Basic Information | |
---|---|
Family ID | F027273 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 195 |
Average Sequence Length | 43 residues |
Representative Sequence | MLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEAEKFYRDL |
Number of Associated Samples | 170 |
Number of Associated Scaffolds | 195 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 92.82 % |
% of genes near scaffold ends (potentially truncated) | 83.08 % |
% of genes from short scaffolds (< 2000 bps) | 82.56 % |
Associated GOLD sequencing projects | 168 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.67 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.487 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.821 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.692 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 28.17% Coil/Unstructured: 59.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 195 Family Scaffolds |
---|---|---|
PF02371 | Transposase_20 | 7.69 |
PF03279 | Lip_A_acyltrans | 1.54 |
PF07676 | PD40 | 1.54 |
PF02687 | FtsX | 1.54 |
PF01548 | DEDD_Tnp_IS110 | 1.54 |
PF00072 | Response_reg | 1.03 |
PF03083 | MtN3_slv | 1.03 |
PF01740 | STAS | 1.03 |
PF13491 | FtsK_4TM | 1.03 |
PF03743 | TrbI | 0.51 |
PF04613 | LpxD | 0.51 |
PF13561 | adh_short_C2 | 0.51 |
PF13847 | Methyltransf_31 | 0.51 |
PF00293 | NUDIX | 0.51 |
PF05016 | ParE_toxin | 0.51 |
PF04055 | Radical_SAM | 0.51 |
PF08546 | ApbA_C | 0.51 |
PF08751 | TrwC | 0.51 |
PF00155 | Aminotran_1_2 | 0.51 |
PF00578 | AhpC-TSA | 0.51 |
PF01747 | ATP-sulfurylase | 0.51 |
PF00535 | Glycos_transf_2 | 0.51 |
PF14319 | Zn_Tnp_IS91 | 0.51 |
PF13174 | TPR_6 | 0.51 |
PF14559 | TPR_19 | 0.51 |
PF12779 | WXXGXW | 0.51 |
PF00872 | Transposase_mut | 0.51 |
PF00589 | Phage_integrase | 0.51 |
PF00005 | ABC_tran | 0.51 |
PF00403 | HMA | 0.51 |
PF04203 | Sortase | 0.51 |
PF00725 | 3HCDH | 0.51 |
PF00664 | ABC_membrane | 0.51 |
PF02803 | Thiolase_C | 0.51 |
PF02563 | Poly_export | 0.51 |
PF13655 | RVT_N | 0.51 |
PF03989 | DNA_gyraseA_C | 0.51 |
PF00328 | His_Phos_2 | 0.51 |
PF00990 | GGDEF | 0.51 |
PF00079 | Serpin | 0.51 |
PF07853 | DUF1648 | 0.51 |
PF00484 | Pro_CA | 0.51 |
PF13649 | Methyltransf_25 | 0.51 |
PF00881 | Nitroreductase | 0.51 |
PF12697 | Abhydrolase_6 | 0.51 |
PF07813 | LTXXQ | 0.51 |
PF07508 | Recombinase | 0.51 |
PF13231 | PMT_2 | 0.51 |
PF13442 | Cytochrome_CBB3 | 0.51 |
PF00882 | Zn_dep_PLPC | 0.51 |
PF11199 | DUF2891 | 0.51 |
PF01865 | PhoU_div | 0.51 |
PF04545 | Sigma70_r4 | 0.51 |
PF09471 | Peptidase_M64 | 0.51 |
PF12713 | DUF3806 | 0.51 |
PF14430 | Imm1 | 0.51 |
PF07732 | Cu-oxidase_3 | 0.51 |
PF13495 | Phage_int_SAM_4 | 0.51 |
PF00561 | Abhydrolase_1 | 0.51 |
COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 9.23 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 2.05 |
COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 1.54 |
COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 1.54 |
COG4095 | Sugar transporter, SemiSWEET family, contains PQ motif | Carbohydrate transport and metabolism [G] | 1.03 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.51 |
COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.51 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.51 |
COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.51 |
COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 0.51 |
COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.51 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.51 |
COG2046 | ATP sulfurylase (sulfate adenylyltransferase) | Inorganic ion transport and metabolism [P] | 0.51 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.51 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.51 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.51 |
COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.51 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.51 |
COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.49 % |
Unclassified | root | N/A | 0.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001546|JGI12659J15293_10051761 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300001593|JGI12635J15846_10610123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10145052 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300005167|Ga0066672_10061828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2187 | Open in IMG/M |
3300005178|Ga0066688_10102456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1751 | Open in IMG/M |
3300005332|Ga0066388_103970299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 754 | Open in IMG/M |
3300005435|Ga0070714_101409306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300005436|Ga0070713_100602301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1044 | Open in IMG/M |
3300005439|Ga0070711_100974707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 726 | Open in IMG/M |
3300005445|Ga0070708_100166309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2057 | Open in IMG/M |
3300005445|Ga0070708_100951970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 806 | Open in IMG/M |
3300005459|Ga0068867_100734114 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300005526|Ga0073909_10593566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
3300005532|Ga0070739_10554123 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005555|Ga0066692_10118055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1596 | Open in IMG/M |
3300005561|Ga0066699_10247970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1256 | Open in IMG/M |
3300005602|Ga0070762_10467384 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300005610|Ga0070763_10516815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300005712|Ga0070764_10241494 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300005938|Ga0066795_10027639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1642 | Open in IMG/M |
3300005952|Ga0080026_10126188 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300006050|Ga0075028_100484662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 720 | Open in IMG/M |
3300006052|Ga0075029_100106236 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300006162|Ga0075030_100021480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5549 | Open in IMG/M |
3300006175|Ga0070712_100000240 | All Organisms → cellular organisms → Bacteria | 30823 | Open in IMG/M |
3300006176|Ga0070765_100585573 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300006176|Ga0070765_102120590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300006797|Ga0066659_10509185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 966 | Open in IMG/M |
3300007258|Ga0099793_10040288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2025 | Open in IMG/M |
3300009029|Ga0066793_10042723 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → unclassified Caldithrix → Caldithrix sp. RBG_13_44_9 | 2553 | Open in IMG/M |
3300009029|Ga0066793_10291422 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300009029|Ga0066793_10427615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
3300009038|Ga0099829_11753095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300009148|Ga0105243_10688097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 995 | Open in IMG/M |
3300009174|Ga0105241_10622439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 977 | Open in IMG/M |
3300009177|Ga0105248_10447780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
3300009524|Ga0116225_1341714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300009621|Ga0116116_1089659 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300009645|Ga0116106_1151179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300009700|Ga0116217_10483680 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300009700|Ga0116217_10567906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300010046|Ga0126384_10060310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2655 | Open in IMG/M |
3300010321|Ga0134067_10201410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
3300010360|Ga0126372_11714747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 670 | Open in IMG/M |
3300010361|Ga0126378_10005517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 9839 | Open in IMG/M |
3300010362|Ga0126377_12036747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300010366|Ga0126379_10072723 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
3300010366|Ga0126379_10537483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1246 | Open in IMG/M |
3300010373|Ga0134128_10894990 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300010400|Ga0134122_10181140 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300011270|Ga0137391_10811514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
3300011271|Ga0137393_10213353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1632 | Open in IMG/M |
3300012096|Ga0137389_11347854 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300012200|Ga0137382_10725984 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 713 | Open in IMG/M |
3300012201|Ga0137365_10263811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1279 | Open in IMG/M |
3300012201|Ga0137365_10874715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 656 | Open in IMG/M |
3300012209|Ga0137379_10436016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1219 | Open in IMG/M |
3300012212|Ga0150985_120550182 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300012354|Ga0137366_10741480 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012361|Ga0137360_11278644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300012683|Ga0137398_10851792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300012922|Ga0137394_10807209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 786 | Open in IMG/M |
3300012923|Ga0137359_10748971 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300012929|Ga0137404_10925776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 795 | Open in IMG/M |
3300012944|Ga0137410_11282535 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012944|Ga0137410_11889540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300012955|Ga0164298_11674426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 504 | Open in IMG/M |
3300012957|Ga0164303_10535932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 757 | Open in IMG/M |
3300012961|Ga0164302_10138056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
3300012971|Ga0126369_10280961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1655 | Open in IMG/M |
3300012986|Ga0164304_10320761 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300012986|Ga0164304_10493650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
3300013306|Ga0163162_11351219 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300014052|Ga0120109_1169270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300014156|Ga0181518_10241779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 921 | Open in IMG/M |
3300014501|Ga0182024_10005865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 27251 | Open in IMG/M |
3300014501|Ga0182024_10089079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4552 | Open in IMG/M |
3300014838|Ga0182030_10339600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1616 | Open in IMG/M |
3300015371|Ga0132258_10094441 | All Organisms → cellular organisms → Bacteria | 7026 | Open in IMG/M |
3300015371|Ga0132258_12161486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1398 | Open in IMG/M |
3300015372|Ga0132256_102845629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300016270|Ga0182036_11472901 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300016371|Ga0182034_11073064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300016445|Ga0182038_10036857 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
3300017822|Ga0187802_10139112 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300017822|Ga0187802_10165729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300017823|Ga0187818_10018827 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
3300017823|Ga0187818_10019227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2925 | Open in IMG/M |
3300017928|Ga0187806_1210498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 662 | Open in IMG/M |
3300017937|Ga0187809_10405144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300017940|Ga0187853_10235712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 844 | Open in IMG/M |
3300017943|Ga0187819_10797512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300017955|Ga0187817_10451549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
3300017959|Ga0187779_10639009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 715 | Open in IMG/M |
3300017974|Ga0187777_11228663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300017994|Ga0187822_10016432 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
3300018006|Ga0187804_10173242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 915 | Open in IMG/M |
3300018007|Ga0187805_10055819 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
3300018007|Ga0187805_10421665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300018014|Ga0187860_1201394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300018022|Ga0187864_10331975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300018029|Ga0187787_10120636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
3300018040|Ga0187862_10006588 | All Organisms → cellular organisms → Bacteria | 10527 | Open in IMG/M |
3300018468|Ga0066662_10028190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3288 | Open in IMG/M |
3300019882|Ga0193713_1109048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300020022|Ga0193733_1024522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1702 | Open in IMG/M |
3300020579|Ga0210407_11465261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300020580|Ga0210403_10006250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10006 | Open in IMG/M |
3300020581|Ga0210399_10135228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2031 | Open in IMG/M |
3300021088|Ga0210404_10599110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 626 | Open in IMG/M |
3300021181|Ga0210388_11363665 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300021344|Ga0193719_10061360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1631 | Open in IMG/M |
3300021420|Ga0210394_10074465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2939 | Open in IMG/M |
3300021559|Ga0210409_10075462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3129 | Open in IMG/M |
3300023056|Ga0233357_1024642 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300024295|Ga0224556_1028182 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300025475|Ga0208478_1049624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300025507|Ga0208188_1065129 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300025898|Ga0207692_10582295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 718 | Open in IMG/M |
3300025914|Ga0207671_11050901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300025928|Ga0207700_10651205 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300025986|Ga0207658_10756955 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300025986|Ga0207658_11246534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 680 | Open in IMG/M |
3300026041|Ga0207639_11484382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 636 | Open in IMG/M |
3300026088|Ga0207641_12461039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 519 | Open in IMG/M |
3300026122|Ga0209926_1051007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300026223|Ga0209840_1003607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3438 | Open in IMG/M |
3300026306|Ga0209468_1110242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
3300026307|Ga0209469_1091816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
3300026308|Ga0209265_1170898 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300026335|Ga0209804_1209859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 796 | Open in IMG/M |
3300026515|Ga0257158_1108977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300026530|Ga0209807_1081724 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300026532|Ga0209160_1158650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
3300026532|Ga0209160_1191696 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300027045|Ga0207726_1035962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300027330|Ga0207777_1037439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
3300027570|Ga0208043_1012003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2870 | Open in IMG/M |
3300027667|Ga0209009_1023540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1505 | Open in IMG/M |
3300027748|Ga0209689_1107753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1424 | Open in IMG/M |
3300027842|Ga0209580_10350850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300027875|Ga0209283_10957899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 513 | Open in IMG/M |
3300027898|Ga0209067_10356480 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300027898|Ga0209067_10416083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300027986|Ga0209168_10006715 | All Organisms → cellular organisms → Bacteria | 7254 | Open in IMG/M |
3300028678|Ga0302165_10113736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300028780|Ga0302225_10349912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300028828|Ga0307312_11122505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300029636|Ga0222749_10358264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
3300029923|Ga0311347_10113654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1682 | Open in IMG/M |
3300030520|Ga0311372_12127783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300030659|Ga0316363_10216126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
3300030838|Ga0311335_11011311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 593 | Open in IMG/M |
3300030906|Ga0302314_11577078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300030916|Ga0075386_12076280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 547 | Open in IMG/M |
3300031152|Ga0307501_10006617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1754 | Open in IMG/M |
3300031525|Ga0302326_10246201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2920 | Open in IMG/M |
3300031546|Ga0318538_10279514 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300031546|Ga0318538_10669959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300031680|Ga0318574_10027592 | All Organisms → cellular organisms → Bacteria | 2839 | Open in IMG/M |
3300031715|Ga0307476_10031076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3549 | Open in IMG/M |
3300031744|Ga0306918_10518867 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300031747|Ga0318502_11029161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300031753|Ga0307477_10511423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300031754|Ga0307475_11233956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 581 | Open in IMG/M |
3300031754|Ga0307475_11352608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
3300031778|Ga0318498_10347945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300031792|Ga0318529_10528367 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300031823|Ga0307478_11819799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300031833|Ga0310917_11045897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 546 | Open in IMG/M |
3300031846|Ga0318512_10690155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300031912|Ga0306921_10139798 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
3300031942|Ga0310916_10196100 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300031942|Ga0310916_10469239 | Not Available | 1072 | Open in IMG/M |
3300031942|Ga0310916_11000437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300031954|Ga0306926_10226069 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300031954|Ga0306926_11629907 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300031962|Ga0307479_10628588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1055 | Open in IMG/M |
3300032001|Ga0306922_11009294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300032044|Ga0318558_10428455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 659 | Open in IMG/M |
3300032054|Ga0318570_10276941 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300032066|Ga0318514_10580742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
3300032160|Ga0311301_10002717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 66604 | Open in IMG/M |
3300032160|Ga0311301_11823896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 722 | Open in IMG/M |
3300032205|Ga0307472_101688097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300032261|Ga0306920_100162068 | All Organisms → cellular organisms → Bacteria | 3334 | Open in IMG/M |
3300032261|Ga0306920_102883171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 652 | Open in IMG/M |
3300032782|Ga0335082_10000176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 64413 | Open in IMG/M |
3300032829|Ga0335070_10060805 | All Organisms → cellular organisms → Bacteria | 4103 | Open in IMG/M |
3300032897|Ga0335071_10182485 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300032954|Ga0335083_10225384 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
3300033134|Ga0335073_10956503 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300033158|Ga0335077_10441536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1389 | Open in IMG/M |
3300033158|Ga0335077_11515752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300033433|Ga0326726_10674551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.59% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.59% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.05% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.05% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.05% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.05% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.54% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.54% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.03% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.03% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.03% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.51% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.51% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.51% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.51% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.51% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.51% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026122 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG (SPAdes) | Environmental | Open in IMG/M |
3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12659J15293_100517611 | 3300001546 | Forest Soil | MLIIGCDYHPGFQQIACVDTDTGELSEHRLAHREEAEAFY |
JGI12635J15846_106101231 | 3300001593 | Forest Soil | MLIIGCDYHPGFQQIAFVETETGEFGERRLAHREEAEQFYGTLKEHSVRV |
JGIcombinedJ51221_101450522 | 3300003505 | Forest Soil | MLIIGCDYHPGFQQIAFVDTDTGELHERRLQHREEGEGFYRDLAAKGMKVRVVVCNRTPSN* |
Ga0066672_100618282 | 3300005167 | Soil | MLIIGCDYHPGFQQIAFVDTDTGELQERRLLHREEAEKFYRDLAA* |
Ga0066688_101024564 | 3300005178 | Soil | MLIIGCDYHPGFQQIASVDTDTGELQERRLLHREEAEKFYRDLAA* |
Ga0066388_1039702992 | 3300005332 | Tropical Forest Soil | MLIVGCDYHPGFQQIAVVDTETGDFLERRLQHREEAEKF* |
Ga0070714_1014093062 | 3300005435 | Agricultural Soil | MLIVGCDYHPGFQQIAFVDTDTGELQERRLQHREEAERFYRDLAARGMKVR |
Ga0070713_1006023012 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGCDHHPGFQQIAFVDAETGECGERRVQHREEAEKFYRELVATGMTVGVGMEARGHAL* |
Ga0070711_1009747071 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIIGCDYHPGFQQIAFVDTETGDYGEQRLAHSEGAEKFYRDL |
Ga0070708_1001663091 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIIGCDYHPGFQQIACVNTETGELSERRLSHREEAEQFYRDLKG |
Ga0070708_1009519701 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIIGCDYHPGFQQIAFIDSESGEWKERRLGHREEAEQFYRDLKVRGVKV |
Ga0068867_1007341141 | 3300005459 | Miscanthus Rhizosphere | MIIVGCDYHPGFQQIAFVDTDSGELQERRLQHCEEAEKFYRNLA |
Ga0073909_105935662 | 3300005526 | Surface Soil | MIIMGVDYHAEFQQLAFVDTDTGELSEARLRNPEQAEQFYRELA |
Ga0070739_105541232 | 3300005532 | Surface Soil | MLIIGCDYHPGFQQIAWADSDTGELSERHLLHREEARAGL |
Ga0066692_101180553 | 3300005555 | Soil | MIIVGCDYHPGFQQIAFVDTDTGELQERRLQHREEAEKFYRDLATQGMKVRVG |
Ga0066699_102479701 | 3300005561 | Soil | YHPGFQQIAFVDTDTGELQERRLLHREEAEKFYRDLAA* |
Ga0070762_104673842 | 3300005602 | Soil | YHPGFQQIAFVDTDTGEFQERRLQHREEAEKFYRDLAASPPD* |
Ga0070763_105168151 | 3300005610 | Soil | MLIIGCDYHPAFQQIAFVDTETGDYGEQRLAHSEGAEKFYR |
Ga0070764_102414941 | 3300005712 | Soil | MLIIGCDYHPAFQQIAFVDTETGDYGEQRLAHSEGAEKFY |
Ga0066795_100276392 | 3300005938 | Soil | MIIIGLDYHPGFQQIAFVDTDTGEFEERHLEHREEAEKFYP* |
Ga0080026_101261881 | 3300005952 | Permafrost Soil | MIIIRMRLSPGFQQIAFVDTDTGELREQRLLHREEGEKFYRDLAAQGAKVHVGMGRAGRSL* |
Ga0075028_1004846621 | 3300006050 | Watersheds | MMIIGCDYHPAFQQIAFVDTATGELQERRLQHREEAEKFYRD |
Ga0075029_1001062362 | 3300006052 | Watersheds | MLIIGCDYHPAFQQIAFVDTDTGDCGERRLQHREEAE |
Ga0075030_1000214801 | 3300006162 | Watersheds | MMIIGCDYHPAFQQIAFVDTDTGELEELRLQHREAAEKFYRNLAAQ |
Ga0070712_1000002401 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLHPTFQQIAFVDTDTGELQERRLEHREEAEKFYRGLGVQGM |
Ga0070765_1005855733 | 3300006176 | Soil | QQIAFVDTDTGEFQERRLQHREEAEKFYRDLAANPPD* |
Ga0070765_1021205901 | 3300006176 | Soil | MFIIGADYHPAFQQIAFVDTDTGELQERRLGHREEAEKFYRDLAAIRRL* |
Ga0066659_105091852 | 3300006797 | Soil | MLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEDD* |
Ga0099793_100402882 | 3300007258 | Vadose Zone Soil | MTIIGCDYRPGFQQIAFVDTETGDYGEQRLEHSEGAEKFYRDLAAQGEGGTSGNGS* |
Ga0066793_100427231 | 3300009029 | Prmafrost Soil | MIIIGLDYHPGFQQIAFVDTDTGEFEERHLEHREEAEKFY |
Ga0066793_102914221 | 3300009029 | Prmafrost Soil | LDYHPGFQQIAFVDTDTGEFEERHLEHREEAEKFYP* |
Ga0066793_104276152 | 3300009029 | Prmafrost Soil | MLIIGLDYHPGFQQIAFVDTDTGELQERRLQHREEAEKFYRDLAAQGMKVSVGMEA |
Ga0099829_117530952 | 3300009038 | Vadose Zone Soil | MIIVGCDYHPGFQQIAFVDTDTGELQERRLQHREEA |
Ga0105243_106880972 | 3300009148 | Miscanthus Rhizosphere | MIIVGCDYHPGFQQIAFVDTDSGELQERRLQHCEEAE |
Ga0105241_106224392 | 3300009174 | Corn Rhizosphere | MLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEA |
Ga0105248_104477801 | 3300009177 | Switchgrass Rhizosphere | MLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEAEKFYRELAASGVKV |
Ga0116225_13417143 | 3300009524 | Peatlands Soil | MLIIGCDYHAGFQQIAWVETETGECGERRVAHREEAEQFYGELKQG |
Ga0116116_10896591 | 3300009621 | Peatland | VDYHPGFQQTAFVDMDTGELQERRLQHREEAEKFYRDLGAQGASV |
Ga0116106_11511791 | 3300009645 | Peatland | MITIGADYHPGFQQIAFVDTDTGELQERRLEHREDAEKFY |
Ga0116217_104836801 | 3300009700 | Peatlands Soil | MLIIGRDYHPGFQQIALVDSETGEVNERRLEHREEAEKFYRDL* |
Ga0116217_105679062 | 3300009700 | Peatlands Soil | MLIIGCDYHPGFQQIAWVETETGECGERRLAHREE |
Ga0126384_100603101 | 3300010046 | Tropical Forest Soil | MIIIGCDYHPGFQEIAFVDTETGDCGEQRLETVRERKS |
Ga0134067_102014103 | 3300010321 | Grasslands Soil | DYHPGFQQIAFVDTDTGELQERRLLHREEAEKFYRDLAA* |
Ga0126372_117147471 | 3300010360 | Tropical Forest Soil | MMIIGCDYHPGFQQIAFVDTDTGEFQEARLQHREQAEKFYRE |
Ga0126378_100055173 | 3300010361 | Tropical Forest Soil | MIFIGCDYHPGFQQIAFVDFETGHCGEQPLEHPSESLGLG* |
Ga0126377_120367472 | 3300010362 | Tropical Forest Soil | MLIIGCDYHPGFQQIAFMDTDSGEFQEQRLAHREEAEKFYRERDQRLL* |
Ga0126379_100727233 | 3300010366 | Tropical Forest Soil | MNIIGCDYHPGFQQIAFVDTETGDYGEQRLQHSEGAEKFYRDLASQGQKVR |
Ga0126379_105374832 | 3300010366 | Tropical Forest Soil | MLIIGCDYHPGFQQIAFVDDVTGDCGEWRLEHREEAEQFYR |
Ga0134128_108949902 | 3300010373 | Terrestrial Soil | MIIIGCDYHPGVQQIAWADTETGEFQETRLQHREAAEQF |
Ga0134122_101811401 | 3300010400 | Terrestrial Soil | MTIIGCDYHPGFQQIAFVDTETGDYGEQRLAHSEGAEK |
Ga0137391_108115143 | 3300011270 | Vadose Zone Soil | MKIIGCDYHTGFQQIAAVDTETGELEERRLQHGEEAEQF |
Ga0137393_102133533 | 3300011271 | Vadose Zone Soil | MMIIGCDYHPAFQQIAFVDTDTGELQERHLQHREEAEKFYRDLAAQGMKVRVGM |
Ga0137389_113478541 | 3300012096 | Vadose Zone Soil | MIIIGCDYLRGFEQIAFVDRDTGEFEERRVEHREEAEKFYR |
Ga0137382_107259842 | 3300012200 | Vadose Zone Soil | MMIIGCDYHPGFPQIAYVNPETGEVRERRLGHKEEAEQFYRELRGRGMQL |
Ga0137365_102638113 | 3300012201 | Vadose Zone Soil | MLIIGCDYHPAFQQIAFVDTDTGELQEGRLQHREEAEKFYRDLAAQG |
Ga0137365_108747151 | 3300012201 | Vadose Zone Soil | MLIIGCDYHPAFQQIAFVDTDTGELQERRRQHREEAEKFYRDL |
Ga0137379_104360161 | 3300012209 | Vadose Zone Soil | MLIIGCNYHPAFQQIAFVDTDTGELQEGRLQHREE |
Ga0150985_1205501823 | 3300012212 | Avena Fatua Rhizosphere | MLIIGCDYHPGFQQIALVDTDTGELSQRRLLHREEAEQFYR |
Ga0137366_107414801 | 3300012354 | Vadose Zone Soil | MLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEAEKFYRDL |
Ga0137360_112786441 | 3300012361 | Vadose Zone Soil | MMIIGCDYHPAFQQIAFVDTDTGELRERRLQHREEAEKFYRDLATQGIKVR |
Ga0137398_108517921 | 3300012683 | Vadose Zone Soil | MKIIGCDYHPGFQQIAFMDTETGELQERRLQHPEEAETFYRELARRE* |
Ga0137394_108072092 | 3300012922 | Vadose Zone Soil | MIIIGCDYHPGFQQIAFVDLDCGELQERRLHHREEAEKF |
Ga0137359_107489712 | 3300012923 | Vadose Zone Soil | MNIIGCDYHPGFQQIAWLDTQTGEVVERRLGHREEA |
Ga0137404_109257762 | 3300012929 | Vadose Zone Soil | MLIIGCDYYPGFQQIAFVDTETGKVGERRLTHREEAEQFYRDLKGRGSTVLGEGP* |
Ga0137410_112825351 | 3300012944 | Vadose Zone Soil | MLIIGCDYHPGFQQIAFLDSESGEWKERRLGHREEAEQFYR |
Ga0137410_118895401 | 3300012944 | Vadose Zone Soil | MMIIGCDYHPGFQQIAFVDMETGELRERRLAHREEAERFYRDLGAHRVS |
Ga0164298_116744261 | 3300012955 | Soil | MLIIGCDYHPGFQQIAFLDTDTGELAERRLAHSDEA |
Ga0164303_105359321 | 3300012957 | Soil | MMIIGCDYHPGFQQIAFVDTDSGELQELRLQHREEAEKFYRDLGAQG |
Ga0164302_101380562 | 3300012961 | Soil | MFIVGCDYHPGFQQIACVETDTGALSGTALGHPEQAEQFYR |
Ga0126369_102809611 | 3300012971 | Tropical Forest Soil | PSFEQIAFVDTDTGEFQEQRLAHREEAKSFIAILRP* |
Ga0164304_103207611 | 3300012986 | Soil | MMIIGCDYHPGFQQLAYVNTDTGELSEGRLGHKQQA |
Ga0164304_104936501 | 3300012986 | Soil | MFIVGCDYHPGFQQIACVETDTGALSGTALGHPEQAEQFYRE |
Ga0163162_113512192 | 3300013306 | Switchgrass Rhizosphere | MIIVGCDYHPGFQQIAFVDTDSGELQERRLQHCEEAEKFYRNLAAQG |
Ga0120109_11692701 | 3300014052 | Permafrost | MLIIGCDYHPGFQQIAFVDSATGELQERRLQHREE |
Ga0181518_102417792 | 3300014156 | Bog | MVIIGCDYHPGFQQIGFVDTETGDYGEQRLEHSEGAEKFYRDLAAQGKKVRVG |
Ga0182024_100058651 | 3300014501 | Permafrost | MLIIGCDYPPAFQQIAFVDTATGDCGERRLEHREEAEKFYRDLAAQGMK |
Ga0182024_100890795 | 3300014501 | Permafrost | MLIIGCDYHPAFQQIAFVDTATGECGERQLEHREEAEKLYRDLAAQGMKVRVG |
Ga0182030_103396004 | 3300014838 | Bog | MIIVGCDYHPGFQQIAFVDCETGDCGERRLEHREEAEKFYRE |
Ga0132258_100944417 | 3300015371 | Arabidopsis Rhizosphere | MLIIGCDYHPGFQQIALVDTDTGELSERRLAHPEQAEQFYRELK |
Ga0132258_121614864 | 3300015371 | Arabidopsis Rhizosphere | MLIIGCDYHPGFQQIAFVAPETGECGERRLAHREEAAQFYRKLSERSLRVRVEIW* |
Ga0132256_1028456291 | 3300015372 | Arabidopsis Rhizosphere | MMIIGCDYHPGFQQIAFIDTETDECGEHRLPHREE |
Ga0182036_114729011 | 3300016270 | Soil | MTIIGCDYHPGFQQIAFVDLETGDCGEQQLKHCEGAEKFYRD |
Ga0182034_110730642 | 3300016371 | Soil | MLIIGLDYHPEFQQIAFVDDETGEFGERQLLHQNGEAEKFYRE |
Ga0182038_100368571 | 3300016445 | Soil | MLCIIGCDYHPGFQQIAFVDTETGDCEEQRLEHCEGAQKFYRDLATQGKKVRVG |
Ga0187802_101391122 | 3300017822 | Freshwater Sediment | MLIIGCDDDPGLQQSAWVDSETGELEERRLVHRQESEWFYPQLI |
Ga0187802_101657292 | 3300017822 | Freshwater Sediment | MVIIGADYHPGFQQIAFVDTDTGEFQERRLQHREEA |
Ga0187818_100188271 | 3300017823 | Freshwater Sediment | MIIVGWDYHPGFQQIAYIAYVDSETGELQERRLGHREEVEKFYRDLA |
Ga0187818_100192271 | 3300017823 | Freshwater Sediment | MIMVGCDYHPGFQQIAFVDTDTGEVQERRLQHRDETEEFYRDLAARGMKV |
Ga0187806_12104981 | 3300017928 | Freshwater Sediment | MMIIGCDYHPAFQQIALVDTDSGELQEWRLQHREEAEKFYRNLAAQGMKVRVEMEASGHARV |
Ga0187809_104051441 | 3300017937 | Freshwater Sediment | MLILGCDYHPGFQQNACVDTDGGKLSEHRLPHREQPSSFTTH |
Ga0187853_102357121 | 3300017940 | Peatland | MITIGADYHPGFQQIAFVDTDTGELQERRLEHREDAEKFYRDL |
Ga0187819_107975122 | 3300017943 | Freshwater Sediment | MMIIGCDYHPAFQQIAFVDTDTGELRERRLQHREEAEKFY |
Ga0187817_104515492 | 3300017955 | Freshwater Sediment | MLIIGCDYHPGFQQIAFVETETGEYGERRLTHREEAEQFYGA |
Ga0187779_106390091 | 3300017959 | Tropical Peatland | MLIIGCDYHPGFQQIAFVDTATGESGEQRLEHVEGAEQFYRDLRARSSEV |
Ga0187777_112286631 | 3300017974 | Tropical Peatland | MLIIGCDYHPGFQQIAFVDTDTGELSERRLGHREQAEQFYRE |
Ga0187822_100164322 | 3300017994 | Freshwater Sediment | MIIIGCDYHPGFRQIAWLDTDTGELSEARLGHKEQAGNPHGVQ |
Ga0187804_101732423 | 3300018006 | Freshwater Sediment | MIIGCDYHPAFQQIALVDTDSGELQEWRLQHREEAEKFYRNLAAQGMK |
Ga0187805_100558192 | 3300018007 | Freshwater Sediment | MLIIGCDYHPGFQQIAFVDAETGECGERRLTHREEAE |
Ga0187805_104216652 | 3300018007 | Freshwater Sediment | MFIIGCDYHPGFQQIACVDTDTGELSERRLAHREQ |
Ga0187860_12013941 | 3300018014 | Peatland | MMIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEAEKFYRNLA |
Ga0187864_103319751 | 3300018022 | Peatland | MIIRGADYHPGFQQIAFVDTDTGELQERRLQHREE |
Ga0187787_101206362 | 3300018029 | Tropical Peatland | MLTMGCDYHPGLQQIAFVDDETGECGERQLAHREEAEPFNGALQQQGLRMRVGM |
Ga0187862_100065889 | 3300018040 | Peatland | MITIGADYHPGFQQIAFVDTDTGELQERRLEHREDAE |
Ga0066662_100281904 | 3300018468 | Grasslands Soil | MLIIGCDYHPGFQQIAFVDTDTGELQERRLLHREEAEKFYRDLAA |
Ga0193713_11090482 | 3300019882 | Soil | MLIIGCDYHPGFQQIAFVDTETGDLGERRLTHREEAEQFYGT |
Ga0193733_10245223 | 3300020022 | Soil | MLIIGCDYHPGFQQIAFVDTDTGELSERRLGHREQ |
Ga0210407_114652611 | 3300020579 | Soil | MIIIECDYHPGFQQIAFVDTDTGECGERRLGHREEAEKFYRDLRAQGA |
Ga0210403_100062503 | 3300020580 | Soil | MIVIGADYHPGFQQIAFVDTDTGEFQERRLQHREEAEKFYRDLAAQGMQVRVGCV |
Ga0210399_101352284 | 3300020581 | Soil | MLIIGCDYRPGFQQIAFVDAETGECGERRLAHRDEAEQFYKAL |
Ga0210404_105991101 | 3300021088 | Soil | MLIIGCDYHPGFQQIAFVDTETGDCGERRLTHREEAEQFYQDLK |
Ga0210388_113636652 | 3300021181 | Soil | MLIIGCEYHPGFQQIAFVDKETGECGERRLSHREEAEQFYRALLGQ |
Ga0193719_100613603 | 3300021344 | Soil | MIIMGCDYHPGLQQIAYGNPDTGELREVRLGHKEEAEQFYRGLKTHGVPVRIGME |
Ga0210394_100744651 | 3300021420 | Soil | MTIGTDFYPGFQQIAFVDTDTGEFQERQLQHREEAEKFYRELAAQGQKV |
Ga0210409_100754621 | 3300021559 | Soil | MLIIGCDYHPGFQQIAWVDTDTGEFQEQRLEHSLEA |
Ga0233357_10246422 | 3300023056 | Soil | MLIIGCDYHPGMQQIAWFDKQSGECGEQRLEHGTG |
Ga0224556_10281824 | 3300024295 | Soil | DFHPEFQQIASVDTDTGEVQEKRLAHREEAEKFYRALAGQKTSGEN |
Ga0208478_10496241 | 3300025475 | Arctic Peat Soil | MLIIGCDYHPGFQQIAFVDQETGECGERRLQHPEEAQ |
Ga0208188_10651291 | 3300025507 | Peatland | MMIIMMIIGCDYHPGFQQIALVDTDTGDCGERRLQHREE |
Ga0207692_105822951 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIIGCDYRPSFQQIAFVDTESGELKEQRLAHREAAE |
Ga0207671_110509012 | 3300025914 | Corn Rhizosphere | MIIVGCDYHPGFQQIAFVDTDSGELQERRLQHCEEAEKFYRNLAAQGMKVR |
Ga0207700_106512052 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIVGCDCHPGFQQIALVDTDTGELSERRFFNREERHF |
Ga0207658_107569552 | 3300025986 | Switchgrass Rhizosphere | QQIAFVNSETGGLEERRLQHREEAEKFYRDLATGGSD |
Ga0207658_112465342 | 3300025986 | Switchgrass Rhizosphere | MLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEAEKFYRELAASGV |
Ga0207639_114843821 | 3300026041 | Corn Rhizosphere | MLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEAE |
Ga0207641_124610391 | 3300026088 | Switchgrass Rhizosphere | MLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEAV |
Ga0209926_10510072 | 3300026122 | Soil | MMIIGCAFHPGFQQIAYVEQETGEYGERRLSHREEA |
Ga0209840_10036071 | 3300026223 | Soil | MIIIGLDYHPGFQQIAFVDTDTGEFEERHLEHREEAEKFYP |
Ga0209468_11102421 | 3300026306 | Soil | MIIVGCDYHPGFQQIAFVDTDTGELQERRLQHREEAEKFYRDL |
Ga0209469_10918161 | 3300026307 | Soil | MIIVGCDYHPGFQQIAFVDTDTGELQERRLQHREE |
Ga0209265_11708982 | 3300026308 | Soil | MLIIGCDYHPGFQQIAFLNTDGGELGERRLAHREEAEQFYGKL |
Ga0209804_12098591 | 3300026335 | Soil | MLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEAERFYRELATRGRKVR |
Ga0257158_11089771 | 3300026515 | Soil | MLIIGCDYHPVFQQIACVDTETGDYGEQRLAHSEGAE |
Ga0209807_10817241 | 3300026530 | Soil | MFIIGCDYHPGFQQIAFVDTDTGELSERRLAHREQA |
Ga0209160_11586501 | 3300026532 | Soil | MIIIGCDYHPGFQQIAFVDTDSGEWNEGKLGHREEA |
Ga0209160_11916961 | 3300026532 | Soil | MMIIGCDYHPAFQQIAFVDTDTGECGEQRLQHREEAEKFYRDLAAQGV |
Ga0207726_10359621 | 3300027045 | Tropical Forest Soil | MLVIGCDYHPGFQQIAFVDDVTGDCGERQLEHREE |
Ga0207777_10374392 | 3300027330 | Tropical Forest Soil | MLVIGCDYHPGFQQIAFVDDVTGDCGERQLEHREEAEQFYRQIGERG |
Ga0208043_10120036 | 3300027570 | Peatlands Soil | MLIIDYHPGFQQIAFVDTESGELNERRLAHREEAERFYQELKQR |
Ga0209009_10235402 | 3300027667 | Forest Soil | MLIIGCDYHPAFEQIAFVDTATGDCGERRLEHREGAEKFYRDLAAQ |
Ga0209689_11077532 | 3300027748 | Soil | MLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEDD |
Ga0209580_103508501 | 3300027842 | Surface Soil | MFIIGCDYHPGFQQIACVDTDTGELGERRLAHREEAEQFYRELK |
Ga0209283_109578991 | 3300027875 | Vadose Zone Soil | MIIIDCDYHPGFQQIAFVDTDSGELQERRLQHREEAETFYRELAAEG |
Ga0209067_103564802 | 3300027898 | Watersheds | MLIIGCDYHPGFQQIAFVDTDTGELKERRLEHREPAEQFYRDL |
Ga0209067_104160831 | 3300027898 | Watersheds | MMIIGCDYHPAFRQIAFLDTDTGELQERRLQHPEEAEQFYRDLSAQG |
Ga0209168_1000671510 | 3300027986 | Surface Soil | MLIIGCDYHPGFQQIAFVDTETGDCGERRLTHREEAE |
Ga0302165_101137362 | 3300028678 | Fen | MLIIGCDYHPGFQQIAFVDTETGDLQERRLEHREE |
Ga0302225_103499123 | 3300028780 | Palsa | MIIIGLDYHPGFQQIAFVDTDTGEIQERRLEHREEAEKF |
Ga0307312_111225052 | 3300028828 | Soil | MVIIGVDLHPEFQQIASVDTETGDVQEKRLAHREEAEAFYRALAGQKVR |
Ga0222749_103582641 | 3300029636 | Soil | MLIIGCDYHPGFQQLAFVDTDTGELKERRLPHREQAEQFYRELRQQSMVVRV |
Ga0311347_101136545 | 3300029923 | Fen | MLIIGCDYHPGFQQIAFVDTETGDLQERRLEHREEAEKFYRELAARGKDI |
Ga0311372_121277831 | 3300030520 | Palsa | MIIGCDYHPGFQQIALVDSETGDLQERRLEHREEAE |
Ga0316363_102161262 | 3300030659 | Peatlands Soil | MLIIGCDYHPGFQQIAWVETETGECGERRLAHREEAEQFY |
Ga0311335_110113111 | 3300030838 | Fen | MLIIGCDYHPGFQQIAFVDTETGDLQERRLEHREEAEKFYRDLAAQGKDI |
Ga0302314_115770781 | 3300030906 | Palsa | MMIIGCDYHPGFQQIALVDSETGDLQERRLEHREEAE |
Ga0075386_120762801 | 3300030916 | Soil | MLIIGCDYHPGFQQIAFVDTESGEVGERRLSHREEAEQFYRELKQR |
Ga0307501_100066171 | 3300031152 | Soil | MIIIGCDYHPGFQQIASVNTDTGDISEARLGHKEQ |
Ga0302326_102462017 | 3300031525 | Palsa | MIIIGLDYHPGFQQIAFVDTDTGEIQERRLEHREEAEKFYRDLGAQGATVRVG |
Ga0318538_102795142 | 3300031546 | Soil | MIIIGCDYPGFQQIAFVDTETGDCGEQRLEHGEGAQKFYRDLATHGKKMRVG |
Ga0318538_106699591 | 3300031546 | Soil | MIIVRCDDHPGFQQIAFVDTDTGELQERRLQHPEEAEPFYRDLAAH |
Ga0318574_100275924 | 3300031680 | Soil | MLCIIGCDYHPGFQQIGFVDTETGDCGEQRLEHCEGAQKFYRDLATQGKKVR |
Ga0307476_100310761 | 3300031715 | Hardwood Forest Soil | EKGADMLIIGCDYHPAFQQIAFVDTATGDCGERRLEHREEAGV |
Ga0306918_105188671 | 3300031744 | Soil | MLIIGCDYHPGFQQIAGVDTDTGELSEHRLAHREQAEQF |
Ga0318502_110291612 | 3300031747 | Soil | MLIIGWDYHPGFQQIACVNSETGECGEQQLEHCAGETEKFYRDLKLR |
Ga0307477_105114232 | 3300031753 | Hardwood Forest Soil | MLIIGCDYHPGFQQIAFVDTDTGELSERRLGHREEAEQFYHELKQR |
Ga0307475_112339561 | 3300031754 | Hardwood Forest Soil | MLIIGCDYHPGFQQIALVDRETGECGEGRLAHREEAEQFYRELKQRG |
Ga0307475_113526082 | 3300031754 | Hardwood Forest Soil | MLIIGCDYHPGVQQIAWVDMETGECGEQRLTHQGGEAEDFYRGLKKREAVCA |
Ga0318498_103479452 | 3300031778 | Soil | MIIIGCDYPGFQQIAFVDTETGDCGEQRLEHGEGAQKFYRDLATHGK |
Ga0318529_105283672 | 3300031792 | Soil | MIIVGCDDHPGLPQIAFVDTDTGELQERRLQHPEEAEPFYRDLAAHGI |
Ga0307478_118197992 | 3300031823 | Hardwood Forest Soil | MLITGCDYHPGFQQIAFVDRETGECGERRLAHRKEI |
Ga0310917_110458971 | 3300031833 | Soil | MLIIGCDDHPGFQQIALVDTETGDCGEQRLEHCEG |
Ga0318512_106901553 | 3300031846 | Soil | MIIVECDDHPGFQQIAFVDTDTGELQERRLQHPEEAEHFYRAWQPKE |
Ga0306921_101397984 | 3300031912 | Soil | MLTIGCDYHPGFQQIACVDTDTGELSERRLAHREQIRISRQSNH |
Ga0310916_101961002 | 3300031942 | Soil | MIIVGCDDHPGLPQIAFVDTDTGELQERRLQHPEEAEPFYRDLAA |
Ga0310916_104692392 | 3300031942 | Soil | MIIVECDDHPGFQQIAFVDTDTGELQERRLQHPEEAEPFYRDLAAHGIK |
Ga0310916_110004371 | 3300031942 | Soil | MLIIGCDYHPGFQQIALVETDTGELGERRLAHREHAEQF |
Ga0306926_102260692 | 3300031954 | Soil | MIIVGCDDHPGLPQIAFVDTDTGELQERRLQHPEEAEPFYRDL |
Ga0306926_116299071 | 3300031954 | Soil | MIIIGTDYHPGFQQIALVDTETGDCVERRLEHCEEAEKFY |
Ga0307479_106285881 | 3300031962 | Hardwood Forest Soil | MLIIGCDYHPGFQQIAFVDTDTGELSERRLGHREQAEQFYRELKQRNL |
Ga0306922_110092941 | 3300032001 | Soil | MIIIGTDYHPGFQQIALVDTETGDCVERRLEHCEEAEKFYRDLAARAV |
Ga0318558_104284551 | 3300032044 | Soil | MIIIGTDYHPGFQQIALVDTETGDCVERRLEHREEAEKFY |
Ga0318570_102769411 | 3300032054 | Soil | MIIVECDDHPGFQQIAFVDTDTGELQERRLQHPEEAEPFYRDLAAHGIKGRVGME |
Ga0318514_105807422 | 3300032066 | Soil | MIIIGTDYHPGFQQIALVDTETGDCVERRLEHCEEAEKFYRDLAARAVPIRFGMEA |
Ga0311301_100027171 | 3300032160 | Peatlands Soil | MLIIGRDYHPGFQQIALVDSETGEVNERRLEHREEAEKFYRDL |
Ga0311301_118238962 | 3300032160 | Peatlands Soil | MIIVGCDYHPGFQQIAFVDTDSGELQERRLQHREEAEKFYRKLAAQG |
Ga0307472_1016880971 | 3300032205 | Hardwood Forest Soil | MIGADYHPGFQQIAFVDTDTGELQERRLQHPEEAEKFYRDLAAQ |
Ga0306920_1001620681 | 3300032261 | Soil | MIIVECDDHPGFQQIAFVDTDTGELQERRLQHPEEAEPFYRDLAA |
Ga0306920_1028831711 | 3300032261 | Soil | MTIIGCDHHPGFQQIAFVDLETGDCGEQQLKHCEGAEKFYRDLASE |
Ga0335082_100001761 | 3300032782 | Soil | VLIIGCDYHPGFQQIACVDTDGGELSEHHLAHREQAEQFYRE |
Ga0335070_100608057 | 3300032829 | Soil | MLIIGCDYHPGFQQIALVDGETGELSERRLLHREQAEQFY |
Ga0335071_101824851 | 3300032897 | Soil | MLIIGCDYHPGFQQIACVDTDGGELSERRLAHREQAEQ |
Ga0335083_102253843 | 3300032954 | Soil | MLIIGLDYHPEFQQIAFVDDETGEFGERQLLHQNGEAEKF |
Ga0335073_109565032 | 3300033134 | Soil | MLIIGCDYHPGFQQSALVDTDTGELSERRLLHREEAEQFYRKLQ |
Ga0335077_104415361 | 3300033158 | Soil | MFIIGCDYHPGFQQIACVDTDTGELSEHRLAHREQAEQFYQGLKQQNLRA |
Ga0335077_115157521 | 3300033158 | Soil | MLIIGCDYHPGFQQIACVDTDGGELSEHHLAHREQAEQFYRELK |
Ga0326726_106745511 | 3300033433 | Peat Soil | MISIGCDYHPGFQQIAWIDTESGELNERRLAHREEAERFYRDLGA |
⦗Top⦘ |