Basic Information | |
---|---|
Family ID | F027272 |
Family Type | Metagenome |
Number of Sequences | 195 |
Average Sequence Length | 45 residues |
Representative Sequence | FATYSYEVAFNQLRWGRGVTISIFLVPLLVVGIALISRYLLRERR |
Number of Associated Samples | 166 |
Number of Associated Scaffolds | 195 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.51 % |
% of genes near scaffold ends (potentially truncated) | 98.97 % |
% of genes from short scaffolds (< 2000 bps) | 94.87 % |
Associated GOLD sequencing projects | 160 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.487 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (10.256 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.615 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 195 Family Scaffolds |
---|---|---|
PF00528 | BPD_transp_1 | 51.28 |
PF02668 | TauD | 2.05 |
PF05721 | PhyH | 1.54 |
PF10282 | Lactonase | 1.03 |
PF00664 | ABC_membrane | 0.51 |
PF01061 | ABC2_membrane | 0.51 |
PF00343 | Phosphorylase | 0.51 |
PF07813 | LTXXQ | 0.51 |
PF02350 | Epimerase_2 | 0.51 |
PF13602 | ADH_zinc_N_2 | 0.51 |
COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
---|---|---|---|
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.05 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 2.05 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.54 |
COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.51 |
COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.49 % |
Unclassified | root | N/A | 0.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2040502000|ACOD_F64RS5002F4BZB | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
3300000559|F14TC_100891610 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300000559|F14TC_100891611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 501 | Open in IMG/M |
3300002561|JGI25384J37096_10100571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1008 | Open in IMG/M |
3300003267|soilL1_10018639 | All Organisms → cellular organisms → Bacteria | 4586 | Open in IMG/M |
3300004019|Ga0055439_10334878 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005172|Ga0066683_10476934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 763 | Open in IMG/M |
3300005180|Ga0066685_11074884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
3300005186|Ga0066676_10873435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
3300005218|Ga0068996_10049132 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300005294|Ga0065705_10913051 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005330|Ga0070690_101709326 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
3300005331|Ga0070670_100947152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 782 | Open in IMG/M |
3300005332|Ga0066388_103881999 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300005345|Ga0070692_11292615 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005441|Ga0070700_100328764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
3300005444|Ga0070694_101295269 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300005445|Ga0070708_100239704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1703 | Open in IMG/M |
3300005451|Ga0066681_10358816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 895 | Open in IMG/M |
3300005467|Ga0070706_101463370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
3300005518|Ga0070699_101265917 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300005529|Ga0070741_10286781 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300005543|Ga0070672_100219600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1594 | Open in IMG/M |
3300005545|Ga0070695_101165722 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300005545|Ga0070695_101779485 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300005546|Ga0070696_100571302 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300005552|Ga0066701_10095288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1730 | Open in IMG/M |
3300005558|Ga0066698_10203137 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300005569|Ga0066705_10072601 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
3300005569|Ga0066705_10521220 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 742 | Open in IMG/M |
3300005574|Ga0066694_10125124 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300005574|Ga0066694_10547809 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
3300005574|Ga0066694_10572287 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005576|Ga0066708_10932384 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005577|Ga0068857_100087444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2787 | Open in IMG/M |
3300005578|Ga0068854_100454981 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300005586|Ga0066691_10324178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
3300005617|Ga0068859_100856395 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300005713|Ga0066905_101441341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
3300005718|Ga0068866_10667090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
3300005764|Ga0066903_100829147 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300005764|Ga0066903_105946848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
3300005764|Ga0066903_107381434 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
3300005829|Ga0074479_10076076 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2030 | Open in IMG/M |
3300005829|Ga0074479_10510674 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
3300005840|Ga0068870_10872922 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
3300005841|Ga0068863_100870287 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 900 | Open in IMG/M |
3300005843|Ga0068860_101786913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
3300006041|Ga0075023_100623661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 505 | Open in IMG/M |
3300006046|Ga0066652_102046140 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006175|Ga0070712_100008041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6618 | Open in IMG/M |
3300006845|Ga0075421_101046379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 921 | Open in IMG/M |
3300006847|Ga0075431_100988429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 809 | Open in IMG/M |
3300006871|Ga0075434_100473519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1274 | Open in IMG/M |
3300006871|Ga0075434_102092798 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300006880|Ga0075429_101195878 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
3300006881|Ga0068865_101486491 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
3300006894|Ga0079215_11135945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
3300006903|Ga0075426_10612287 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 814 | Open in IMG/M |
3300006918|Ga0079216_10493050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 806 | Open in IMG/M |
3300006969|Ga0075419_11146603 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300009012|Ga0066710_104451486 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
3300009094|Ga0111539_10998275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 973 | Open in IMG/M |
3300009157|Ga0105092_10470049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
3300009162|Ga0075423_11597733 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
3300009777|Ga0105164_10492445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
3300009816|Ga0105076_1084429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
3300009822|Ga0105066_1122795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
3300010029|Ga0105074_1111039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
3300010044|Ga0126310_11780027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
3300010047|Ga0126382_10419636 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1050 | Open in IMG/M |
3300010048|Ga0126373_10599142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1154 | Open in IMG/M |
3300010323|Ga0134086_10403890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
3300010358|Ga0126370_12673808 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
3300010360|Ga0126372_11582508 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 694 | Open in IMG/M |
3300010360|Ga0126372_11792422 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 657 | Open in IMG/M |
3300010362|Ga0126377_11496632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 749 | Open in IMG/M |
3300010362|Ga0126377_11600057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
3300010362|Ga0126377_12889528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
3300010366|Ga0126379_10605897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1181 | Open in IMG/M |
3300010366|Ga0126379_10714004 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1097 | Open in IMG/M |
3300010399|Ga0134127_12469233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 599 | Open in IMG/M |
3300010399|Ga0134127_12898686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
3300010401|Ga0134121_10296711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1429 | Open in IMG/M |
3300010403|Ga0134123_13618996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
3300011271|Ga0137393_10507357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1035 | Open in IMG/M |
3300011406|Ga0137454_1024273 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 842 | Open in IMG/M |
3300012022|Ga0120191_10084351 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
3300012096|Ga0137389_10424599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1136 | Open in IMG/M |
3300012164|Ga0137352_1103185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
3300012189|Ga0137388_11736387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
3300012200|Ga0137382_10591277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 792 | Open in IMG/M |
3300012201|Ga0137365_11364007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
3300012208|Ga0137376_11558391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
3300012209|Ga0137379_10568505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1041 | Open in IMG/M |
3300012350|Ga0137372_10710909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
3300012351|Ga0137386_10409244 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 977 | Open in IMG/M |
3300012355|Ga0137369_10047503 | All Organisms → cellular organisms → Bacteria | 3780 | Open in IMG/M |
3300012361|Ga0137360_10727894 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 852 | Open in IMG/M |
3300012912|Ga0157306_10101917 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 833 | Open in IMG/M |
3300012918|Ga0137396_11191229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
3300012922|Ga0137394_10876146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 750 | Open in IMG/M |
3300012923|Ga0137359_11032721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
3300012930|Ga0137407_10010444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6567 | Open in IMG/M |
3300012944|Ga0137410_10441841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1055 | Open in IMG/M |
3300012944|Ga0137410_11915666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
3300012964|Ga0153916_12448491 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
3300012972|Ga0134077_10525298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
3300013026|Ga0170681_1058052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 777 | Open in IMG/M |
3300014873|Ga0180066_1113217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
3300015262|Ga0182007_10008367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4257 | Open in IMG/M |
3300015372|Ga0132256_103453770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
3300016387|Ga0182040_11760261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
3300017993|Ga0187823_10102459 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 858 | Open in IMG/M |
3300018031|Ga0184634_10154254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1032 | Open in IMG/M |
3300018052|Ga0184638_1271447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
3300018058|Ga0187766_10986882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 599 | Open in IMG/M |
3300018061|Ga0184619_10412981 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
3300018063|Ga0184637_10723462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
3300018084|Ga0184629_10378991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 744 | Open in IMG/M |
3300018089|Ga0187774_11102859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
3300018429|Ga0190272_10065208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2182 | Open in IMG/M |
3300018468|Ga0066662_10948939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 848 | Open in IMG/M |
3300018482|Ga0066669_11830030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
3300020004|Ga0193755_1038834 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1566 | Open in IMG/M |
3300020199|Ga0179592_10149068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1070 | Open in IMG/M |
3300021081|Ga0210379_10129675 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1063 | Open in IMG/M |
3300025311|Ga0209343_10182434 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
3300025322|Ga0209641_10425716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_2_20CM_69_10 | 953 | Open in IMG/M |
3300025538|Ga0210132_1069398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
3300025893|Ga0207682_10046168 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1789 | Open in IMG/M |
3300025903|Ga0207680_10805195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
3300025904|Ga0207647_10593869 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
3300025910|Ga0207684_10780723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 808 | Open in IMG/M |
3300025924|Ga0207694_10929167 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 736 | Open in IMG/M |
3300025936|Ga0207670_10782090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 794 | Open in IMG/M |
3300025961|Ga0207712_10318493 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300025981|Ga0207640_11235865 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 665 | Open in IMG/M |
3300026023|Ga0207677_10664995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 921 | Open in IMG/M |
3300026297|Ga0209237_1126419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1060 | Open in IMG/M |
3300026300|Ga0209027_1177208 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300026312|Ga0209153_1241540 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
3300026313|Ga0209761_1166082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1023 | Open in IMG/M |
3300026313|Ga0209761_1263755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 642 | Open in IMG/M |
3300026322|Ga0209687_1272975 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
3300026323|Ga0209472_1097517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1176 | Open in IMG/M |
3300026342|Ga0209057_1197426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
3300026360|Ga0257173_1000011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5613 | Open in IMG/M |
3300026523|Ga0209808_1184022 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 732 | Open in IMG/M |
3300026536|Ga0209058_1158458 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1046 | Open in IMG/M |
3300027360|Ga0209969_1062392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
3300027669|Ga0208981_1180008 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
3300027695|Ga0209966_1024785 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1187 | Open in IMG/M |
3300027871|Ga0209397_10551274 | Not Available | 575 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10202560 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 873 | Open in IMG/M |
3300028812|Ga0247825_10930078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
3300028814|Ga0307302_10443693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 643 | Open in IMG/M |
3300030336|Ga0247826_10785689 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 745 | Open in IMG/M |
3300031538|Ga0310888_10915356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
3300031545|Ga0318541_10267430 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 951 | Open in IMG/M |
3300031720|Ga0307469_10411654 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300031720|Ga0307469_10412187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1157 | Open in IMG/M |
3300031720|Ga0307469_10860036 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 837 | Open in IMG/M |
3300031720|Ga0307469_12221614 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300031740|Ga0307468_100186364 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300031740|Ga0307468_100701268 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 846 | Open in IMG/M |
3300031740|Ga0307468_102057875 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
3300031820|Ga0307473_10256065 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1076 | Open in IMG/M |
3300031820|Ga0307473_11144842 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
3300031820|Ga0307473_11470923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
3300031834|Ga0315290_11133700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 652 | Open in IMG/M |
3300031845|Ga0318511_10396713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
3300031873|Ga0315297_11172876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
3300031892|Ga0310893_10070079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1219 | Open in IMG/M |
3300031911|Ga0307412_11080373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 713 | Open in IMG/M |
3300031913|Ga0310891_10398973 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
3300031947|Ga0310909_11258860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
3300031995|Ga0307409_101096442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 817 | Open in IMG/M |
3300031995|Ga0307409_102564179 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
3300031997|Ga0315278_11435374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300032002|Ga0307416_101330939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 824 | Open in IMG/M |
3300032065|Ga0318513_10224169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 908 | Open in IMG/M |
3300032180|Ga0307471_101657705 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 794 | Open in IMG/M |
3300032180|Ga0307471_102543227 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
3300032180|Ga0307471_102617238 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
3300032180|Ga0307471_102625456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
3300032211|Ga0310896_10636989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
3300032401|Ga0315275_10193158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2267 | Open in IMG/M |
3300033004|Ga0335084_11251810 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 740 | Open in IMG/M |
3300033433|Ga0326726_10212106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1791 | Open in IMG/M |
3300033433|Ga0326726_11033916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 798 | Open in IMG/M |
3300033433|Ga0326726_11107729 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 770 | Open in IMG/M |
3300033487|Ga0316630_10582963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 931 | Open in IMG/M |
3300033977|Ga0314861_0265429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 785 | Open in IMG/M |
3300034818|Ga0373950_0108192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.26% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.23% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.18% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.08% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.05% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.05% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.05% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.05% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.54% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.54% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.54% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.54% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.03% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.03% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.03% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.03% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.03% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.03% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.51% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.51% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.51% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.51% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.51% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.51% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.51% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.51% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.51% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.51% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.51% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.51% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.51% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 0.51% |
Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.51% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2040502000 | Fungus garden microbial communities from Atta colombica in Panama - dump bottom | Host-Associated | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013026 | Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila | Environmental | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ACODB_19361690 | 2040502000 | Fungus Garden | HHLRDDPGRPGTATQIFATYSYQVAFNQLRWGXGVTICLFVVPILVIGIILISRYLLRDR |
F14TC_1008916102 | 3300000559 | Soil | TQVFATYSYQVAFGQLRWGRGVTISIFVVPILVIGIILISRYLLRDRR* |
F14TC_1008916112 | 3300000559 | Soil | TQVFATYSYQVAFNQLRWGRGVTISIFVVPILVVGIILISRYLLRDRR* |
JGI25384J37096_101005711 | 3300002561 | Grasslands Soil | VFATYSYEVAFNQLRWGRGVTISIFALPLLAAAIALVSRYLLRDRTA* |
soilL1_100186398 | 3300003267 | Sugarcane Root And Bulk Soil | PGTATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLIAGIALVSRYLLRERTT* |
Ga0055439_103348782 | 3300004019 | Natural And Restored Wetlands | TYSYQVAFNQLRWGRGVTICLFVVPILVLGIILISRYLLRDKK* |
Ga0066683_104769342 | 3300005172 | Soil | TYSYQVAFNQLRWGRGVTICLFMVPILIVGIIFISRYLLRDRK* |
Ga0066685_110748841 | 3300005180 | Soil | EVAFNQLRWGRGVTISMFAVPLLVAGIALVSRYLLRERTA* |
Ga0066676_108734351 | 3300005186 | Soil | VFATYSFEVAFNQLRWGRGVTISMFAVPLLVAGIALVSRYLLRERTA* |
Ga0068996_100491321 | 3300005218 | Natural And Restored Wetlands | VFATYSYEVAFNQLRWGRGVTISIFLVPLLVAGIAFVSRYLLREKD* |
Ga0065705_109130512 | 3300005294 | Switchgrass Rhizosphere | GPGSATQVFATYSYQVAFQQLRWGRGVTISIFLVPLLVVGIALISRYLLREGRGK* |
Ga0070690_1017093261 | 3300005330 | Switchgrass Rhizosphere | SYEVAFNALRWGRGVTISIFVVPLLIALIPLVSRYLLRERAA* |
Ga0070670_1009471522 | 3300005331 | Switchgrass Rhizosphere | SYEVAFNQLRWGRGVTISIFLVPLLVVGIALISRYLLREAR* |
Ga0066388_1038819991 | 3300005332 | Tropical Forest Soil | FATYSYEVAFNQLRWGRGVTIAIYAVPLLIAVIPLVSRALLRERNA* |
Ga0070692_112926151 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TYSYQVAFNQLRWGRGVTISIFVVPILVVGIVLISRYLLRDRR* |
Ga0070700_1003287643 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | YSYQVAFGQLRWGRGVTISLFVVPILVLGIVLISRYLLRDRK* |
Ga0070694_1012952691 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GGPGTATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA* |
Ga0070708_1002397043 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PGTATQIFATYSYQVAFGQLRWGRGVTISLFVVPILVLGIVLISRYLLRDRK* |
Ga0066681_103588161 | 3300005451 | Soil | YEVAFNQLRWGRGVTVSIFLVPVLIVAIALVSRYLLRERE* |
Ga0070706_1014633702 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GGPGAATQVFATYSYQVAFGQLRWGRGVTISIFLVPLLVIGIVFISRYLLRQKS* |
Ga0070699_1012659172 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PGTATQVFATYSYEVAFNQLRWGRGVTISIFLVPVLIVAITLVSRYLLKERE* |
Ga0070741_102867811 | 3300005529 | Surface Soil | GPGTATHVFATYSYDVAFNQLRWGRGVTISLFLVPLLVVGIVLVSRYLLRVRD* |
Ga0070672_1002196001 | 3300005543 | Miscanthus Rhizosphere | SYQVAFGQLRWGRGVTISLFVVPILVLGIVLISRYLLRDRK* |
Ga0070695_1011657221 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ATQVFATYSYEVAFNALRWGRGVTISIFVVPLLIALIPLVSRYLLRERAA* |
Ga0070695_1017794852 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | YEVAFNQLRWGRGVTISIYAVPLLIALIPLVSRSLLRERPA* |
Ga0070696_1005713021 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FATYSYEVAFNQLRWGRGVTISIFLVPLLVVGIALISRYLLRERR* |
Ga0066701_100952883 | 3300005552 | Soil | YSYEVAFNQLRWGRGVTISIFVVPLLIALIPLVSRYLLRERSA* |
Ga0066698_102031371 | 3300005558 | Soil | TQVFATYSYEVAFNQLRWARGVTVSIFLVPLLVAGIALLSRYLLRQENA* |
Ga0066705_100726011 | 3300005569 | Soil | YEVAFNQLRWARGVTVSIFLVPLLVAGIALLSRYLLRQENA* |
Ga0066705_105212201 | 3300005569 | Soil | AFNQLRWGRGVTVSIFLVPVLIVAIALVSRYLLRERE* |
Ga0066694_101251243 | 3300005574 | Soil | LATYSYEVAFHQLRWGRGVTVAIFLVPVLVVGIALVSRYLLRERD* |
Ga0066694_105478092 | 3300005574 | Soil | AFNQLRWARGVTVSIFLVPLLVAGIALLSRYLLRQENA* |
Ga0066694_105722872 | 3300005574 | Soil | RGGPGTATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA* |
Ga0066708_109323841 | 3300005576 | Soil | FATYSYEVAFNQLRWGRGVTISIYVVPLLIALIPLVSRHLLRERAA* |
Ga0068857_1000874444 | 3300005577 | Corn Rhizosphere | FATYSYQVAFGQLRWGRGVTISLFVVPILVLGIVLISRYLLRDRK* |
Ga0068854_1004549811 | 3300005578 | Corn Rhizosphere | RGGPGTATQVFATYSYEVAFNQLRWGRGVTISIFLVPLLVVGIALISRYLLRERR* |
Ga0066691_103241782 | 3300005586 | Soil | FNQLRWGRGVTISIFLVPVLIVAIALVSRYLLRDRE* |
Ga0068859_1008563952 | 3300005617 | Switchgrass Rhizosphere | TQVFATYSYEVAFNQLRWGRGVTISIYVVPLLIALIPFVSRYLLRERAA* |
Ga0066905_1014413412 | 3300005713 | Tropical Forest Soil | QLRWGRGVTISIFLVPLLVIGIALISRYLLREPK* |
Ga0068866_106670902 | 3300005718 | Miscanthus Rhizosphere | LRWGRGVTISIFVVPLLIALIPLVSRYLLRERTA* |
Ga0066903_1008291474 | 3300005764 | Tropical Forest Soil | ATYSYQVAFNQLRWGRGVTISIFVVPILVVGIILISRYLLRDRR* |
Ga0066903_1059468482 | 3300005764 | Tropical Forest Soil | EVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERAA* |
Ga0066903_1073814341 | 3300005764 | Tropical Forest Soil | LRWGRGVTISIFAVPLLTAAIALISRYLLRDRTA* |
Ga0074479_100760761 | 3300005829 | Sediment (Intertidal) | GTATQVFATYSYEVAFNQLRWGRGVTISIFLVPLLVVGIALVSRYLLREKDA* |
Ga0074479_105106741 | 3300005829 | Sediment (Intertidal) | TATQIFATYSYQVAFNQLRWGRGVTICLFVVPILVLGIILISRYLLRDKK* |
Ga0068870_108729221 | 3300005840 | Miscanthus Rhizosphere | FNQLRWGRGVTISIFLVPLLVVGIALISRYLLRERR* |
Ga0068863_1008702871 | 3300005841 | Switchgrass Rhizosphere | QLRWGRGVTISIFLVPLLVVGIALISRYLLREAR* |
Ga0068860_1017869131 | 3300005843 | Switchgrass Rhizosphere | QLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA* |
Ga0075023_1006236611 | 3300006041 | Watersheds | GTATQVFATYSYQVAFNQLRWGRGVTICLFVVPILVVGIIFISRYLLRDKK* |
Ga0066652_1020461401 | 3300006046 | Soil | EVAFNQLRWGRGVTISIYAVPLLIAVIPLVSRYLLRERAA* |
Ga0070712_1000080418 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PGTATQVFATYSYQVAFNQLRWGRGVTICLFMVPILIVGIIFISRYLLRDRK* |
Ga0075421_1010463792 | 3300006845 | Populus Rhizosphere | VAFNQLRWGRGVTISIFAVPLLIAGIALVSRYLLRERTA* |
Ga0075431_1009884292 | 3300006847 | Populus Rhizosphere | AFNQLRWGRGVTICLFVVPILVLGIILISRYLLRDKK* |
Ga0075434_1004735191 | 3300006871 | Populus Rhizosphere | GTATQVFATYSYQVAFNQLRWGRGVTICLFMVPILIVGIIFISRYLLRDRK* |
Ga0075434_1020927982 | 3300006871 | Populus Rhizosphere | FNQLRWGRGVTIAIFVVPLLIALIPLVSRSLLRERTA* |
Ga0075429_1011958781 | 3300006880 | Populus Rhizosphere | NQLRWGRGVTISIFLVPALVVAIALVSRYLLRERE* |
Ga0068865_1014864911 | 3300006881 | Miscanthus Rhizosphere | SYEVAFNQLRWGRGVTILIFLVPLLAVGIALISRYLLREPR* |
Ga0079215_111359452 | 3300006894 | Agricultural Soil | AFNSLRWGRGVTVSIFCVPLLIAGIALVSRYLLRDRD* |
Ga0075426_106122872 | 3300006903 | Populus Rhizosphere | QVFATYSYEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA* |
Ga0079216_104930501 | 3300006918 | Agricultural Soil | SYEVAFNSLRWGRGVTISIFVVPLLIALIPLVSRYLLRERTA* |
Ga0075419_111466032 | 3300006969 | Populus Rhizosphere | YSYQVAFNQLRWGRGVTISIFVVPILVVGIVLISRYLLRDRR* |
Ga0066710_1044514861 | 3300009012 | Grasslands Soil | QVLATYSYEVAFNQLRWGRGVTIAIFLVPALVAGIALVSRYLLRDGD |
Ga0111539_109982752 | 3300009094 | Populus Rhizosphere | HQLRWGRGVTVAIFLVPVLVVGIALVSRYLLRERES* |
Ga0105092_104700491 | 3300009157 | Freshwater Sediment | EVAFNQLRWGRGVTISIFLVPLLVVGIALISRYLLREQR* |
Ga0075423_115977332 | 3300009162 | Populus Rhizosphere | GTATQVLATYSYEVAFNQLRWGRGVTIAIFLVPVLVAGIALISRYLLRERD* |
Ga0105164_104924452 | 3300009777 | Wastewater | VFATYSYDVAFNSLRWGRGVTISLYMVPLLIVGIVLVSRYLLRDKD* |
Ga0105076_10844291 | 3300009816 | Groundwater Sand | GGPGTATQVFATYSYEVAFNQLRWGRGVTVSIFLVPFLVVGIVLISRYLLREKD* |
Ga0105066_11227952 | 3300009822 | Groundwater Sand | ATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA* |
Ga0105074_11110391 | 3300010029 | Groundwater Sand | QIFATYSYQVAFNQLRWGRGVTICLFVVPILVVGIILISRYLLRDKK* |
Ga0126310_117800271 | 3300010044 | Serpentine Soil | QLRWGRGVTVAIFLVPVLVAGIALVSRYLLRERD* |
Ga0126382_104196362 | 3300010047 | Tropical Forest Soil | GTATQIFATYSYQVAFNQLRWGRGVTVCLFVVPILVIGIILISRYLLRDRK* |
Ga0126373_105991422 | 3300010048 | Tropical Forest Soil | ATQIFATYSYQVAFSQLRWGRGVTICLFVVPILVLGIVLISRYLLRDRK* |
Ga0134086_104038901 | 3300010323 | Grasslands Soil | SYEVAFNQLRWGRGVTISIFLVPVLIVAIALISRYLLKDRE* |
Ga0126370_126738081 | 3300010358 | Tropical Forest Soil | NQLRWGRGVTISIFAVPLLVAAIALVSRYLLRERPA* |
Ga0126372_115825082 | 3300010360 | Tropical Forest Soil | VAFNQLRWGRGVTISIYAVPLLIALIPLVSRYLLRERAA* |
Ga0126372_117924222 | 3300010360 | Tropical Forest Soil | FATYSYEVAFNQLRWGRGVTISIFVVPLLVIGIALISHYLLRERR* |
Ga0126377_114966322 | 3300010362 | Tropical Forest Soil | GPGTATQVFATYSYQVAFNQLRWGRGVTISIFVVPILVVGIILISRYLLRDRR* |
Ga0126377_116000571 | 3300010362 | Tropical Forest Soil | TATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLAAAIALISRYLLRDRTA* |
Ga0126377_128895281 | 3300010362 | Tropical Forest Soil | GPGSATQVFATYSYQVAFGQLRWGRGVTISIFVVPLLVIGIVLISRYLLRERR* |
Ga0126379_106058971 | 3300010366 | Tropical Forest Soil | TQIFATYSYQVALSQLRWGRGVTICLFVVPILVLGIVLISRYLLRDRR* |
Ga0126379_107140041 | 3300010366 | Tropical Forest Soil | TATQVFATYSYEVAFNALRWGRGVTISIFVVPLLIALIPLVSRYLLRERTA* |
Ga0134127_124692332 | 3300010399 | Terrestrial Soil | AFNQLRWGRGVTISIFLVPLLVVGIALISRYLLREQR* |
Ga0134127_128986862 | 3300010399 | Terrestrial Soil | VFATYSYEVAFNQLRWGRGVTISIYAVPLLIALIPLVSRYLLRERNA* |
Ga0134121_102967113 | 3300010401 | Terrestrial Soil | FATYSYEVAFNQLRWGRGVTISIYAVPLLIALIPLVSRYLLRERNA* |
Ga0134123_136189962 | 3300010403 | Terrestrial Soil | GGPGTATQVFATYSYEVAFNALRWGRGVTISIFVVPLLIALIPLVSRYLLRERAA* |
Ga0137393_105073572 | 3300011271 | Vadose Zone Soil | GPGTATQVFATYSYEVAFNQLRWGRGVTISIFLVPALIVAIALVSRYLLKERE* |
Ga0137454_10242732 | 3300011406 | Soil | AFNQLRWGRGVTISIFLVPLLVVGIALISRYLLREPR* |
Ga0120191_100843512 | 3300012022 | Terrestrial | FATYSYQVAFNQLRWGRGVTISIFLVPLLVVGIILISRYLLRERR* |
Ga0137389_104245992 | 3300012096 | Vadose Zone Soil | FATYSYQVAFGQLRWGRGVTICLFVVPILVLGIVMISRYLLRDRK* |
Ga0137352_11031851 | 3300012164 | Soil | VAFNQLRWGRGVTICLFVVPILVLGIILISRYLLRDKK* |
Ga0137388_117363871 | 3300012189 | Vadose Zone Soil | LRWGRGVTVAIFLVPVLVVGIALVSRYLLRERET* |
Ga0137382_105912771 | 3300012200 | Vadose Zone Soil | PGTATQVFASYSYEVPFNQLRWGRGVTISIFLVPVLIVAIALVSRYLLKERE* |
Ga0137365_113640071 | 3300012201 | Vadose Zone Soil | QVFATYSYEVAFNQLRWGRGVTISIFAVPLLAAAIALVSRYLLRDRTA* |
Ga0137376_115583912 | 3300012208 | Vadose Zone Soil | TYSYEVAFNQLRWGRGVTISIFLVPVLIVGIALVSRYLLRERE* |
Ga0137379_105685051 | 3300012209 | Vadose Zone Soil | PGSATQVFATYSYQVAFGQLRWGRGVTISIFLVPLLVIGIVLISRYLLRERR* |
Ga0137372_107109092 | 3300012350 | Vadose Zone Soil | GPGTATQVFATYSYEVAFNQLRWGRGVTISIFLVPILIAGIALVSRYLLRDKN* |
Ga0137386_104092442 | 3300012351 | Vadose Zone Soil | YEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA* |
Ga0137369_100475031 | 3300012355 | Vadose Zone Soil | GTATQVFATYSYEVAFNQLRWGRGVTISIFVVPLLIALIPLVSRYLLRERTA* |
Ga0137360_107278942 | 3300012361 | Vadose Zone Soil | QIFATYSYQVAFGQLRWGRGVTICLFVVPILVLGIVMISRYLLRDRK* |
Ga0157306_101019172 | 3300012912 | Soil | VAFQQLRWGRGVTISIFLVPLLVVGIALISRYLLREGRGK* |
Ga0137396_111912292 | 3300012918 | Vadose Zone Soil | TRGVPGTATQVFATYSYEVAFNQLRWGRGVTISIFLVPVLIVAISLVSRYLLRERE* |
Ga0137394_108761461 | 3300012922 | Vadose Zone Soil | YEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTV* |
Ga0137359_110327212 | 3300012923 | Vadose Zone Soil | YEVAFHQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTV* |
Ga0137407_100104441 | 3300012930 | Vadose Zone Soil | GGPGTATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLAAAIALVSRYLLRDRTA* |
Ga0137410_104418411 | 3300012944 | Vadose Zone Soil | TYSYEVAFNALRWGRGVTISIFVVPLLIALIPLVSRYLLRERTA* |
Ga0137410_119156661 | 3300012944 | Vadose Zone Soil | QVFATYSYEVAFNQLRWGRGVTISIFLVPALIVAIALVSRYLLKERE* |
Ga0153916_124484911 | 3300012964 | Freshwater Wetlands | SYEVAFNQLRWGRGVTISIFLVPVFIVGIVLISRYLLRERD* |
Ga0134077_105252982 | 3300012972 | Grasslands Soil | FATYSYQVAFNQLRWGRGVTICLFMVPILIVGIIFISRYLLRDKK* |
Ga0170681_10580522 | 3300013026 | Rock | TAFNQLRWGRGVAVSIFLVPVLVVAIVVLSRYLLREEK* |
Ga0180066_11132171 | 3300014873 | Soil | TYSYEVAFNQLRWGRGVTISIFVVPLLIALIPLVSRYLLRERSA* |
Ga0182007_100083671 | 3300015262 | Rhizosphere | QLRWGRGVTISLFVVPILVLGIVLISRYLLRDRK* |
Ga0132256_1034537702 | 3300015372 | Arabidopsis Rhizosphere | VFATYSYEVAFNQLRWGRGVTISIFLVPALIVAIALVSRYLLRERE* |
Ga0182040_117602612 | 3300016387 | Soil | GPGTATQVFATYSYEVAFNQLRWGRGVTISIFAVPFLVAGIALVSRYLLRERTA |
Ga0187823_101024592 | 3300017993 | Freshwater Sediment | YSYQVAFGQLRWGRGVTICLFVVPILVLGIVLISRYLLCDRD |
Ga0184634_101542541 | 3300018031 | Groundwater Sediment | QLRWGRGVTISIFVVPLLIALIPLVSRYLLRERTA |
Ga0184638_12714471 | 3300018052 | Groundwater Sediment | QIFATYSYQVAFNQLRWGRGVTICLFVVPILVLGIILISRYLLRDKK |
Ga0187766_109868821 | 3300018058 | Tropical Peatland | FNQLRWGRGVTISIFLVPVFIVGIVLISRYLLRERD |
Ga0184619_104129811 | 3300018061 | Groundwater Sediment | QLRWGRGVTISIFVVPLLIALIPLVSRYLLRERSA |
Ga0184637_107234622 | 3300018063 | Groundwater Sediment | TQVFATYSYEVAFNQLRWGRGVTIAIFLVPLLVVGIVLISRYLLREKD |
Ga0184629_103789911 | 3300018084 | Groundwater Sediment | NQLRWGRGVTISIFLLPLLVVGIALVSRYLLREKDA |
Ga0187774_111028592 | 3300018089 | Tropical Peatland | VFATYSYDVAFNQLRWARGVTISIYVVPFLVAGIALVSRYLLRESNA |
Ga0190272_100652084 | 3300018429 | Soil | ATYSYQVAFNQLRWGRGVTICLFVVPILVLGIILISRYLLRDRK |
Ga0066662_109489391 | 3300018468 | Grasslands Soil | TQVFATYSYEVAFNQLRWGRGVTVSIFLVPVLIVGIVLVSRYLLREKE |
Ga0066669_118300302 | 3300018482 | Grasslands Soil | YSYEVAFNQLRWGRGVTIAIFLVPVLVAGIALVSRYLLRERD |
Ga0193755_10388343 | 3300020004 | Soil | TQVFATYSYEVAFNQLRWGRGVTISIFVVPLLIALIPLLSRYLLRERTA |
Ga0179592_101490682 | 3300020199 | Vadose Zone Soil | QVFATYSYEVAFNQLRWGRGVTISIFLVPALIVAIALVSRYLLKERE |
Ga0210379_101296751 | 3300021081 | Groundwater Sediment | PGSATQIFATYSYQVAFNQLRWGRGVTICLFVVPILVLGIILISRYLLRDKK |
Ga0209343_101824343 | 3300025311 | Groundwater | VLRVILLRWGRGVTVSIFLVPLLIVGIALVSRYLLRDKD |
Ga0209641_104257161 | 3300025322 | Soil | ATQVFATYSYDVAFNQLRWGRGVTISIFLVPLLVAGIVLISRYLLREKE |
Ga0210132_10693982 | 3300025538 | Natural And Restored Wetlands | YEVAFNQLRWGRGVTISIFLLPLLVVGIALVSRYLLREKDA |
Ga0207682_100461682 | 3300025893 | Miscanthus Rhizosphere | VFATYSYEVAFNQLRWGRGVTIAIFAVPLLVAGIALVSRYLLRERTA |
Ga0207680_108051951 | 3300025903 | Switchgrass Rhizosphere | TATQVFATYSYEVAFNQLRWGRGVTISIFLVPLLVVGIALISRYLLRERR |
Ga0207647_105938691 | 3300025904 | Corn Rhizosphere | FHQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA |
Ga0207684_107807232 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SATQVFATYSYQVAFQQLRWGRGVTISIFLVPLLVVGIALISRYLLREGRGK |
Ga0207694_109291672 | 3300025924 | Corn Rhizosphere | YSYQVAFGQLRWGRGVTISLFVVPILVLGIVLISRYLLRDRK |
Ga0207670_107820902 | 3300025936 | Switchgrass Rhizosphere | TYSYEVAFNQLRWGRGVTISIFLVPLLVVGIALISRYLLREQK |
Ga0207712_103184931 | 3300025961 | Switchgrass Rhizosphere | GSATQIFATYSYQVAFNQLRWGRGVTICLFVVPILVLGIIVISRYLLRDKK |
Ga0207640_112358652 | 3300025981 | Corn Rhizosphere | QIFATYSYQVAFGQLRWGRGVTISLFVVPILVLGIVLISRYLLRDRK |
Ga0207677_106649952 | 3300026023 | Miscanthus Rhizosphere | TATQVFATYSYEVAFHQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA |
Ga0209237_11264193 | 3300026297 | Grasslands Soil | AFNQLRWGRGVTISIFLVPVLIVGIALVSRYLLREKE |
Ga0209027_11772081 | 3300026300 | Grasslands Soil | YEVAFHQLRWGRGVTVAIFLVPVLVVGIALVSRYLLRERD |
Ga0209153_12415402 | 3300026312 | Soil | YSYEVAFNQLRWGRGVTISIYVVPLLIALIPLVSRHLLRERAA |
Ga0209761_11660821 | 3300026313 | Grasslands Soil | GTATQVFATYSYEVAFNQLRWGRGVTISIFALPLLAAAIALVSRYLLRDRTA |
Ga0209761_12637551 | 3300026313 | Grasslands Soil | TYSYQVAFGQLRWGRGVTISIFLVPLLVIGIVLISRYLLRERH |
Ga0209687_12729751 | 3300026322 | Soil | GPGTATQVFATYSYEVAFNQLRWGRGVTISIFLVPVMVVAIALVSRYLLRERE |
Ga0209472_10975171 | 3300026323 | Soil | ATYSYEVAFNQLRWGRGVTVSIFLVPVLIVAIALVSRYLLRERE |
Ga0209057_11974262 | 3300026342 | Soil | YEVAFNQLRWGRGVTISIFLVPVLIVAIALISRYLLKDRE |
Ga0257173_10000111 | 3300026360 | Soil | QVAFGQLRWGRGVTICLFVVPILVLGIVMISRYLLRDRK |
Ga0209808_11840221 | 3300026523 | Soil | GGPGTATQVFATYSYEVAFYQLRWGRGVTISIFLVPVMVVAIALVSRYLLRERE |
Ga0209058_11584581 | 3300026536 | Soil | QLRWARGVTVSIFLVPLLVAGIALLSRYLLRQENA |
Ga0209969_10623921 | 3300027360 | Arabidopsis Thaliana Rhizosphere | QLRWGRGVTISIYAVPLLIAGIALVSRYLLRERTA |
Ga0208981_11800081 | 3300027669 | Forest Soil | AFHQLRWGRGVTISIFAVPLLIAGIALVSRYLLRERTA |
Ga0209966_10247851 | 3300027695 | Arabidopsis Thaliana Rhizosphere | YSYEVAFNQLRWGRGVTISIYAVPLLIAGIALVSRYLLRERTA |
Ga0209397_105512741 | 3300027871 | Wetland | RGGPGTATQVFATYSYEVAFHQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA |
(restricted) Ga0233417_102025601 | 3300028043 | Sediment | RGGPGTATQVFATYSYEVAFNQLRWGRGVTISIFLVPFLVVGIVLVSSHLLRDRE |
Ga0247825_109300781 | 3300028812 | Soil | SYEVAFNQLRWGRGVTISIFAVPLLIAGIALVSRYLLRERTA |
Ga0307302_104436931 | 3300028814 | Soil | YQVAFNQLRWGRGVTICLFVVPILVVGIILISRYLLRDKK |
Ga0247826_107856891 | 3300030336 | Soil | TYSYEVAFNALRWGRGVTISIFVVPLLIALIPLVSRYLLRERSA |
Ga0310888_109153561 | 3300031538 | Soil | TQVFATYSYEVAFNALRWGRGVTISIFVIPLLIALIPLVSRYLLRERTA |
Ga0318541_102674301 | 3300031545 | Soil | YEVAFNQLRWGRGVTISIFAVPFLVAGIALVSRYLLRERTA |
Ga0307469_104116541 | 3300031720 | Hardwood Forest Soil | YQVAFNQLRWGRGVTICLFVVPILVLGIIVISRYLLRDKK |
Ga0307469_104121871 | 3300031720 | Hardwood Forest Soil | GPGTATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA |
Ga0307469_108600362 | 3300031720 | Hardwood Forest Soil | TYSYEVAFNQLRWGRGVTISIFAVPLLIAGIALVSRYLLRERTA |
Ga0307469_122216141 | 3300031720 | Hardwood Forest Soil | YSYEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA |
Ga0307468_1001863643 | 3300031740 | Hardwood Forest Soil | NQLRWGRGVTISIFAVPLLVAGIALVSRYLLRERTA |
Ga0307468_1007012681 | 3300031740 | Hardwood Forest Soil | TQIFATYSYQVAFNQLRWGRGVTICLFVVPLLVVGIILISRYLLREKK |
Ga0307468_1020578751 | 3300031740 | Hardwood Forest Soil | AFNQLRWGRGVTICLFMVPILIVGIIFISRYLLRDRK |
Ga0307473_102560653 | 3300031820 | Hardwood Forest Soil | VAFNQLRWGRGVTISMFAVPLLVAGIALVSRYLLRERTA |
Ga0307473_111448422 | 3300031820 | Hardwood Forest Soil | PGTATQVFATYSYQVAFNQLRWGRGVTICLFMVPILIVGIIFISRYLLRDKK |
Ga0307473_114709232 | 3300031820 | Hardwood Forest Soil | FNQLRWGRGVTICLFMVPILIVGIIFISRYLLRDRK |
Ga0315290_111337001 | 3300031834 | Sediment | TYSYEVAFNQLRWGRGVTISIFLLPLLVVGIALVSRYLLREKDA |
Ga0318511_103967131 | 3300031845 | Soil | YSYEVAFNQLRWGRGVTISIFAVPFLVAGIALVSRYLLRERTA |
Ga0315297_111728762 | 3300031873 | Sediment | SYEVAFNQLRWGRGVTISIFLLPLLVVGIALVSRYLLREKDA |
Ga0310893_100700791 | 3300031892 | Soil | TATQVFATYSYEVAFHQLRWGRGVTISIFAVPLLVAGIALVSRYLLRDRTA |
Ga0307412_110803731 | 3300031911 | Rhizosphere | GTATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLIAGIALVSRYLLRERTA |
Ga0310891_103989731 | 3300031913 | Soil | TQVFATYSYEVAFNALRWGRGVTISIFVVPLLIALIPLVSRYLLRERAA |
Ga0310909_112588601 | 3300031947 | Soil | EVAFNQLRWGRGVTISIFAVPFLVAGIALVSRYLLRERTA |
Ga0307409_1010964422 | 3300031995 | Rhizosphere | TQVFATYSYEVAFNSLRWGRGVTISIFVVPLLIALIPLVSRYLLRERTA |
Ga0307409_1025641792 | 3300031995 | Rhizosphere | TQVFATYSYEVAFNQLRWGRGVTISIFAVPLLIAGIALVSRYLLRERTA |
Ga0315278_114353742 | 3300031997 | Sediment | QVFATYSYEVAFNQLRWGRGVTISIFLLPLLVVGIALVSRYLLREKDA |
Ga0307416_1013309391 | 3300032002 | Rhizosphere | ATQVFATFSYEVAFNSLRWGRGVTVSIFCVPLLIAGIALVSRYLLRDRD |
Ga0318513_102241691 | 3300032065 | Soil | FATYSYEVAFNQLRWGRGVTISIFAVPFLVAGIALVSRYLLRERTA |
Ga0307471_1016577051 | 3300032180 | Hardwood Forest Soil | AFNQLRWGRGVTICLFVVPLLVVGIILISRYLLREKK |
Ga0307471_1025432272 | 3300032180 | Hardwood Forest Soil | NALRWGRGVTISIFVVPLLIALIPLVSRYLLRERAA |
Ga0307471_1026172381 | 3300032180 | Hardwood Forest Soil | FNQLRWGRGVTISIFAVPLLVVGIALVSRYLLRERAV |
Ga0307471_1026254561 | 3300032180 | Hardwood Forest Soil | FNQLRWGRGVTISIYVVPLLIALIPLVSRYLLRERAA |
Ga0310896_106369892 | 3300032211 | Soil | TRGGPGTATQVFATYSYEVAFNQLRWGRGVTISIFAVPLLVAGIALVSRYLLRDRTA |
Ga0315275_101931581 | 3300032401 | Sediment | EVAFNQLRWGRGVTISIFLLPLLVVGIALVSRYLLREKDA |
Ga0335084_112518102 | 3300033004 | Soil | FATYSYEVAFNQLRWGRGVTISIFLLPVLIVGIVLISRYLLRERD |
Ga0326726_102121063 | 3300033433 | Peat Soil | EVAFNQLRWGRGVTVSIFLVPVFIVGIVLISRYLLREKD |
Ga0326726_110339162 | 3300033433 | Peat Soil | GGPGMATQVFATYSYEVAFNQLRWGRGVTISIFLVPALIVGIALISRYLLHEKS |
Ga0326726_111077291 | 3300033433 | Peat Soil | TYSYEVAFNQLRWGRGVTISIFLVPLLVVGIALISRYLLREPR |
Ga0316630_105829631 | 3300033487 | Soil | GTATQLFATYSYEVAFNQLRWGRGVTISIFAVPLLIAGIALIGHYLLREKD |
Ga0314861_0265429_676_783 | 3300033977 | Peatland | NQLRWGRGVTISIFLVPVFIVGIVLISRYLLRERD |
Ga0373950_0108192_1_123 | 3300034818 | Rhizosphere Soil | EVAFNALRWGRGVTISIFVVPLLIALIPLVSRYLLRERAA |
⦗Top⦘ |