Metagenome Family F027067

Basic Information
Family ID	F027067
Family Type	Metagenome
Number of Sequences	195
Average Sequence Length	35 residues
Representative Sequence	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSR
Number of Associated Samples	19
Number of Associated Scaffolds	191

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	42.05 %
% of genes near scaffold ends (potentially truncated)	8.21 %
% of genes from short scaffolds (< 2000 bps)	41.54 %
Associated GOLD sequencing projects	19
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Eukaryota (39.487 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (75.897 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (66.154 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 191 Family Scaffolds
PF00078	RVT_1	5.76
PF03732	Retrotrans_gag	5.24
PF00665	rve	3.66
PF14372	DUF4413	1.57
PF09337	zf-H2C2	1.05
PF14392	zf-CCHC_4	1.05
PF13639	zf-RING_2	0.52
PF00612	IQ	0.52
PF14244	Retrotran_gag_3	0.52
PF14833	NAD_binding_11	0.52
PF13292	DXP_synthase_N	0.52
PF00098	zf-CCHC	0.52
PF13961	DUF4219	0.52
PF07727	RVT_2	0.52
PF00626	Gelsolin	0.52
PF00069	Pkinase	0.52

COG ID	Name	Functional Category	% Frequency in 191 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	3.66
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	3.66
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	3.66
COG4584	Transposase	Mobilome: prophages, transposons [X]	3.66
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.09

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.82 %
Unclassified	root	N/A	27.18 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.82 %
Unclassified	root	N/A	27.18 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	39.49 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	33.33 %
Unclassified	root	N/A	27.18 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	36.41 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	32.31 %
Unclassified	root	N/A	27.18 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.03 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	36.41 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	32.31 %
Unclassified	root	N/A	27.18 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.03 %

Name	Rank	Taxonomy	Distribution
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	32.31 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	31.79 %
Unclassified	root	N/A	27.18 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	1.03 %

Name	Rank	Taxonomy	Distribution
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	32.31 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	31.79 %
Unclassified	root	N/A	27.18 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella/Raoultella group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group	32.31 %
Unclassified	root	N/A	27.18 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	26.15 %
Lactobacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella	32.31 %
Unclassified	root	N/A	27.18 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	26.15 %
Weissella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	26.15 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	26.15 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	20.00 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	16.92 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	2.56 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Rosales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	16.92 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	2.56 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	14.36 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	2.56 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	12.82 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	2.56 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	1.54 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300028786\|Ga0307517_10003520	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24339	Open in IMG/M
3300028786\|Ga0307517_10007106	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16420	Open in IMG/M
3300028786\|Ga0307517_10014937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10370	Open in IMG/M
3300028786\|Ga0307517_10015549	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	10101	Open in IMG/M
3300028786\|Ga0307517_10017899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	9198	Open in IMG/M
3300028786\|Ga0307517_10019523	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8688	Open in IMG/M
3300028786\|Ga0307517_10024927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	7341	Open in IMG/M
3300028786\|Ga0307517_10028812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	6594	Open in IMG/M
3300028786\|Ga0307517_10028812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	6594	Open in IMG/M
3300028786\|Ga0307517_10029999	Not Available	6394	Open in IMG/M
3300028786\|Ga0307517_10033684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5868	Open in IMG/M
3300028786\|Ga0307517_10033684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5868	Open in IMG/M
3300028786\|Ga0307517_10035593	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5631	Open in IMG/M
3300028786\|Ga0307517_10039133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5220	Open in IMG/M
3300028786\|Ga0307517_10042036	Not Available	4916	Open in IMG/M
3300028786\|Ga0307517_10042329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	4888	Open in IMG/M
3300028786\|Ga0307517_10043566	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	4775	Open in IMG/M
3300028786\|Ga0307517_10046197	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4553	Open in IMG/M
3300028786\|Ga0307517_10049752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4279	Open in IMG/M
3300028786\|Ga0307517_10052993	Not Available	4050	Open in IMG/M
3300028786\|Ga0307517_10057862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3746	Open in IMG/M
3300028786\|Ga0307517_10060002	Not Available	3630	Open in IMG/M
3300028786\|Ga0307517_10062708	Not Available	3490	Open in IMG/M
3300028786\|Ga0307517_10075204	Not Available	2965	Open in IMG/M
3300028786\|Ga0307517_10090004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2521	Open in IMG/M
3300028786\|Ga0307517_10101439	Not Available	2265	Open in IMG/M
3300028786\|Ga0307517_10107665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2145	Open in IMG/M
3300028786\|Ga0307517_10119330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1958	Open in IMG/M
3300028786\|Ga0307517_10123594	Not Available	1900	Open in IMG/M
3300028786\|Ga0307517_10150263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1600	Open in IMG/M
3300028786\|Ga0307517_10168248	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1449	Open in IMG/M
3300028786\|Ga0307517_10183277	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1346	Open in IMG/M
3300028786\|Ga0307517_10262428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1001	Open in IMG/M
3300028786\|Ga0307517_10308661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	882	Open in IMG/M
3300028786\|Ga0307517_10326120	Not Available	846	Open in IMG/M
3300028786\|Ga0307517_10341085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	818	Open in IMG/M
3300028786\|Ga0307517_10356076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	792	Open in IMG/M
3300028786\|Ga0307517_10483890	Not Available	633	Open in IMG/M
3300028786\|Ga0307517_10489276	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	628	Open in IMG/M
3300028786\|Ga0307517_10511616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	608	Open in IMG/M
3300028794\|Ga0307515_10008752	All Organisms → cellular organisms → Eukaryota	19670	Open in IMG/M
3300028794\|Ga0307515_10008857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19538	Open in IMG/M
3300028794\|Ga0307515_10015500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	14037	Open in IMG/M
3300028794\|Ga0307515_10040611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7350	Open in IMG/M
3300028794\|Ga0307515_10041073	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7287	Open in IMG/M
3300028794\|Ga0307515_10042561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7098	Open in IMG/M
3300028794\|Ga0307515_10059040	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	5507	Open in IMG/M
3300028794\|Ga0307515_10063854	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	5160	Open in IMG/M
3300028794\|Ga0307515_10068486	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	4874	Open in IMG/M
3300028794\|Ga0307515_10087479	Not Available	3953	Open in IMG/M
3300028794\|Ga0307515_10088911	All Organisms → cellular organisms → Eukaryota	3897	Open in IMG/M
3300028794\|Ga0307515_10113276	Not Available	3146	Open in IMG/M
3300028794\|Ga0307515_10132070	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2742	Open in IMG/M
3300028794\|Ga0307515_10139058	Not Available	2617	Open in IMG/M
3300028794\|Ga0307515_10141785	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2572	Open in IMG/M
3300028794\|Ga0307515_10147561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	2481	Open in IMG/M
3300028794\|Ga0307515_10194094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1929	Open in IMG/M
3300028794\|Ga0307515_10200749	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1870	Open in IMG/M
3300028794\|Ga0307515_10202829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1853	Open in IMG/M
3300028794\|Ga0307515_10224455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1687	Open in IMG/M
3300028794\|Ga0307515_10238873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1592	Open in IMG/M
3300028794\|Ga0307515_10376214	Not Available	1054	Open in IMG/M
3300028794\|Ga0307515_10478007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	858	Open in IMG/M
3300028794\|Ga0307515_10635375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	679	Open in IMG/M
3300028794\|Ga0307515_10709053	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	622	Open in IMG/M
3300028794\|Ga0307515_10769167	Not Available	583	Open in IMG/M
3300030521\|Ga0307511_10007543	All Organisms → cellular organisms → Eukaryota	10941	Open in IMG/M
3300030521\|Ga0307511_10018726	Not Available	6603	Open in IMG/M
3300030521\|Ga0307511_10018844	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6582	Open in IMG/M
3300030521\|Ga0307511_10036649	Not Available	4254	Open in IMG/M
3300030521\|Ga0307511_10043427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3756	Open in IMG/M
3300030521\|Ga0307511_10045906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3603	Open in IMG/M
3300030521\|Ga0307511_10046478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3569	Open in IMG/M
3300030521\|Ga0307511_10051825	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3282	Open in IMG/M
3300030521\|Ga0307511_10068201	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2629	Open in IMG/M
3300030521\|Ga0307511_10123563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1589	Open in IMG/M
3300030521\|Ga0307511_10143283	Not Available	1396	Open in IMG/M
3300030521\|Ga0307511_10153508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1314	Open in IMG/M
3300030521\|Ga0307511_10186912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1103	Open in IMG/M
3300030521\|Ga0307511_10188026	Not Available	1097	Open in IMG/M
3300030522\|Ga0307512_10011015	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8589	Open in IMG/M
3300030522\|Ga0307512_10036052	Not Available	4202	Open in IMG/M
3300030522\|Ga0307512_10070240	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2610	Open in IMG/M
3300030522\|Ga0307512_10172376	Not Available	1237	Open in IMG/M
3300030522\|Ga0307512_10179860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1191	Open in IMG/M
3300030522\|Ga0307512_10317996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	710	Open in IMG/M
3300030522\|Ga0307512_10323069	Not Available	700	Open in IMG/M
3300030522\|Ga0307512_10404582	Not Available	571	Open in IMG/M
3300031456\|Ga0307513_10003889	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	20090	Open in IMG/M
3300031456\|Ga0307513_10011786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	10840	Open in IMG/M
3300031456\|Ga0307513_10046647	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	4720	Open in IMG/M
3300031456\|Ga0307513_10051548	All Organisms → cellular organisms → Eukaryota	4438	Open in IMG/M
3300031456\|Ga0307513_10056271	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	4200	Open in IMG/M
3300031456\|Ga0307513_10063654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3891	Open in IMG/M
3300031456\|Ga0307513_10117399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2638	Open in IMG/M
3300031456\|Ga0307513_10118648	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2619	Open in IMG/M
3300031456\|Ga0307513_10181890	Not Available	1964	Open in IMG/M
3300031456\|Ga0307513_10260488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1524	Open in IMG/M
3300031456\|Ga0307513_10321749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1304	Open in IMG/M
3300031456\|Ga0307513_10337962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1257	Open in IMG/M
3300031456\|Ga0307513_10411449	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1084	Open in IMG/M
3300031456\|Ga0307513_10432751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1043	Open in IMG/M
3300031456\|Ga0307513_10753349	Not Available	679	Open in IMG/M
3300031456\|Ga0307513_10787396	Not Available	656	Open in IMG/M
3300031456\|Ga0307513_10901642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	591	Open in IMG/M
3300031507\|Ga0307509_10049541	Not Available	4502	Open in IMG/M
3300031507\|Ga0307509_10157613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2173	Open in IMG/M
3300031507\|Ga0307509_10161351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2138	Open in IMG/M
3300031507\|Ga0307509_10244008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1586	Open in IMG/M
3300031507\|Ga0307509_10285436	Not Available	1408	Open in IMG/M
3300031507\|Ga0307509_10350562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1199	Open in IMG/M
3300031507\|Ga0307509_10369787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1150	Open in IMG/M
3300031507\|Ga0307509_10525346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	864	Open in IMG/M
3300031507\|Ga0307509_10571896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	805	Open in IMG/M
3300031507\|Ga0307509_10872686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	564	Open in IMG/M
3300031616\|Ga0307508_10285349	Not Available	1244	Open in IMG/M
3300031616\|Ga0307508_10316396	Not Available	1153	Open in IMG/M
3300031616\|Ga0307508_10396833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	970	Open in IMG/M
3300031616\|Ga0307508_10602113	Not Available	700	Open in IMG/M
3300031616\|Ga0307508_10635792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	671	Open in IMG/M
3300031649\|Ga0307514_10051738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3180	Open in IMG/M
3300031649\|Ga0307514_10060104	Not Available	2901	Open in IMG/M
3300031649\|Ga0307514_10084273	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	2339	Open in IMG/M
3300031649\|Ga0307514_10087094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2289	Open in IMG/M
3300031649\|Ga0307514_10106543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	1998	Open in IMG/M
3300031649\|Ga0307514_10135342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1687	Open in IMG/M
3300031649\|Ga0307514_10152486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1547	Open in IMG/M
3300031649\|Ga0307514_10214772	Not Available	1188	Open in IMG/M
3300031649\|Ga0307514_10261800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1011	Open in IMG/M
3300031649\|Ga0307514_10267453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	993	Open in IMG/M
3300031649\|Ga0307514_10560075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	524	Open in IMG/M
3300031730\|Ga0307516_10011239	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	9757	Open in IMG/M
3300031730\|Ga0307516_10101136	Not Available	2698	Open in IMG/M
3300031730\|Ga0307516_10120321	Not Available	2417	Open in IMG/M
3300031730\|Ga0307516_10528552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	833	Open in IMG/M
3300031730\|Ga0307516_10741160	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	641	Open in IMG/M
3300031730\|Ga0307516_10847523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	577	Open in IMG/M
3300031838\|Ga0307518_10150817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1608	Open in IMG/M
3300031838\|Ga0307518_10395902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	773	Open in IMG/M
3300031838\|Ga0307518_10619146	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	510	Open in IMG/M
3300032354\|Ga0325403_1000738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	24731	Open in IMG/M
3300032354\|Ga0325403_1002535	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16239	Open in IMG/M
3300032354\|Ga0325403_1003557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	14257	Open in IMG/M
3300032354\|Ga0325403_1003558	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14256	Open in IMG/M
3300032354\|Ga0325403_1004906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	12526	Open in IMG/M
3300032354\|Ga0325403_1005849	Not Available	11639	Open in IMG/M
3300032354\|Ga0325403_1005849	Not Available	11639	Open in IMG/M
3300032354\|Ga0325403_1010913	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8635	Open in IMG/M
3300032354\|Ga0325403_1012288	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8093	Open in IMG/M
3300032354\|Ga0325403_1012345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	8071	Open in IMG/M
3300032354\|Ga0325403_1013574	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7658	Open in IMG/M
3300032354\|Ga0325403_1016223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6913	Open in IMG/M
3300032354\|Ga0325403_1021078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5868	Open in IMG/M
3300032354\|Ga0325403_1025473	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	5148	Open in IMG/M
3300032354\|Ga0325403_1026198	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5050	Open in IMG/M
3300032354\|Ga0325403_1040578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	3574	Open in IMG/M
3300032354\|Ga0325403_1040666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	3568	Open in IMG/M
3300032354\|Ga0325403_1045092	Not Available	3243	Open in IMG/M
3300032354\|Ga0325403_1049292	Not Available	2972	Open in IMG/M
3300032354\|Ga0325403_1051250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2851	Open in IMG/M
3300032354\|Ga0325403_1051278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2850	Open in IMG/M
3300032354\|Ga0325403_1054779	Not Available	2658	Open in IMG/M
3300032354\|Ga0325403_1068476	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2052	Open in IMG/M
3300032354\|Ga0325403_1076861	All Organisms → cellular organisms → Eukaryota	1760	Open in IMG/M
3300032354\|Ga0325403_1099210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1200	Open in IMG/M
3300032354\|Ga0325403_1105736	Not Available	1083	Open in IMG/M
3300032354\|Ga0325403_1126241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	829	Open in IMG/M
3300032355\|Ga0325401_1014871	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	7431	Open in IMG/M
3300032355\|Ga0325401_1079327	Not Available	2051	Open in IMG/M
3300032389\|Ga0325405_1001089	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	27364	Open in IMG/M
3300032389\|Ga0325405_1004131	Not Available	14872	Open in IMG/M
3300032389\|Ga0325405_1004131	Not Available	14872	Open in IMG/M
3300032389\|Ga0325405_1025754	Not Available	4822	Open in IMG/M
3300032389\|Ga0325405_1027838	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	4517	Open in IMG/M
3300032389\|Ga0325405_1050699	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2482	Open in IMG/M
3300032389\|Ga0325405_1076697	Not Available	1351	Open in IMG/M
3300032389\|Ga0325405_1111189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	710	Open in IMG/M
3300032389\|Ga0325405_1123427	Not Available	577	Open in IMG/M
3300032389\|Ga0325405_1127537	Not Available	542	Open in IMG/M
3300032390\|Ga0325404_1004466	Not Available	14872	Open in IMG/M
3300032390\|Ga0325404_1020215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5956	Open in IMG/M
3300032735\|Ga0325410_1011461	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	9220	Open in IMG/M
3300032735\|Ga0325410_1047068	All Organisms → cellular organisms → Eukaryota	2682	Open in IMG/M
3300033179\|Ga0307507_10017617	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8191	Open in IMG/M
3300033179\|Ga0307507_10059741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3566	Open in IMG/M
3300033179\|Ga0307507_10105257	Not Available	2336	Open in IMG/M
3300033179\|Ga0307507_10237444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1198	Open in IMG/M
3300033179\|Ga0307507_10627701	Not Available	549	Open in IMG/M
3300033180\|Ga0307510_10239808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1308	Open in IMG/M
3300033180\|Ga0307510_10267175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1188	Open in IMG/M
3300033180\|Ga0307510_10277407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1148	Open in IMG/M
3300034389\|Ga0325419_036000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3597	Open in IMG/M
3300034389\|Ga0325419_047475	Not Available	2606	Open in IMG/M
3300034389\|Ga0325419_110427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	723	Open in IMG/M
3300034688\|Ga0325420_047768	Not Available	2701	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	75.90%
Wood	Host-Associated → Plants → Wood	22.05%
Phylloplane	Host-Associated → Plants → Phylloplane	2.05%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	75.90%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	22.05%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	2.05%

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_1000352022	3300028786	Ectomycorrhiza	MGKALNGSFVVGLLEFGLIMQISKEIDVVYGQNNR
Ga0307517_100071069	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDVVYCQNSR
Ga0307517_100149375	3300028786	Ectomycorrhiza	MGKALNGSFDVRLLEFVLIMQISEEIDDVYGQNIR
Ga0307517_100155491	3300028786	Ectomycorrhiza	MGKTLNGSFDAGLHEFGLIMQISEGIDVVYGQNSK
Ga0307517_100178999	3300028786	Ectomycorrhiza	MGKSLNGSFDAGLLEFGLIMQISEGINVVYSQNSK
Ga0307517_100195236	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQINEEIDAVYGQNSR
Ga0307517_100249272	3300028786	Ectomycorrhiza	MGKALNGSFNVGLLVFGLIMQISKEIDVVYGQNSR
Ga0307517_1002881210	3300028786	Ectomycorrhiza	MGKALNGSFDVALLEFGLIIQISEEIDVVYGQNSR
Ga0307517_100288125	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVCGQKSR
Ga0307517_100299995	3300028786	Ectomycorrhiza	MGKALNGSFDIGLLEFGLIMQLSEEIDGVYGQNSR
Ga0307517_100336842	3300028786	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQISEEIDAVYGQNSR
Ga0307517_100336844	3300028786	Ectomycorrhiza	MRKALNGSFDVGLLEFGLIMQINEEIDAVYGQNSR
Ga0307517_100355937	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFWMIMQISEGIDVVYDQNSK
Ga0307517_100391332	3300028786	Ectomycorrhiza	MGKALNGSFNVGLLVFGLIMQISEEIGAVYGQNSR
Ga0307517_100420363	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEVIDTVYGQNSKRI
Ga0307517_100423295	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDAVYDQNSR
Ga0307517_100435665	3300028786	Ectomycorrhiza	MRKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSR
Ga0307517_100461974	3300028786	Ectomycorrhiza	MGKALNVSFDVGLLEFGLIMQIREEIDAVYGHNSR
Ga0307517_100497525	3300028786	Ectomycorrhiza	MGKALNGSFDVGLFEFGLIMQISEGIGVVYSQNSK
Ga0307517_100529933	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307517_100578627	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGINVVYGQNSK
Ga0307517_100600021	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIIQISEGIDAIYGQNSR
Ga0307517_100627085	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLVMQIIKRIDVVYYYNNR
Ga0307517_100752044	3300028786	Ectomycorrhiza	VGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSR
Ga0307517_100900042	3300028786	Ectomycorrhiza	MGKALNGSLDAGLLEFGLIMQISEGIDVVYDQKSK
Ga0307517_101014393	3300028786	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQISEEIDVVYDQNSR
Ga0307517_101076652	3300028786	Ectomycorrhiza	MEKTLNGSFDVGLLEFGLIMQISKEIDAVYDQNSR
Ga0307517_101193302	3300028786	Ectomycorrhiza	MGKPLNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307517_101235944	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEAIDVVYSQNSK
Ga0307517_101502631	3300028786	Ectomycorrhiza	MGKAFNGFLDAGLLEFELIMQISEGIDVVYSQNSK
Ga0307517_101682482	3300028786	Ectomycorrhiza	MGKALNGSFDIGLLEFGLIMQISEGVDVVYCQNSR
Ga0307517_101832773	3300028786	Ectomycorrhiza	MGKALNGSFDAGPLEFGLIMQISEGIDVVYGQNSR
Ga0307517_102624282	3300028786	Ectomycorrhiza	MEKALNGSFDAGLLELGLIMQISEGIDVVYSQNSK
Ga0307517_103086611	3300028786	Ectomycorrhiza	MGKTLNGSLDAGLLEFGLIMQISEGIDAVYGHNSN
Ga0307517_103261202	3300028786	Ectomycorrhiza	MEKALNGSFDVELLEFGLIMQINEEIDDVYGQNSR
Ga0307517_103410852	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSRCF
Ga0307517_103560761	3300028786	Ectomycorrhiza	MGKAFNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307517_104838901	3300028786	Ectomycorrhiza	MGKALNGSFNAGLLEFGLIMQISEGINVVYGQNSK
Ga0307517_104892762	3300028786	Ectomycorrhiza	MGKALDGSFDVGLLEFGLIMQISEEIDAIYCQNSRCI
Ga0307517_105116161	3300028786	Ectomycorrhiza	MGKTLNGSFDAGLLEFGLIMQISEEIDAVYSQNSK
Ga0307515_100087529	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLRVQISEEIDVVYCQNSR
Ga0307515_1000885716	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGHNSK
Ga0307515_100155003	3300028794	Ectomycorrhiza	MGKALNGSFNAGLLEFGLIMQISKGINVVYGQNSK
Ga0307515_100406113	3300028794	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSR
Ga0307515_100410733	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDAVYGQNSR
Ga0307515_100425612	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLVMQIIKRIDVVYYHNNR
Ga0307515_100590408	3300028794	Ectomycorrhiza	MGKGLNDSFDVGLLEFGLIMQTSEEIYAVYGQNSR
Ga0307515_100638543	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISKGIDVVYGQNSK
Ga0307515_100684864	3300028794	Ectomycorrhiza	MGKSLNGSFDAGLVEFGLIMQINEGINVVYSQNSK
Ga0307515_100874794	3300028794	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQISKEIDVVYGQNSR
Ga0307515_100889115	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLITQISEEIDAVYGQNSR
Ga0307515_101132763	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDAVYGHNSR
Ga0307515_101320702	3300028794	Ectomycorrhiza	MEKALNGFFDAGLLEFGLIMQISEEIDAVYGQISR
Ga0307515_101390581	3300028794	Ectomycorrhiza	MEKTLNGSFNIALLEFELIMQISEEIDAIYGQNNR
Ga0307515_101417854	3300028794	Ectomycorrhiza	LPTIGNLEMGKALNGYFDVGLLEFGLIMQISKGIDVVYGQKNK
Ga0307515_101475615	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGKNNK
Ga0307515_101940942	3300028794	Ectomycorrhiza	MGKSLNGSFDAGLVEFGLIMQISEGINVVYSQNSK
Ga0307515_102007491	3300028794	Ectomycorrhiza	LNLEMGLEMGKALNGSFDAGLLEFGLIMQISEGIDAVYGQNSR
Ga0307515_102028292	3300028794	Ectomycorrhiza	MGKALNGSFEAGLLEFGLIMQISEGIDAVCGQKSR
Ga0307515_102244551	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSK
Ga0307515_102388732	3300028794	Ectomycorrhiza	MGKALDVSFDVGLLEFGLIMQISEEIDAVYGHNSR
Ga0307515_103762141	3300028794	Ectomycorrhiza	MEKTLNGSFDVRLLVFGLIMQISEEIDVVYGQNSR
Ga0307515_104780072	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSR
Ga0307515_106353751	3300028794	Ectomycorrhiza	LDTGKALNGSFDVGLLEFGLIIQISEEIDVVYGQNK
Ga0307515_107090531	3300028794	Ectomycorrhiza	MGKALNGSFDDGLLEFGLIMQISEGIDVVYGQNSK
Ga0307515_107691672	3300028794	Ectomycorrhiza	MKKALNGSFDVELLEFGLIMQINEEIDAVYGQNSK
Ga0307511_1000754314	3300030521	Ectomycorrhiza	LPTIGNLEMGKALNGYFDVGLLEFGLIMQISKGIDVVYGQNNK
Ga0307511_100187266	3300030521	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIYAVYGQKSR
Ga0307511_100188441	3300030521	Ectomycorrhiza	LDIGKALNGSFDVELLEFGLIMQISEEIDVVYGQNSR
Ga0307511_100366492	3300030521	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDTVYGQNNKSI
Ga0307511_100434271	3300030521	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGHNSK
Ga0307511_100459064	3300030521	Ectomycorrhiza	MRKALNGSFDAGLLEFGLIMQISEGIDAVYGQNNR
Ga0307511_100464783	3300030521	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAIYGQNSR
Ga0307511_100518255	3300030521	Ectomycorrhiza	MEKALNGSFDVGLLEYGLIMQISKEIDVVYGQNSR
Ga0307511_100682015	3300030521	Ectomycorrhiza	MGKAFNGSFHAGLLEFELIMQISEGIDVVYSQNSK
Ga0307511_101235632	3300030521	Ectomycorrhiza	MRKALNGFFDVGLLEFGLIMQISEEIDFVYGQNSR
Ga0307511_101432831	3300030521	Ectomycorrhiza	MGKALNGSFDARLLEFGLIMQISEGIDVVYSQNSK
Ga0307511_101535082	3300030521	Ectomycorrhiza	MGKALNGSFEVGLLEFGLIIQISEEIDAVYGQNSR
Ga0307511_101869122	3300030521	Ectomycorrhiza	MGKALNDSIDAGLLKFGVDMQISEGIDVVYGQNNK
Ga0307511_101880263	3300030521	Ectomycorrhiza	MRKTLNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307512_100110156	3300030522	Ectomycorrhiza	LDTGKALNGSFDVRLLEFVLIMQISEEIDDVYGQNIR
Ga0307512_100360522	3300030522	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDTVYGQNSKSI
Ga0307512_100702401	3300030522	Ectomycorrhiza	LDMEKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSR
Ga0307512_101723761	3300030522	Ectomycorrhiza	MRKALNGSFDVGLLEFGLIMQISEEIDFVYGQNSR
Ga0307512_101798602	3300030522	Ectomycorrhiza	MGKTLNGSFDVRLLVFGLIMQISEEIDVVYGQNSR
Ga0307512_103179962	3300030522	Ectomycorrhiza	MGKALNGYFDVGLLEFGLIMQISKGIDVVYDQNNK
Ga0307512_103230691	3300030522	Ectomycorrhiza	MEKTLNGSFNIALLEFELIMQISEEIDAIYGQNNRXIXTRFXN
Ga0307512_104045821	3300030522	Ectomycorrhiza	MGKALNSYFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307513_1000388913	3300031456	Ectomycorrhiza	MGKALNSSFDVGLLEFGLITQISEEIDAVYGQDSR
Ga0307513_1001178615	3300031456	Ectomycorrhiza	MGKAFNGSFDIGLLEFGLIMQLSEEIDGVYGQNSR
Ga0307513_100466475	3300031456	Ectomycorrhiza	MGKALNGSFDIGLLEFGLIMQLSEEIDVVYGQNSR
Ga0307513_100515481	3300031456	Ectomycorrhiza	NLEMGKALNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307513_100562712	3300031456	Ectomycorrhiza	MEKALNGSFDVGLLEFGLVMQIIKRIDVVYYHNNI
Ga0307513_100636545	3300031456	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISERIDAVYGQNSK
Ga0307513_101173991	3300031456	Ectomycorrhiza	MGKAFNGSFDAGLLEFELIMQISEGIDVVYSQNSK
Ga0307513_101186481	3300031456	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQINEEIDAVYGQNSR
Ga0307513_101818903	3300031456	Ectomycorrhiza	MKKALNGSFDVELLEFGLIMQINEEIDAVYGQNSKXI
Ga0307513_102604883	3300031456	Ectomycorrhiza	MRKALNGSFDAGLLEFGLIMQISEGIDVVYSQNSK
Ga0307513_103217491	3300031456	Ectomycorrhiza	MGKAINGSFNVGLLVFGLIMQISEEIGAVYGQNSR
Ga0307513_103379622	3300031456	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGQKSR
Ga0307513_104114492	3300031456	Ectomycorrhiza	MGKALNGSFDAGLLEFWMIMQISEGIDVVYDHNSK
Ga0307513_104327511	3300031456	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIIQISEGIDAIYGHNSR
Ga0307513_107533491	3300031456	Ectomycorrhiza	MGKTLNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307513_107873962	3300031456	Ectomycorrhiza	MGKALNGYFDVGLLEFGLIMQISKGIDVVYGQKNK
Ga0307513_109016422	3300031456	Ectomycorrhiza	MGKALNDSIDAGLLKFGVDMQISEGIDAVYGQNNK
Ga0307509_100495412	3300031507	Ectomycorrhiza	LPTIGNLEMGKALNGYFDAGLLEFGLIMQISKGIDVVYGQNNK
Ga0307509_101576132	3300031507	Ectomycorrhiza	MEKTLNGSFNIELLEFGLIMQISEEIDVVYGQNNR
Ga0307509_101613512	3300031507	Ectomycorrhiza	MGKTLNGSFDAGLLEFGLIMQISKGIDVVYGQNSK
Ga0307509_102440081	3300031507	Ectomycorrhiza	MGKALNGSFDVELLEFGLIMQISEEIDVVYGQNSR
Ga0307509_102854363	3300031507	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGINAVYGQNSK
Ga0307509_103505621	3300031507	Ectomycorrhiza	MGKTLNGSFDAGLLEFGLIMQISEGIDAVYSQNSK
Ga0307509_103697873	3300031507	Ectomycorrhiza	MGKALNGSFDVGLLEFGLITQISEGIDAIYSQNSR
Ga0307509_105253462	3300031507	Ectomycorrhiza	MRKALNGSFDVRLLEFGLIMQISEEIDDVYGQNIR
Ga0307509_105718962	3300031507	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVIYGQNSR
Ga0307509_108726862	3300031507	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEEIDVVYGQNSR
Ga0307508_102853491	3300031616	Ectomycorrhiza	LNLEMGLEMGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSR
Ga0307508_103163961	3300031616	Ectomycorrhiza	MEKALNDSFDVELLEFGLIMQINEEIDVVYIQNSR
Ga0307508_103968332	3300031616	Ectomycorrhiza	MGKALNGSFDVRLLVFGLIMQISEEIDVVYGQNSR
Ga0307508_106021131	3300031616	Ectomycorrhiza	NWNLEMGKTLNGSFDAGLHEFGLIMQISEGIDVVYGQNSK
Ga0307508_106357923	3300031616	Ectomycorrhiza	MRKALNGSFYVRLLEFGLIMQISEEIDDVYGQNIR
Ga0307514_100517381	3300031649	Ectomycorrhiza	NLNMEKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSR
Ga0307514_100601046	3300031649	Ectomycorrhiza	MGKALNGSFDVGLLEFGLVMQIIKIIDVVYYHNNR
Ga0307514_100842733	3300031649	Ectomycorrhiza	YNWNLEMGKALNGSFDAGLLEFGLIMQISEGIDTVYG
Ga0307514_100870943	3300031649	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYDQNSK
Ga0307514_101065431	3300031649	Ectomycorrhiza	MRKALNGSFDVGLLKFGLIMQINEEIDAVYGQNSR
Ga0307514_101353423	3300031649	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDGVYGQNSR
Ga0307514_101524863	3300031649	Ectomycorrhiza	MGKALNGSFDAGLLEFWMIMQISEGIDVVYGQNSK
Ga0307514_102147721	3300031649	Ectomycorrhiza	DMEKALNGSFDVGLLEFGLIMQISEEIDAVYGQNSR
Ga0307514_102618001	3300031649	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISKGIDVVYGRNSK
Ga0307514_102674532	3300031649	Ectomycorrhiza	MGKALNGSFDVRLLEFGLIMQISEEIDDVYGQNIR
Ga0307514_105600751	3300031649	Ectomycorrhiza	MGKAFNGSFDAGLLEFELIMQISEGIDVVYSQNSKXIXTQI
Ga0307516_100112397	3300031730	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIVQISEEIDVVYCQNSR
Ga0307516_101011361	3300031730	Ectomycorrhiza	NLDMRKALNGSFDVRLLEFGLIIQISEEIDDVYGQNIR
Ga0307516_101203211	3300031730	Ectomycorrhiza	MKKALNGSFDVELLEFGLIMQINEEIDAVYGQNSKXIXTRF
Ga0307516_105285521	3300031730	Ectomycorrhiza	MEKALNGSFDAGLLELGLIMQISERIDTVYSQNSK
Ga0307516_107411603	3300031730	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGKNNK
Ga0307516_108475232	3300031730	Ectomycorrhiza	MGKAFNGFLDAGLLEFELIMQISEGIDVVYIQNSK
Ga0307518_101508172	3300031838	Ectomycorrhiza	MGKALNGSLDTGLLEFGLIMQISEGIDAVYDQKSK
Ga0307518_103959021	3300031838	Ectomycorrhiza	MSCHSTILNGYFDAGLLEFGLIMQISKGIDVVYGQNNK
Ga0307518_106191461	3300031838	Ectomycorrhiza	MGKALNGSIDAGLLKFGVDMQISEGIDAVYGQNNK
Ga0325403_100073815	3300032354	Xylem	MGKALNSSFDAGVLEFGLIMQISEGINVVYGQNSK
Ga0325403_10025352	3300032354	Xylem	MGKALNGFFDARLLEFGLIMQISEGIDVVYGQNNK
Ga0325403_100355717	3300032354	Xylem	MAKPLSGSFDVGLLEFGLIMQIGEEIDVVYSQNSR
Ga0325403_100355813	3300032354	Xylem	MGKAFNGSFDAGLLEFGLIMQINEGIDVVYGQNSR
Ga0325403_100490615	3300032354	Xylem	MGKTLNGSFDAGLLEFRLIMQISEGIDVVYGQNSK
Ga0325403_10058491	3300032354	Xylem	MGKALNGSFDIGLLDFGLIMQISEEIDDVYGQNSR
Ga0325403_100584911	3300032354	Xylem	MGKALNGSFDVGLFEFGLIMQISEEIDDVYGQNSR
Ga0325403_101091311	3300032354	Xylem	MGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNTR
Ga0325403_10122883	3300032354	Xylem	MGKALNGSFDAGLLEFGLIMHISEGINAIYGHNSK
Ga0325403_10123457	3300032354	Xylem	MGKAFNGSFDVGLFEFGLIIQISEEIDDVYDQNSR
Ga0325403_10135744	3300032354	Xylem	MGKALNGSFDAGLLEFGLIMQISEGIDVFYGQNSK
Ga0325403_10162238	3300032354	Xylem	MRKALNGSFDVELLEFGLLMQISEEIDVVYDQNSR
Ga0325403_10210782	3300032354	Xylem	MGKVLNGSFDAGLLEFGLIMQISEGIDVVYGQNSKWI
Ga0325403_10254731	3300032354	Xylem	MGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNNR
Ga0325403_10261981	3300032354	Xylem	MGKALNGSFDIGLLEFGLIMQISEEIDDVYSQNSR
Ga0325403_10405781	3300032354	Xylem	MGKALNGSFEVGLLDFGLIMQISEEIDVVYGQNNR
Ga0325403_10406663	3300032354	Xylem	MGKALNGSFDVGLLKFGLIMQISEEIDVVYGQNSRCI
Ga0325403_10450923	3300032354	Xylem	MGKALNDSLDVGLLEFGLIMQISEEINAVYSQDSR
Ga0325403_10492922	3300032354	Xylem	MGKALNGSFDVGLLEFGLIMQISEEIDVIYCQNSR
Ga0325403_10512502	3300032354	Xylem	MGKALNHSCDAGLLEFGLIMQISEGIDVVYDQNSK
Ga0325403_10512781	3300032354	Xylem	MGKTLNGSFDVGLLEFGLIMQISEEIDVVYCQNSR
Ga0325403_10547791	3300032354	Xylem	MGKALNGSFEVGLLDFGLIMQISEEIDAVYGQNNR
Ga0325403_10684762	3300032354	Xylem	TTLLGLFLLEGKALNGSFDVGLLEFGLVMQVSEGMDVVYYQNSR
Ga0325403_10768612	3300032354	Xylem	LDIEKALNGSFDVGLLEFGLIMQISEEIDAVYCPNSR
Ga0325403_10992103	3300032354	Xylem	MGKAFNGSFDMRLLEFEFVMQISEGIDFVYYQNCRLIRN
Ga0325403_11057362	3300032354	Xylem	MGKALNGSFDAGLLKFELIMQISEGINIVYGQNNK
Ga0325403_11262411	3300032354	Xylem	MGKALNGYFDAGLLEFRLIMQMSEEIDPVYGQNSR
Ga0325401_10148717	3300032355	Xylem	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSKWI
Ga0325401_10793271	3300032355	Xylem	MGKALNGSFDAGLLKFELIMQISEGINIVYGQNSKXIXTRI
Ga0325405_10010893	3300032389	Xylem	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGQNNK
Ga0325405_100413114	3300032389	Xylem	LKLGHEKSLNGSFDAGLLDFGLIMQISEEIDVVYGQNTR
Ga0325405_10041313	3300032389	Xylem	MGKALNGSFDAGLLEFGLIMQISEEIDVVYGQNTR
Ga0325405_10257543	3300032389	Xylem	MGKALNGSFDAGVLEFGLIMQISEGIDVVHGQNSK
Ga0325405_10278382	3300032389	Xylem	MGKALNGSFDAGLLEFGLIMQISKGIDAIYSQNSR
Ga0325405_10506992	3300032389	Xylem	LLGLFLLEGKALNGFFDVGLLEFGLVMQVSEGMDVVYYQNSR
Ga0325405_10766973	3300032389	Xylem	MGKALNDSFDVGLLEFGLIIQISEEIKVVYGQDIR
Ga0325405_11111891	3300032389	Xylem	MGKALNGSFDARLLEFGLIMQISEGIDAVYGQNNK
Ga0325405_11234272	3300032389	Xylem	MEKALNGSFDVGLLEFGLIIQISEEIDAVYCPNSR
Ga0325405_11275372	3300032389	Xylem	LLGLFLLEGKALNGSFDVGLLEFGLVMQVSEGMDVVYYQNSR
Ga0325404_10044665	3300032390	Xylem	LLKLKLGHEKSLNGSFDAGLLDFGLIMQISEEIDVVYGQNTR
Ga0325404_10202155	3300032390	Xylem	LNIGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNNR
Ga0325410_101146110	3300032735	Xylem	MGKALNSSFDVGLLEFGLIMQISEGIDAIYGQNSR
Ga0325410_10470683	3300032735	Xylem	LLGLFLLEGKALNGSFDVGLLEFGLVIQVSEGMDVVYYQNSR
Ga0307507_100176178	3300033179	Ectomycorrhiza	MGKALNGSFNVGLLVFGLIMQISEEIGVVYGQNSR
Ga0307507_100597413	3300033179	Ectomycorrhiza	MGKALNGSLDTGLLEFGLIMQISEGIDVVYDQKSK
Ga0307507_101052572	3300033179	Ectomycorrhiza	MEKTLNGSFNIELLEFGLIMQISKEIDAVYGQNNR
Ga0307507_102374441	3300033179	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEAIDVVYSQNSKXI
Ga0307507_106277011	3300033179	Ectomycorrhiza	EMGKAFNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307510_102398082	3300033180	Ectomycorrhiza	MGKALNGSFDVELFEFGLIMQISEGIGVVYSQNSK
Ga0307510_102671753	3300033180	Ectomycorrhiza	MGKALNGYFDAGLLEFGLIMQISKGIDVVYGQNNK
Ga0307510_102774071	3300033180	Ectomycorrhiza	MGKALNGYFDVGLLEFGLIMQISKGIDVVYGQNNK
Ga0325419_036000_315_422	3300034389	Leaf	MGKALNGSFDAGLLKFELIMQISEGINIVYGQNSK
Ga0325419_047475_1144_1251	3300034389	Leaf	MEKALNDSFDVGLLEFGLIIQISEEINVVYGQDIR
Ga0325419_110427_57_164	3300034389	Leaf	MGKALNSSFDAGLLKFELIMQISEGINIVYGQNNK
Ga0325420_047768_2293_2400	3300034688	Leaf	MGKAFNGSFNVGLLEFGLIMQISEEIDVIYCQNSK

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F027067

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M
3300034688	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign