLDEIRDFSFARQALKELKASR*
Ga0137320_102553813300012172SoilFELKNLTVDGLMSDAELDSLITRLGDKRRPLDEVRDFTLVRQAVKELDAGK*
Ga0137383_1083576113300012199Vadose Zone SoilAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK*
Ga0137383_1086399413300012199Vadose Zone SoilQMTDAEIEFQMDRLADKKRPLDEIRDFSFARQALKELAAGK*
Ga0137377_1067701713300012211Vadose Zone SoilMTDAELEAVINRVADKKRPLDEVRDFTPARQALKELQAEK*
Ga0137387_1085396523300012349Vadose Zone SoilALAKDGQMTDAEIEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK*
Ga0137387_1090789013300012349Vadose Zone SoilQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEANK*
Ga0137367_1098253123300012353Vadose Zone SoilQMTDAELEAVINRVADKKRPLDEVRDFTPARQALKELQAEK*
Ga0137366_1018148333300012354Vadose Zone SoilKALAKDGQMTDAEIEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK*
Ga0137366_1111564013300012354Vadose Zone SoilTIRKDGQMTDAEMESFLERLGDKKRPLDEVRDFSLVRQALKELEANK*
Ga0157323_101118913300012495Arabidopsis RhizosphereGELKTLSKDGTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK*
Ga0157351_100417213300012501Unplanted SoilLKTLSKDGQMTDAEIEFQMDRLADKRRPLDEVRDFSFARQALKELAVGK*
Ga0157334_107440123300012509SoilSKDGQMTDAEIEFQMDRLADKRRPLDEVRDFSFARQALKELAAGK*
Ga0137373_1036051223300012532Vadose Zone SoilDAEMESLMERLSDKKRPLDEVRDFSYARLALKELEAGK*
Ga0137397_1012125133300012685Vadose Zone SoilMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK*
Ga0137396_1026619613300012918Vadose Zone SoilKDGQMTDAEIEFQMDRLADKKRPLDEVRDFSFARQALKELAAGK*
Ga0137419_1050300123300012925Vadose Zone SoilSRDGTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK*
Ga0164299_1155007723300012958SoilLAKDGQMTDAEIESLMERLSDKKRPLDEVRDFSYARLALKELEAGK*
Ga0164308_1077918213300012985SoilTDAEIEFQMDRLADKKRPLDEIRDFSFARQALKELAAGK*
Ga0163162_1146121813300013306Switchgrass RhizosphereGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEGK*
Ga0075301_101800723300014262Natural And Restored WetlandsLKTLARDGQMTDAEVESLINRLAEKKRPLDEVRDFTFARQALKELETGK*
Ga0075324_116325713300014263Natural And Restored WetlandsGQMTDSEIEFQMERLADKKRPLDEIRDFSFARQALKELDSGK*
Ga0075302_105668813300014269Natural And Restored WetlandsGTMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELESGAR*
Ga0180080_102842013300014870SoilAEIEFQMDRLAEKRRPLDEVRDFSFARQAMKELDAVK*
Ga0180074_102286223300014877SoilQLARDGQMTDAEIEFQMDRLAEKRRPLDEIRDFSFARQALKELEAGR*
Ga0180094_105114123300014881SoilLKALNRDGTMTDGEIEAIIARVGEKKRPLDEVRDFSFAREALKELNLK*
Ga0132256_10002308413300015372Arabidopsis RhizosphereGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR*
Ga0132256_10125385813300015372Arabidopsis RhizosphereALARDGQMTDSEIEFQMERLADKKRPLDEIRDFSFARAVVKELEAGK*
Ga0132257_10090331013300015373Arabidopsis RhizosphereIEFQMDRLADKKRPLDEVRDFSFARQAMKELAAGK*
Ga0132257_10444109523300015373Arabidopsis RhizosphereDGQMTDSEIEFQMERLADKKRPLDEVRDFSFARQAVKELESGK*
Ga0132255_10359378113300015374Arabidopsis RhizosphereTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEGK*
Ga0187775_1019459633300017939Tropical PeatlandEIEFQMDRLADKKRPLDEIRDFSFARAALKELETGK
Ga0184629_1018140613300018084Groundwater SedimentDGQMTDAELEFQMERLAEKKRPLDEIRDFSFGRQALKELEQNR
Ga0184629_1044746113300018084Groundwater SedimentLNRDGTMTDGEIEAIIARVGEKKRPLDEVRDFSFAREALKELNLK
Ga0193715_103480613300019878SoilAESKTLSLDGTMTDAEIETIIARVGEKKRPLDEVRDFSFARQAMKELEAGK
Ga0193739_104589823300020003SoilKTLSRDGIMTDAEIDAIIARVGEKKRPLDEVRDFSFARQAMKELETGR
Ga0193739_116757813300020003SoilGQMTDAEIEFQMDRLAEKRRPLDEIRDFSFARQALKELEANR
Ga0193755_108292413300020004SoilKDGQMTDAEIEFQMDRLADKKRPLDEVRDFSFARQALKELAAGK
Ga0180107_123070923300020064Groundwater SedimentELEALMVKLGDKKRPLDEVRDFSLARQAARELESTR
Ga0210379_1009082033300021081Groundwater SedimentRDGLMTDAELEAVMVKLGDKKRPIDEVRDFSLARQAMKELEAGK
Ga0210379_1032671833300021081Groundwater SedimentRDGQMTDGEIETLIDRLAEKKRPLDEVRDFSFARQAMKELPAGK
Ga0224505_1029868413300022214SedimentMTDAEIESIIERIGEKKRPLNEVRDFSFAREALKELGR
Ga0209342_1012059753300025326SoilMTDAEIEFQMERFAEKKRPLDEIRDFSFARRALKDA
Ga0210094_111371523300025549Natural And Restored WetlandsMTDAEVESLINRLAEKKRPLDEVRDFTFARQALKELETGK
Ga0207642_1041275323300025899Miscanthus RhizosphereEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK
Ga0207660_1151611113300025917Corn RhizosphereRDGTMTDAEIDAIIARVGEKKRPLDEVRDFSFARQAMKELQSEK
Ga0207649_1111345723300025920Corn RhizosphereYDSELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIDAGK
Ga0207706_1057562013300025933Corn RhizosphereQMTDSEIEFQMERLADKKRPLDEVRDFSFARAVFKELEAGK
Ga0207706_1075864513300025933Corn RhizosphereKTLSKDGTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELQTER
Ga0210126_13047923300025946Natural And Restored WetlandsTDAEINAIIERLGDKKRPLDEVRDFSFARDAFKELGMK
Ga0210116_100726133300025959Natural And Restored WetlandsMSDAKLEALIVKLGDKKRPFDEVRDFSLARQALDDLGAK
Ga0207668_1203583313300025972Switchgrass RhizosphereGTMTDAEIEAIIARVGEKKRPLDEVRDFSFARQAMKELEAGK
Ga0207648_1140892023300026089Miscanthus RhizosphereLKTLAKDGQMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELESGK
Ga0207698_1271102023300026142Corn RhizosphereVELKALARDGQMTDAEIEFQMERLADKKRPLDEVRDFSFARGAFKELEAGK
Ga0209159_108675033300026343SoilGQMTDAEMESFIERLSDKKRPLDEVRDFSLVRQALKELEANK
Ga0209806_118919713300026529SoilDLELKTIRKDGQMTDAEIESFIERLGDKKRPLDEVRDFSLVRQALKELEASK
Ga0209058_106583223300026536SoilMTDAELEAVINRVADKKRPLDEVRDFTPARQALKELQAEK
Ga0209058_116126823300026536SoilMTDAEIEFQMERLAEKRRPLDEIRDFSFARQALKEIESNK
Ga0209846_103932413300027277Groundwater SandAKDGQMTDAEIEFQMERLTEKKRPLDEIRDFSFARQAWKELEQRK
Ga0207981_103688233300027560SoilDGTMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQAMKELESAR
Ga0209683_1031044513300027840Wetland SedimentEIESIIERIGEKKRPLNEVRDFSFAREALKELGNR
Ga0209798_1007332143300027843Wetland SedimentELKNINRDGTMTDAEIESIIERIGEKKRPLNEVRDFSFAREALKELGKQ
Ga0209283_1093347623300027875Vadose Zone SoilKALAKDGQMTDAEIEFQMERLADKKRPLDEIRDFSFARQALKEIESSK
Ga0207428_1105571623300027907Populus RhizosphereYDNELKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR
Ga0207428_1113046533300027907Populus RhizosphereEIEFQMERLADKKRPLDEVRDFSFARAVFKELEAGK
Ga0209382_1176787513300027909Populus RhizosphereLKALAKDGQMTDAEVEFQMDRLAEKKRPLDEIRDFSFARQALKELEAGK
Ga0307281_1012991723300028803SoilMTDAEIEFQMDRLAEKRRPLDEVRDFSFARQALKELETGK
Ga0307305_1032100323300028807SoilGQMTDAEIEFQMDRLADKKRLLDEVRDFSFARQALKELAAGK
Ga0299906_1020410033300030606SoilLSRDGQMTDAEINALIDKLGDKKRPLDEVRDFSFARQAMKELEARK
Ga0307497_1056154123300031226SoilAELKALMIKLGDKKRPLDEVRNFSLARQALRELEIGK
Ga0307497_1077784613300031226SoilELKTLSKDGTMTDAEIETIIARVGEKKRPLDEVRDFSFARQAMKELEAGK
Ga0310813_1235696413300031716SoilMTDAEINSIIERIGDKKRPLDEVRDFSFAREASKELGLR
Ga0307469_1205837223300031720Hardwood Forest SoilYDAELKTLTRDGQMTDGELEALILRVGEKKRPLDEVRDFTLARQAMKELQ
Ga0307473_1089522223300031820Hardwood Forest SoilKTIRKDGQMTDAEMESFIDRLGDKKRPLDEVRDFSLVRQALKELEGGK
Ga0310892_1040749833300031858SoilEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGK
Ga0307406_1148343713300031901RhizosphereMSDAELEAVMIKLGDKKRSIDEVRDFSLARQAMKELESGR
Ga0310900_1021177623300031908SoilMSDAELKALMIKLGDKKRPLDEVRDFSLARQALRELESSR
Ga0306923_1176167113300031910SoilARDGQMTDSEIEFQMDRLADKKRPLDEVRDFSFARAAFKELEAGK
Ga0306921_1116885613300031912SoilDAELKTLTRDGQMTDAELEALITRLGEKKRPLDEVRDFTLARQAMKELQ
Ga0310912_1062812213300031941SoilKDGQMTDAEMESLMKRLSDKKRPLDEVRDFSYARLALKELEAGK
Ga0214473_1135025823300031949SoilMTDAEIEFQMERFAEKKRPLDEIRDFSFARRALKELEQNK
Ga0326597_1008933613300031965SoilMTDAEIEFQMERFAEKKRPLDEIRDFSFARQALKELEQNR
Ga0326597_1044203323300031965SoilEMEFQMERLAEKKRPSDQIRDFSFARQALKELEQNN
Ga0310902_1121967413300032012SoilTDLEIAAIIARVGEKKRPLDEVRDFSFARQAMKELEAAK
Ga0307415_10202093313300032126RhizosphereDGTMTDAEISSIIERVGEKKRPLDEVRDFSFAREAMKELGRQ
Ga0315912_1004008933300032157SoilMSDAELEAPMITLGDKKRPLDEVRDFSLARQALRELECSR
Ga0315912_1020732513300032157SoilKGLSRDGLMSDAELEALMVTLGDKKRPLDEVRDFSLARQALRELEIGK
Ga0307470_1076972523300032174Hardwood Forest SoilLNTITKDGQMTDAEMESFIDRLGDKKRPLDEVRDFSLVRQALKELEGGK
Ga0307471_10002626343300032180Hardwood Forest SoilIRKDGQMTDAEMEGFIERLGDKKRPLDEVRDFSLVRQALKELEGGK
Ga0307472_10025454233300032205Hardwood Forest SoilSKDGTMTDAEIEGQLERLADKKRPLDEIRDFSFARQALKEIESGK
Ga0335084_1009086353300033004SoilTMTDAEIEFQMDRLADKRRPLDEVRDFSIARQALKELEAGK
Ga0310810_1043017423300033412SoilKTLSRDGTMTDAEVEAIIARVGEKKRPLDEVRDFSFARQAMKEIEAGR
Ga0316613_1007065323300033434SoilMSDAELEALMVKLGDKKRPIDEVRDFSLARQALRELESRR
Ga0364946_104078_2_1363300033815SedimentAKDGQMTDAEMEFQMERLADKKRPLDEVRDFFHARQAVKELEGK
Ga0364929_0002596_4280_44023300034149SedimentMTDTEIEFQMDRLAEKRRPLDEVRDFSFARQALKELESGK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.