NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F027195

Metagenome Family F027195

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027195
Family Type Metagenome
Number of Sequences 195
Average Sequence Length 49 residues
Representative Sequence VNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRM
Number of Associated Samples 162
Number of Associated Scaffolds 195

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.44 %
% of genes near scaffold ends (potentially truncated) 98.46 %
% of genes from short scaffolds (< 2000 bps) 91.79 %
Associated GOLD sequencing projects 150
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.769 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(8.718 % of family members)
Environment Ontology (ENVO) Unclassified
(38.974 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.462 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.37%    β-sheet: 0.00%    Coil/Unstructured: 77.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 195 Family Scaffolds
PF00248Aldo_ket_red 71.28
PF04879Molybdop_Fe4S4 10.77
PF00384Molybdopterin 1.03
PF01734Patatin 0.51
PF00226DnaJ 0.51
PF00490ALAD 0.51
PF00717Peptidase_S24 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 195 Family Scaffolds
COG0113Delta-aminolevulinic acid dehydratase, porphobilinogen synthaseCoenzyme transport and metabolism [H] 0.51
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.51
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.51
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.77 %
UnclassifiedrootN/A29.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2046860007|LWAeNNiSIP_GDP3C2T02GECEUNot Available509Open in IMG/M
2088090013|LWAnNN_GDP3C2T02GECEUNot Available509Open in IMG/M
2170459019|G14TP7Y02HBG81All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium653Open in IMG/M
3300000881|JGI10215J12807_1487417Not Available817Open in IMG/M
3300001213|JGIcombinedJ13530_102943831All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium577Open in IMG/M
3300001213|JGIcombinedJ13530_103636456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium545Open in IMG/M
3300001976|JGI24752J21851_1003629All Organisms → cellular organisms → Bacteria → Proteobacteria2034Open in IMG/M
3300001979|JGI24740J21852_10176455All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium530Open in IMG/M
3300004153|Ga0063455_101245289All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium562Open in IMG/M
3300004480|Ga0062592_101116599All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300004633|Ga0066395_10862124All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae546Open in IMG/M
3300004643|Ga0062591_102930009All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005180|Ga0066685_10396181Not Available959Open in IMG/M
3300005329|Ga0070683_101511952All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium645Open in IMG/M
3300005332|Ga0066388_107014841All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium567Open in IMG/M
3300005334|Ga0068869_100670252Not Available882Open in IMG/M
3300005335|Ga0070666_10779535All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300005337|Ga0070682_100327979All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1133Open in IMG/M
3300005337|Ga0070682_101233874All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300005339|Ga0070660_101147392All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005353|Ga0070669_101691234All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium551Open in IMG/M
3300005355|Ga0070671_100013921All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6490Open in IMG/M
3300005355|Ga0070671_101720451All Organisms → cellular organisms → Bacteria → Proteobacteria557Open in IMG/M
3300005440|Ga0070705_101637617All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005444|Ga0070694_100687052All Organisms → cellular organisms → Bacteria → Proteobacteria831Open in IMG/M
3300005455|Ga0070663_101889833All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium536Open in IMG/M
3300005542|Ga0070732_10034665All Organisms → cellular organisms → Bacteria → Proteobacteria2885Open in IMG/M
3300005543|Ga0070672_101680496All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium570Open in IMG/M
3300005548|Ga0070665_102495545All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium518Open in IMG/M
3300005563|Ga0068855_100842957All Organisms → cellular organisms → Bacteria → Proteobacteria972Open in IMG/M
3300005569|Ga0066705_10529363All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium734Open in IMG/M
3300005578|Ga0068854_101210504All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium677Open in IMG/M
3300005578|Ga0068854_101510722All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300005718|Ga0068866_10665658Not Available710Open in IMG/M
3300005719|Ga0068861_100076007All Organisms → cellular organisms → Bacteria → Proteobacteria2616Open in IMG/M
3300005841|Ga0068863_102455372All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006032|Ga0066696_10807192All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium599Open in IMG/M
3300006046|Ga0066652_101266262All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300006047|Ga0075024_100581749All Organisms → cellular organisms → Bacteria → Proteobacteria599Open in IMG/M
3300006057|Ga0075026_100532155All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium681Open in IMG/M
3300006354|Ga0075021_10283546Not Available1024Open in IMG/M
3300006797|Ga0066659_10070568All Organisms → cellular organisms → Bacteria → Proteobacteria2284Open in IMG/M
3300006797|Ga0066659_10785459All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300006904|Ga0075424_101652847All Organisms → cellular organisms → Bacteria → Proteobacteria679Open in IMG/M
3300006904|Ga0075424_101893929All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium630Open in IMG/M
3300006954|Ga0079219_11013639All Organisms → cellular organisms → Bacteria → Proteobacteria690Open in IMG/M
3300009093|Ga0105240_12749489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium507Open in IMG/M
3300009131|Ga0115027_11027642All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium647Open in IMG/M
3300009148|Ga0105243_12061044All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium606Open in IMG/M
3300009167|Ga0113563_11523554All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300009167|Ga0113563_12254980All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300009873|Ga0131077_10199053All Organisms → cellular organisms → Bacteria → Proteobacteria2133Open in IMG/M
3300010361|Ga0126378_12866946All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium550Open in IMG/M
3300010361|Ga0126378_12951650All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium542Open in IMG/M
3300010396|Ga0134126_10719940All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1133Open in IMG/M
3300010396|Ga0134126_12434544All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium570Open in IMG/M
3300010400|Ga0134122_10952969Not Available836Open in IMG/M
3300010401|Ga0134121_11824809All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium635Open in IMG/M
3300010401|Ga0134121_12793037All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium534Open in IMG/M
3300011438|Ga0137451_1267310All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium538Open in IMG/M
3300012350|Ga0137372_11137487All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300012892|Ga0157294_10283217All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium523Open in IMG/M
3300012896|Ga0157303_10187845All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium586Open in IMG/M
3300012911|Ga0157301_10061717Not Available1000Open in IMG/M
3300012924|Ga0137413_10654781All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium792Open in IMG/M
3300012924|Ga0137413_11319568All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium580Open in IMG/M
3300012925|Ga0137419_10812341All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium765Open in IMG/M
3300012960|Ga0164301_10859977All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium700Open in IMG/M
3300012985|Ga0164308_10845771Not Available801Open in IMG/M
3300012988|Ga0164306_11028672All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium680Open in IMG/M
3300013296|Ga0157374_10234880All Organisms → cellular organisms → Bacteria → Proteobacteria1802Open in IMG/M
3300013296|Ga0157374_10724124Not Available1009Open in IMG/M
3300013297|Ga0157378_11953343All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium636Open in IMG/M
3300013297|Ga0157378_12673299All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium552Open in IMG/M
3300013307|Ga0157372_11772743All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300013308|Ga0157375_10960177Not Available996Open in IMG/M
3300014303|Ga0075358_1128543All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium529Open in IMG/M
3300014325|Ga0163163_11867345All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium661Open in IMG/M
3300014968|Ga0157379_12061456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium565Open in IMG/M
3300014969|Ga0157376_12916529All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium518Open in IMG/M
3300015259|Ga0180085_1121368All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300015371|Ga0132258_10186869All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5014Open in IMG/M
3300015371|Ga0132258_13414253Not Available1090Open in IMG/M
3300015374|Ga0132255_104830772All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium571Open in IMG/M
3300015374|Ga0132255_105064587Not Available558Open in IMG/M
3300016357|Ga0182032_10626547All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium897Open in IMG/M
3300017792|Ga0163161_11879932All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium533Open in IMG/M
3300017965|Ga0190266_10777622All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium611Open in IMG/M
3300018422|Ga0190265_11517800Not Available783Open in IMG/M
3300018476|Ga0190274_11659441Not Available733Open in IMG/M
3300018481|Ga0190271_12166808All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium663Open in IMG/M
3300019362|Ga0173479_10115069Not Available1021Open in IMG/M
3300019883|Ga0193725_1050842All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1060Open in IMG/M
3300020061|Ga0193716_1206263Not Available743Open in IMG/M
3300020062|Ga0193724_1102968All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium577Open in IMG/M
3300021445|Ga0182009_10024065All Organisms → cellular organisms → Bacteria2351Open in IMG/M
3300024056|Ga0124853_1143879Not Available2129Open in IMG/M
3300025903|Ga0207680_11133164All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium559Open in IMG/M
3300025906|Ga0207699_10752541All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300025913|Ga0207695_10771146All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium842Open in IMG/M
3300025917|Ga0207660_11390358All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium569Open in IMG/M
3300025923|Ga0207681_11542223All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium557Open in IMG/M
3300025931|Ga0207644_10013606All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5430Open in IMG/M
3300025935|Ga0207709_11870494All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium500Open in IMG/M
3300025936|Ga0207670_10277283All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1305Open in IMG/M
3300025936|Ga0207670_11830998All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium516Open in IMG/M
3300025937|Ga0207669_11569747All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium562Open in IMG/M
3300025940|Ga0207691_10138226All Organisms → cellular organisms → Bacteria → Proteobacteria2148Open in IMG/M
3300025940|Ga0207691_10430723Not Available1123Open in IMG/M
3300025944|Ga0207661_11851613Not Available549Open in IMG/M
3300025945|Ga0207679_11369954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium649Open in IMG/M
3300025960|Ga0207651_11136233Not Available700Open in IMG/M
3300025972|Ga0207668_10762304Not Available854Open in IMG/M
3300026023|Ga0207677_10798303Not Available845Open in IMG/M
3300026095|Ga0207676_10764793Not Available940Open in IMG/M
3300026118|Ga0207675_101713618All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium648Open in IMG/M
3300026142|Ga0207698_11267147Not Available752Open in IMG/M
3300026142|Ga0207698_11268832Not Available751Open in IMG/M
3300026320|Ga0209131_1401431All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium513Open in IMG/M
3300027310|Ga0207983_1035339All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300027841|Ga0209262_10132054Not Available1189Open in IMG/M
3300027873|Ga0209814_10558869All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium509Open in IMG/M
3300027877|Ga0209293_10749079All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium518Open in IMG/M
3300027886|Ga0209486_11066350Not Available547Open in IMG/M
3300027890|Ga0209496_10535343All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium626Open in IMG/M
3300027894|Ga0209068_10624586All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium628Open in IMG/M
3300028379|Ga0268266_11089668Not Available773Open in IMG/M
3300028379|Ga0268266_11913087All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium567Open in IMG/M
3300028381|Ga0268264_11734085All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium635Open in IMG/M
3300028381|Ga0268264_12345730All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium540Open in IMG/M
3300028739|Ga0302205_10187579All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium530Open in IMG/M
3300028741|Ga0302256_10225555All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium516Open in IMG/M
3300028809|Ga0247824_10437160Not Available762Open in IMG/M
3300028828|Ga0307312_10940270All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium573Open in IMG/M
3300028861|Ga0302259_1049089Not Available995Open in IMG/M
3300028861|Ga0302259_1192125All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium513Open in IMG/M
3300028865|Ga0302291_10119724Not Available882Open in IMG/M
3300028865|Ga0302291_10167859Not Available745Open in IMG/M
3300028869|Ga0302263_10101817Not Available1141Open in IMG/M
3300029923|Ga0311347_10540214Not Available709Open in IMG/M
3300030000|Ga0311337_10350630Not Available1242Open in IMG/M
3300030000|Ga0311337_11978038All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium512Open in IMG/M
3300030003|Ga0302172_10125697Not Available790Open in IMG/M
3300030048|Ga0302273_1180115All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium618Open in IMG/M
3300030050|Ga0302255_1024987Not Available1140Open in IMG/M
3300030838|Ga0311335_11407490All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium503Open in IMG/M
3300030943|Ga0311366_10224143All Organisms → cellular organisms → Bacteria → Proteobacteria1625Open in IMG/M
3300031251|Ga0265327_10027370All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3284Open in IMG/M
3300031521|Ga0311364_11324944Not Available713Open in IMG/M
3300031521|Ga0311364_12126643All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium549Open in IMG/M
3300031561|Ga0318528_10006394All Organisms → cellular organisms → Bacteria → Proteobacteria5154Open in IMG/M
3300031722|Ga0311351_10713936Not Available764Open in IMG/M
3300031731|Ga0307405_12072807All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium510Open in IMG/M
3300031778|Ga0318498_10244179All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium810Open in IMG/M
3300031821|Ga0318567_10507409Not Available685Open in IMG/M
3300031854|Ga0310904_10468350Not Available839Open in IMG/M
3300031901|Ga0307406_11683631All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium562Open in IMG/M
3300031938|Ga0308175_100324568All Organisms → cellular organisms → Bacteria → Proteobacteria1580Open in IMG/M
3300031938|Ga0308175_102180619All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300031938|Ga0308175_102421227All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium588Open in IMG/M
3300031939|Ga0308174_11073340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium684Open in IMG/M
3300031947|Ga0310909_10514334All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1003Open in IMG/M
3300031995|Ga0307409_100129849All Organisms → cellular organisms → Bacteria → Proteobacteria2151Open in IMG/M
3300032004|Ga0307414_10276090All Organisms → cellular organisms → Bacteria → Proteobacteria1410Open in IMG/M
3300032008|Ga0318562_10530569Not Available682Open in IMG/M
3300032008|Ga0318562_10567127Not Available656Open in IMG/M
3300032012|Ga0310902_11235413All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium527Open in IMG/M
3300032013|Ga0310906_10185743All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1248Open in IMG/M
3300032067|Ga0318524_10025715All Organisms → cellular organisms → Bacteria2679Open in IMG/M
3300032075|Ga0310890_10872238Not Available717Open in IMG/M
3300032089|Ga0318525_10352578Not Available755Open in IMG/M
3300032122|Ga0310895_10753748All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium510Open in IMG/M
3300032126|Ga0307415_101509203All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium643Open in IMG/M
3300032143|Ga0315292_10271686All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300032143|Ga0315292_10962899Not Available710Open in IMG/M
3300032177|Ga0315276_10426178All Organisms → cellular organisms → Bacteria1422Open in IMG/M
3300032180|Ga0307471_101088224Not Available965Open in IMG/M
3300032211|Ga0310896_10830801All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium531Open in IMG/M
3300032256|Ga0315271_10192164All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1629Open in IMG/M
3300032256|Ga0315271_11320867All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium623Open in IMG/M
3300032954|Ga0335083_11128584All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium611Open in IMG/M
3300032954|Ga0335083_11496984All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium512Open in IMG/M
3300033004|Ga0335084_11018652Not Available833Open in IMG/M
3300033004|Ga0335084_11270439Not Available734Open in IMG/M
3300033413|Ga0316603_11078556Not Available759Open in IMG/M
3300033413|Ga0316603_11205103All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300033414|Ga0316619_10541378Not Available957Open in IMG/M
3300033418|Ga0316625_100154806All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300033482|Ga0316627_100834258Not Available875Open in IMG/M
3300033483|Ga0316629_10645173Not Available794Open in IMG/M
3300033485|Ga0316626_11523303Not Available602Open in IMG/M
3300033488|Ga0316621_10883778All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300033550|Ga0247829_10038994All Organisms → cellular organisms → Bacteria → Proteobacteria3251Open in IMG/M
3300033550|Ga0247829_10150591All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300034169|Ga0370480_0341460Not Available503Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.08%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.56%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.05%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.05%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.54%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.54%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment1.03%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.03%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.03%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.03%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.03%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.51%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.51%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.51%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.51%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.51%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.51%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.51%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.51%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2046860007Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - Microc enrich af exp to meth lab w 13Ccarbon-no added nitrateEnvironmentalOpen in IMG/M
2088090013Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13Cmethane anaerobic no nitrateEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014303Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027310Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3EnvironmentalOpen in IMG/M
3300028741Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028861Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4EnvironmentalOpen in IMG/M
3300028865Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030048Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3EnvironmentalOpen in IMG/M
3300030050Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034169Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LWAeNNiSIP_39960302046860007Freshwater SedimentVSYTAVSYTFYDYLELPQDATPARVEAAYVGLLERFGYGTTDAGQDMSNRVAMIHAAYNVLANP
LWAnNN_011251302088090013Freshwater SedimentVSYTAVSYTFYDYLELPQDATPARVEAAYVGLLERFGYGTTDAGQDMSNRVAMIHAAYNVLAN
4MG_028171402170459019Switchgrass, Maize And Mischanthus LitterVTYTYYDYLEIPPTASASRIDAAYGVLLQRFGYGTTDAGQDMSGLVQMIHTAHDV
JGI10215J12807_148741713300000881SoilVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMTDAGQDLSGLVR
JGIcombinedJ13530_10294383123300001213WetlandVTYTHYDFLDLAPGASPARIEAAYAAVLERFQFGATDAGQDLSGLVRMIHAAYEVLSD
JGIcombinedJ13530_10363645613300001213WetlandVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLV
JGI24752J21851_100362933300001976Corn, Switchgrass And Miscanthus RhizosphereVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMT
JGI24740J21852_1017645513300001979Corn RhizosphereMVNYTHYDYLELAPGASAQRVEAAYCALLERFQYGHTD
Ga0063455_10124528913300004153SoilMKVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMTDA
Ga0062592_10111659913300004480SoilVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGATEAGQDLTGLVRMIHAAYEVLSRPD
Ga0066395_1086212413300004633Tropical Forest SoilVIYTYYDYLELPPTASASRIDAAYGVLLQRFGYGTTDSGQDMSGLVQMIQTAYDVLSDRE
Ga0062591_10293000923300004643SoilVSYTFYDYLDLAPGATATQIEASYIALLERFGYGVTDAGQDMSGLIRMIHSAYEVLSNFETRQR
Ga0066685_1039618123300005180SoilVNYTHYDYLDIAPGADSTRIEKAYLALIEKLQYGESDAGQDLSGLVRRIH
Ga0070683_10151195213300005329Corn RhizosphereVNYTHYDYLDLAPGASAARIEAAYAAVLERFQYGMTDAGQ
Ga0066388_10701484123300005332Tropical Forest SoilVNYTHYAYLDLAPGASAARIEAAYAQLLERFGYGVTEAGQDLGGLVRMIHAAY
Ga0068869_10067025213300005334Miscanthus RhizosphereMIDEPDRSVIVNYTHYDYLELAPGASRARIEAAYAALLERFSYGTTDAGQDLSGLVRMIH
Ga0070666_1077953513300005335Switchgrass RhizosphereVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTEAGQDLSGLVRMIHAAYEVL
Ga0070682_10032797913300005337Corn RhizosphereVNYTHYDYLELAPGASAQRVEAAYCALLERFQYGHTDAGQDLSGLVRMIHAAY
Ga0070682_10123387423300005337Corn RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGATEAGQDLAGLVRMIHAAYEVLSTP
Ga0070660_10114739213300005339Corn RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGATEAGQDLAGLVRMIHAAYVAPY
Ga0070669_10169123423300005353Switchgrass RhizosphereVSYTFYDYLDLAPGVSAAQIEARYVSLLERFGYGVTDAGQDMSGLIRMIHSAYEVLANAE
Ga0070671_10001392163300005355Switchgrass RhizosphereVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTEAGQDLSGLVRMI
Ga0070671_10172045113300005355Switchgrass RhizosphereVNYTHYDYLELAPGASRARVETAYASLLERFQYGSTDAGQDLSGLVRMIHAAYDILS
Ga0070705_10163761723300005440Corn, Switchgrass And Miscanthus RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGAGDADQDLSGLIRMIHAA
Ga0070694_10068705213300005444Corn, Switchgrass And Miscanthus RhizosphereVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMTDAGQDLSGLVRMIHAAYAVLSD
Ga0070663_10188983323300005455Corn RhizosphereVNYTHYDYLELAPGASTQRIEAAYCALLERFEYGHTEAGQDLSGLVR
Ga0070732_1003466533300005542Surface SoilVNYTHYDYLELAPGATSRRIEAAYCALLERFQYGHTDA
Ga0070672_10168049623300005543Miscanthus RhizosphereVNYTHYDFLEIAPGADSARIETAYVALLERMSYGASESGQDLSG
Ga0070665_10249554513300005548Switchgrass RhizosphereVNYTHYDFLDLAPGAPSARIEAAYAHVMERFQYGGVTD
Ga0068855_10084295713300005563Corn RhizosphereMIDEPDRSVIVNYTHYDYLELAPGASRARIEAAYAALLERFSYGTTDAGQDLSGLVRMIHAAYEVLSDP
Ga0066705_1052936323300005569SoilVNYTHYDYLDIAPGAEPARIETAYLSLIEKLQYGASDTGQDLSGLVRRIHTAYEVL
Ga0068854_10121050413300005578Corn RhizosphereLNYTHYDYLELAPGASKQRIEAAYCALLERFQYGHT
Ga0068854_10151072213300005578Corn RhizosphereMVNYTHYDYLELAPGASTQRIEAAYCALLERFQYGHTEAGQDLSGLVRMIHAAYAVL
Ga0068866_1066565823300005718Miscanthus RhizosphereVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTEAGQDLSGLVRMIHAAYEVLSHPE
Ga0068861_10007600713300005719Switchgrass RhizosphereVNYTHYDFLDLAPGAPSARIEAAYAHVMERFQYGGVTDAGQDLSGLVR
Ga0068863_10245537223300005841Switchgrass RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLDRFQYGATDSGQDLSGLVRM
Ga0066696_1080719213300006032SoilVNYTHYDYLDIAPGADSARIETAYLALIEKLQYGESDAGQDLSGLV
Ga0066652_10126626223300006046SoilVNYTHYDYLDIAPVADSKRIEIAYLALIEKLQYGESD
Ga0075024_10058174913300006047WatershedsVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRMIHAAYEVLSHPELRR
Ga0075026_10053215513300006057WatershedsVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRMIHAA
Ga0075021_1028354623300006354WatershedsVDYTHYDYLDLAPGASTARIETAYAQLLERFGYGTTDEGQDLSGLVRMVHAAYEV
Ga0066659_1007056833300006797SoilVNYTHYDYLDIAPGADSARIEVAYLALIEKLQYGQSDAGQDLSG
Ga0066659_1078545923300006797SoilVNYTHYDFLDIAPGAVPARIETAYLALIEKLQYGATDAGQDLSGLVR
Ga0075424_10165284723300006904Populus RhizosphereVNYTHYDFLEIAPGADSTRIEAAYVALLERMSFGASESGQDLSGLVRRIHAAYDVLSDP
Ga0075424_10189392923300006904Populus RhizosphereLNYTHYDYLELAPGASAARIEAAYAALLERFQYGMTDAG
Ga0079219_1101363923300006954Agricultural SoilVNYTHYDYLDIAPGADPARIETAYLALIEKLQYGSTDAG*
Ga0105240_1274948923300009093Corn RhizosphereVNYTHYDYLELAPGASPQRIEAAYCALLERFEYGHTEAGQDLSGLV
Ga0115027_1102764213300009131WetlandVTYTYYDYLDLAPGASRARIEAAYASVLERFGYGATESGQDLSGLVRMIHAAYEVLSNPDARDRYDAQLAR
Ga0105243_1206104413300009148Miscanthus RhizosphereMHVNYTHYDFLEIAPGADSARIETAYVALLERMSYGASES
Ga0113563_1152355423300009167Freshwater WetlandsMESVVNYTYYDYLELAPGASPARIEAAYAHLLERFGYRDTESG
Ga0113563_1225498023300009167Freshwater WetlandsVYTYYDYLELPPGASPAMVEAAYGQLLQRFGYGTTDAGQDMSGLVRMIHAAYDVLSNAES
Ga0131077_1019905333300009873WastewaterVNYTHYDYLDLAPGASAARIETAYAAVLERFQYGATDAGQDLSGLV
Ga0126378_1286694623300010361Tropical Forest SoilVSYTFYDYLDLPPGATATQIEASYVALLERFGYGTTDAGQDMSGLIRMIHSAYEVLSNAE
Ga0126378_1295165023300010361Tropical Forest SoilMAVNYTHYDYLELAPGASRARIEAAYLSLLERFQQGTTDAGQDLSGLVRM
Ga0134126_1071994023300010396Terrestrial SoilVNYTHYDYLELPPGAAPARIEAAYAHLTERFECDTRASGEDLSGLVRLIHAA
Ga0134126_1243454413300010396Terrestrial SoilLNYTHYDYLELAPGASKQRIEAAYCALLERFQYGHTEAGQ
Ga0134122_1095296913300010400Terrestrial SoilVTYTHYDYLDLAPGASPARIEAAYAAMLERFQYGAGDAD
Ga0134121_1182480923300010401Terrestrial SoilVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGAGDADQ
Ga0134121_1279303713300010401Terrestrial SoilVTYTHYDYLDLAPGASPARIEAAYAAVLDRFQYGATDSGQDLSGL
Ga0137451_126731013300011438SoilVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGAGDADQDLSGLVRMIHAAYEV
Ga0137372_1113748723300012350Vadose Zone SoilVSYTYYDYLELAPGAPPARIETAYAQILERFGYGVTE
Ga0157294_1028321723300012892SoilMKVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMTDAGQDLSGLVRMIHAAYAVLS
Ga0157303_1018784513300012896SoilVNYTHYDYLDLAPGASTARIEAAYAQVLQRFQFGRTDAGQDLSGLVRMIH
Ga0157301_1006171713300012911SoilMKVNYTHYDYLELAPGATSNRIEAAYAALLERFQYG
Ga0137413_1065478123300012924Vadose Zone SoilVNYTHYDYLEIPPCADDVRIEAAYLKLVERLQYGSTDAGQDLSGLVRR
Ga0137413_1131956813300012924Vadose Zone SoilVNYTHYDYLDIAPGADSVRIEIAYLALIEKLQYGQSDA
Ga0137419_1081234113300012925Vadose Zone SoilVNYTHYDYLEIPPCADDVRIEAAYLKLVERLQYGSTDAGQDLSG
Ga0164301_1085997713300012960SoilLVNYTHYDYLELAPGATSRRIEAAYCALLERFQYGHTDAGQDLSGLVRMIHA
Ga0164308_1084577123300012985SoilMKVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMTDAGQDLSGLVRMIHAAY
Ga0164306_1102867213300012988SoilLVNYTHYDYLELAPGATSRRIEAAYCALLERFQYGHTDAGQDLSGLVRM
Ga0157374_1023488013300013296Miscanthus RhizosphereMKVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMT
Ga0157374_1072412423300013296Miscanthus RhizosphereMKVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMTDAGQDLSGLVRM
Ga0157378_1195334313300013297Miscanthus RhizosphereMMVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGTTEA
Ga0157378_1267329923300013297Miscanthus RhizosphereVTYTHYDYLDLAPGSSTARIEAAYAAVLERFQFGATEAGQDLTGLVRMIHAAYEVLSSPE
Ga0157372_1177274323300013307Corn RhizosphereMVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGITDAGQDLSGLVRMIHS
Ga0157375_1096017723300013308Miscanthus RhizosphereMTVNYTHYDFLDLAPGAPSARIEAAYAHVMERFQYGGVTDAGQDLSGLVRLI
Ga0075358_112854313300014303Natural And Restored WetlandsMTYTYYDYLELAPGASRARIEAAYAHVLERFGYGMTDAGQDMSGLVRQIHAAYEVLSNP
Ga0163163_1186734513300014325Switchgrass RhizosphereLKPNQLSEEPAVSYTYYDYLDLSPCADLARIEAAYVAVLERFGYGTTDAGQDMSGLLRM
Ga0157379_1206145613300014968Switchgrass RhizosphereMNYTHYDYLELAPGSPTGRIEAAYAQLLERFQYGMTDAGQDLS
Ga0157376_1291652923300014969Miscanthus RhizosphereMNYTHYDYLELAPGSPTGRIEAAYAQLLERFQYGMTDAGQDLSGLVRLIHAAHDVLSNPDTCRAY
Ga0180085_112136823300015259SoilVYTYYDYLELPPGASPAMVEAAYGQLLQRFGYGTTDAGQDMSGLVRMIHAAYDVLSNAESRRR
Ga0132258_1018686913300015371Arabidopsis RhizosphereVNYTHYDYLDLAPGASAARIEAAYAQLLERFGYGVTEAGQDLGGLVRMIH
Ga0132258_1341425323300015371Arabidopsis RhizosphereVTYTYYDYLDLAPGASPARIEAAYAAVLERFQYGATEAG
Ga0132255_10483077213300015374Arabidopsis RhizosphereMHVNYTHYDFLEIAPGADSARVEAAYVALLERMSYGASESGQDLS
Ga0132255_10506458723300015374Arabidopsis RhizosphereVSYTYYDYLEVAPGAPLARINAAYASILERFGYGVADSGQDLSNLVRLIHAAYDV
Ga0182032_1062654723300016357SoilVNYTHYDYLELAPGASRARIEAAYLSLLERFQQGTTDAGQDLSGLVRMIHAAYEVLSNPE
Ga0163161_1187993213300017792Switchgrass RhizosphereVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRMIHAAYEVL
Ga0190266_1077762223300017965SoilVNYTHYDFLDLAPGAPSARIEAAYAQVMERFQYGGVTEAGQDLSGLVRLIHAAYEVLSNAGTRRAYDAKLAAD
Ga0190265_1151780013300018422SoilVIYTHYDYLEIAPGVPRERIEAAYARVLERFNYGVSPN
Ga0190274_1165944113300018476SoilMKVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMTDAG
Ga0190271_1216680813300018481SoilMRQEMPVTYTHYDYLDLAPGASTARIEAAYAAVLERFDYGDAGNGQDLSGL
Ga0173479_1011506923300019362SoilVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGMTDAGQDLSGL
Ga0193725_105084213300019883SoilVNYTHYDFLDLAPGADSERVEAAYVATLERMQYGASDAGQDLSGLVRRIHAAYDVLSDPCKRTA
Ga0193716_120626323300020061SoilVTYTYYDYLELPPGASPVRIEAAYAQIIERFDYGTSESGQDLSGLVRLI
Ga0193724_110296813300020062SoilVNYTHYDYLDIAPGADSVRIEIAYLALIEKLQYGQSDAGQDLSGLVRRI
Ga0182009_1002406513300021445SoilVNYTHYDYLELAPGASRARVEAAYASLLERFQYGSTDAGQDL
Ga0124853_114387943300024056Freshwater WetlandsVIYTHYDYLELAPGAPRERIEAAYARVLERFNYGLTPAGQDLSGLVRMVHAAVRGPVRP
Ga0207680_1113316423300025903Switchgrass RhizosphereVNYTHYDYLELAPGATSNRIEAAYAALLERFQYGITD
Ga0207699_1075254113300025906Corn, Switchgrass And Miscanthus RhizosphereVLNYTHYDYLELAPGAAPARIEAAYMALLERFQYGTTDAGQDLSGLVRMIHAA
Ga0207695_1077114613300025913Corn RhizosphereVNYTHYDYLELAPGASTQRIEAAYCALLERFQYGHTEAGQDLSGLVRMIHAAY
Ga0207660_1139035823300025917Corn RhizosphereVNYTHYDYLDLAPGASAARIEAAYAAVLERFQYGMTDAGQDLSGLVRMIHAAY
Ga0207681_1154222313300025923Switchgrass RhizosphereVNYTHYDYLDLAPGASTARIEAAYAQVLQRFQFGRTDAGQDLSGLVRMIHSAYRVLSDPDARTSR
Ga0207644_1001360653300025931Switchgrass RhizosphereVNYTHYDFLEIAPGADSARIETAYVALLERMSYGASESGQDLSGLVRRIHAA
Ga0207709_1187049413300025935Miscanthus RhizosphereVNYTHYDYLDLAPGASTARIEAAYAQVLQRFQFGRTDAGQDLSGLVRMIHSA
Ga0207670_1027728313300025936Switchgrass RhizosphereVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTEAGQDLSGLVRMIH
Ga0207670_1183099813300025936Switchgrass RhizosphereVTYTHYDYLDLAPGSSTARIEAAYAAVLERFQYGATEAGQDLTGLVRMIHAAYEVLSRP
Ga0207669_1156974723300025937Miscanthus RhizosphereVNYTHYDFLEIAPGADSARVEAAYVALLERMSFGASESGQDLSGLVRRIHAAY
Ga0207691_1013822613300025940Miscanthus RhizosphereVTYTHYDYLDLAPGSSTARIEAAYAAVLERFQYGATEAGQDLTGL
Ga0207691_1043072313300025940Miscanthus RhizosphereVTYTHYDYLDLAPGASTARIEAAYAAVLERFDYGDAGNGQDL
Ga0207661_1185161313300025944Corn RhizosphereVNYTHYDYLDLAPGASAARIEAAYAAVLERFQYGMTDAGQD
Ga0207679_1136995413300025945Corn RhizosphereMIDEPDRSVIVNYTHYDYLELAPGASRARIEAAYAALLERFSYGTTDAGQDLSGLVRMIHAAYEVLSD
Ga0207651_1113623323300025960Switchgrass RhizosphereVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRMIH
Ga0207668_1076230413300025972Switchgrass RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLDRFQYGATDSGQDLSGLVR
Ga0207677_1079830313300026023Miscanthus RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGATEAG
Ga0207676_1076479313300026095Switchgrass RhizosphereVTYTHYDYLDLAPGSSTARIEAAYAAVLERFQYGATEAGQ
Ga0207675_10171361823300026118Switchgrass RhizosphereVNYTHYDYLDIAPGADRVRIETSYLALIEKLQYGESEAGQDLSGLVRRI
Ga0207698_1126714713300026142Corn RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGAGDADQDLSGLIRMIH
Ga0207698_1126883223300026142Corn RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGATEAGQDLAGLVRMIHAAYEVLS
Ga0209131_140143123300026320Grasslands SoilVNYTHYDYLDLAPGASPARIEAAYAAVLERFQFGAT
Ga0207983_103533913300027310SoilMEASVIYTHYDYLDLAPGASTARIEAAYAQVLERF
Ga0209262_1013205423300027841FreshwaterVFYTHYDYLELAPGAPRERIEAAYSRVLERFNFGMTPAGQDLSGLVRMIHAAYE
Ga0209814_1055886913300027873Populus RhizosphereVNYTHYDFLEIAPGADDARVEAAYVKLLERMSFGASESGQDLSGLVRRIHAAYDVLS
Ga0209293_1074907913300027877WetlandVNYTHYDYLDLAPGASPARIEAAYAAVLERFQFGATDAGQDLSGLVRMIHAAYEVLSD
Ga0209486_1106635023300027886Agricultural SoilVIYTHYDYLELAPGAPRERIEAAYARVLERFNDGAS
Ga0209496_1053534323300027890WetlandVNYTHYDYLDLAPGASPARIEAAYAAVLERFQFGATDAGQDLSGLVRMIHAAYEV
Ga0209068_1062458623300027894WatershedsVDYTHYDYLDLAPGASTARIETAYAQLLERFGYGTTDEGQDLSGLVRMVHA
Ga0268266_1108966823300028379Switchgrass RhizosphereVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGAGDADQDLSGLIRMIHA
Ga0268266_1191308713300028379Switchgrass RhizosphereVNYTHYDFLDLAPGAPSARIEAAYAHVMERFQYGGVTDAGQDLSG
Ga0268264_1173408523300028381Switchgrass RhizosphereVNYTHYDFLDLAPGAPSARIEAAYAQVMERFQYGGVTDAGQD
Ga0268264_1234573013300028381Switchgrass RhizosphereVNYTHYDYLDLAPGASTARIEAAYAQVLQRFQFGRTD
Ga0302205_1018757923300028739FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRMIHAAYEVLSH
Ga0302256_1022555513300028741FenVDYTHYDYLELAPGASTARIEAAYAAVLERFQYGAADAGQDL
Ga0247824_1043716023300028809SoilVNYTHYDYLELAPGATSKRIEAAYAALLERFQYGKTDAGQDLSGLVRMIHAAY
Ga0307312_1094027023300028828SoilVHQYTHYDYLDLAPGADSARIEAAYVALLQRLQYGASDAG
Ga0302259_104908923300028861FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRMIHAAYEVLSHPE
Ga0302259_119212523300028861FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGATEAGQ
Ga0302291_1011972423300028865FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMT
Ga0302291_1016785913300028865FenVNYTYYDYLDLAPGASSARIETAYAQLLERFGYGET
Ga0302263_1010181723300028869FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRM
Ga0311347_1054021423300029923FenVNYTHYDYLDLPPGASTARIEAAYAAVLERFQYGATEAGQDL
Ga0311337_1035063023300030000FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGVTDA
Ga0311337_1197803823300030000FenVDYTHYDYLELAPGASTARIEAAYAAVLERFQYGAADAGQDLSGL
Ga0302172_1012569723300030003FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGATEAGQDLSGLVRMIHAAYEVL
Ga0302273_118011513300030048BogVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGVTEAG
Ga0302255_102498713300030050FenVNYTHYDYLDLAPGASIARIEAAYAAVLERFQYGMTDAGQDLSGLVR
Ga0311335_1140749013300030838FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTD
Ga0311366_1022414333300030943FenVNYTYYDYLDLAPGASSARIETAYAQLLERFGYGETD
Ga0265327_1002737013300031251RhizosphereMEASVIYTHYDYLDLAPGASTARIEAAYAQVLERFGYGGADIEQDMGGL
Ga0311364_1132494423300031521FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGATEAGQDLSGL
Ga0311364_1212664313300031521FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQDLSGLVRMIHAAYE
Ga0318528_1000639413300031561SoilVNYTHYDYLELAPGASRARIEAAYLSLLERFQQGTTDAGQDLSGLVRMIHAAYE
Ga0311351_1071393623300031722FenVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGMTDAGQD
Ga0307405_1207280723300031731RhizosphereVIYTHYDYLEIAPGVARERIEAAYARVLERFNYGVSPNGQDLSGLVRMIHSAYNVLS
Ga0318498_1024417923300031778SoilVNYTHYDYLELAPGASRARIEAAYLSLLERFQQGTTDAGQDLSGLVRMI
Ga0318567_1050740913300031821SoilVNYTHYDFLELAPGADGARVEAAYVALLERMSFGASESGQDLSGLVR
Ga0310904_1046835023300031854SoilVNYTHYDFLDLAPGAPSARIEAAYAQVMERFQYGGVTEAGQDL
Ga0307406_1168363113300031901RhizosphereVNYTHYDYLELAPGASRARVEAAYAALLERFQYGSTDAGQDLSGLVRMIHAAYEILSDPE
Ga0308175_10032456813300031938SoilVTYTYYDYLDLAPGASPARIEAAYAAVLERFQYGATDAGQDLSGLVRMIHAAYEILSSPG
Ga0308175_10218061913300031938SoilVNYTHYDYLELAPGVASHRIEAAYCALLERFQYGHTDAGQDLSGLVR
Ga0308175_10242122713300031938SoilVNYTHYDYLDLAPGASPSRIDSAYRQVLERFGYGSSDAGQDFSGMVRLIH
Ga0308174_1107334023300031939SoilVTYTHYDYLDLAPGASPARIEAAYAAVLERFQYGATEAGQDLAGLVRMIHAAYEVL
Ga0310909_1051433413300031947SoilVNYTHYDYLELAPGASRARIEAAYLSLLERFQQGTTDAGQDLS
Ga0307409_10012984913300031995RhizosphereVIYTHYDYLEIAPGVPRERIEAAYARVLERFNYGVSPNGQDLSGLVRMIHSAYNVLSDAQARK
Ga0307414_1027609033300032004RhizosphereVIYTHYDYLEIAPGVARERIEAAYARVLERFNYGVSPNGQDLSGLVRMIHSAYNVLSDA
Ga0318562_1053056913300032008SoilVKYTHYDYLDLAPGVSPARIEAAYAQLLERFGYGVTEAGQD
Ga0318562_1056712733300032008SoilVNYTHYDFLELAPGADGARVEAAYVALLERMSFGASESGQDLS
Ga0310902_1123541313300032012SoilVNYTHYDYLDLAPGASTARIEAAYAQVLQRFQFGRTDAG
Ga0310906_1018574323300032013SoilVNYTHYDFLDLAPGAPSARIEAAYAHEMERFQYGGVTDAGQDMSGLVRLIHAA
Ga0318524_1002571513300032067SoilVSYTFYDYLDLPPGATAAQIEASYVALLEKFGYGTTDAGQDMSGLIRMIHSAYE
Ga0310890_1087223823300032075SoilVNYTHYDYLDLAPGASTARIEAAYAQVLQRFQFGRTDAGQDLSGLVR
Ga0318525_1035257813300032089SoilVSYTYYDYLDLPPGATAAQIESSYVALLERFGYGTTDAGQDMSGLIRMIHSAYA
Ga0310895_1075374823300032122SoilVTYTHYDYLDLAPGSSTARIEAAYAAVLERFQYGA
Ga0307415_10150920313300032126RhizosphereVNYTHYDYLELAPGASRARVEAAYAALLERFQYGSTDAGQDLSGL
Ga0315292_1027168633300032143SedimentMTYTYYDYLELAPGASQKRIETAYIALVERFGYGTTDAGQDMSGLLRMIQAA
Ga0315292_1096289913300032143SedimentVIYTYYDYLELPPGASPTRIESAYVALLERFGYGTTDAGQDMSGLLRLVQTA
Ga0315276_1042617813300032177SedimentVSYTFYDYLELPQDAAPARIETAYLGLLERFGYGTTDAGQDMSNRVAMIHAAYNVLANPEARTG
Ga0307471_10108822423300032180Hardwood Forest SoilVNYTHYDYLEIPPGAEDARIEAAYVRLVERLQYGSTDAGQDLSGL
Ga0310896_1083080123300032211SoilVNYTHYDYLELAPGATSKRIEAAYMALLERFQYGKTDAG
Ga0315271_1019216413300032256SedimentVNYTHYDYLDLAPGASTARIEAAYAAVLERFQYGVTDAGQDLSGLVRMIHAAYEVLSRPELRRS
Ga0315271_1132086723300032256SedimentVTYTYYDYLELPPAASRARIEAAYAQLLERFGYGTTDAGQDLGGLVRMIHAAYEVLTDAE
Ga0335083_1112858423300032954SoilVIYTHYDYLDLAPGASPARIEAAYAAVLERFQYGVTETGQDLSGLVRMIHAAYDVLS
Ga0335083_1149698413300032954SoilLDYTHYDYLDLAPGASRARIEAAYAALLARLQIGDAGPSQDMPQLVRMVHAAYRVLSDPE
Ga0335084_1101865213300033004SoilMSYTHYDYLELPPGASVARIEAAYIGLVERFGYGTTDAGQDMSGLLRMIHTAYAVLHDPA
Ga0335084_1127043923300033004SoilVKYTHYDYLDLAPGASPARIEAAYAQLLERFGYGVTEAGQDLGGLVRMIHAAYEVL
Ga0316603_1107855623300033413SoilVIYTHYDYLELAPGAPRERIEAAYARVLERFNYGMTP
Ga0316603_1120510313300033413SoilVTYTYYDYLELAPGASPARIETAYAHLLERFGYRDRESGHDLAGLVRMIH
Ga0316619_1054137823300033414SoilVIYTHYDYLELAPGAPRERIEAAYARVLERFNYGLTPAGQDLSGLVRMVHAAYEVLS
Ga0316625_10015480623300033418SoilVTYTYYDYLELAPGASPARIETAYAHLLERFGYRDRESGHDLAG
Ga0316627_10083425823300033482SoilVIYTHYDYLELAPGAPRERIEAAYARVLERFNYGL
Ga0316629_1064517313300033483SoilVIYTHYDYLEIAPGAPRERVEAAYARVLERFNHGMAPSGQDLS
Ga0316626_1152330323300033485SoilVIYTHYDYLELAPGAPRERIEAAYARVLERFNYGLTPA
Ga0316621_1088377813300033488SoilVTYTYYDYLELAPGASPARIEAAYVHLLERFGFRKSGSGHDFSGLVRMIHAA
Ga0247829_1003899433300033550SoilVNYTHYDYLELAPGATSKRIEAAYAALLERFQYGKTDAGQDLSGLVRMI
Ga0247829_1015059113300033550SoilVNYTHYDYLELAPGATSHRIEAAYAALLERFQYGMTDAGQDLSGLVRMIHAAYAVLS
Ga0370480_0341460_381_5033300034169Untreated Peat SoilMTFTFYDYLEIAPGASAARVDAAYVHLLERFGYGMTDAGQD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.