NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027273

Metagenome / Metatranscriptome Family F027273

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027273
Family Type Metagenome / Metatranscriptome
Number of Sequences 195
Average Sequence Length 43 residues
Representative Sequence MLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEAEKFYRDL
Number of Associated Samples 170
Number of Associated Scaffolds 195

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.82 %
% of genes near scaffold ends (potentially truncated) 83.08 %
% of genes from short scaffolds (< 2000 bps) 82.56 %
Associated GOLD sequencing projects 168
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.487 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.821 % of family members)
Environment Ontology (ENVO) Unclassified
(20.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.692 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.68%    β-sheet: 28.17%    Coil/Unstructured: 59.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 195 Family Scaffolds
PF02371Transposase_20 7.69
PF03279Lip_A_acyltrans 1.54
PF07676PD40 1.54
PF02687FtsX 1.54
PF01548DEDD_Tnp_IS110 1.54
PF00072Response_reg 1.03
PF03083MtN3_slv 1.03
PF01740STAS 1.03
PF13491FtsK_4TM 1.03
PF03743TrbI 0.51
PF04613LpxD 0.51
PF13561adh_short_C2 0.51
PF13847Methyltransf_31 0.51
PF00293NUDIX 0.51
PF05016ParE_toxin 0.51
PF04055Radical_SAM 0.51
PF08546ApbA_C 0.51
PF08751TrwC 0.51
PF00155Aminotran_1_2 0.51
PF00578AhpC-TSA 0.51
PF01747ATP-sulfurylase 0.51
PF00535Glycos_transf_2 0.51
PF14319Zn_Tnp_IS91 0.51
PF13174TPR_6 0.51
PF14559TPR_19 0.51
PF12779WXXGXW 0.51
PF00872Transposase_mut 0.51
PF00589Phage_integrase 0.51
PF00005ABC_tran 0.51
PF00403HMA 0.51
PF04203Sortase 0.51
PF007253HCDH 0.51
PF00664ABC_membrane 0.51
PF02803Thiolase_C 0.51
PF02563Poly_export 0.51
PF13655RVT_N 0.51
PF03989DNA_gyraseA_C 0.51
PF00328His_Phos_2 0.51
PF00990GGDEF 0.51
PF00079Serpin 0.51
PF07853DUF1648 0.51
PF00484Pro_CA 0.51
PF13649Methyltransf_25 0.51
PF00881Nitroreductase 0.51
PF12697Abhydrolase_6 0.51
PF07813LTXXQ 0.51
PF07508Recombinase 0.51
PF13231PMT_2 0.51
PF13442Cytochrome_CBB3 0.51
PF00882Zn_dep_PLPC 0.51
PF11199DUF2891 0.51
PF01865PhoU_div 0.51
PF04545Sigma70_r4 0.51
PF09471Peptidase_M64 0.51
PF12713DUF3806 0.51
PF14430Imm1 0.51
PF07732Cu-oxidase_3 0.51
PF13495Phage_int_SAM_4 0.51
PF00561Abhydrolase_1 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 195 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 9.23
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 2.05
COG1560Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis)Lipid transport and metabolism [I] 1.54
COG4261Predicted acyltransferase, LPLAT superfamilyGeneral function prediction only [R] 1.54
COG4095Sugar transporter, SemiSWEET family, contains PQ motifCarbohydrate transport and metabolism [G] 1.03
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.51
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.51
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.51
COG1044UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferaseCell wall/membrane/envelope biogenesis [M] 0.51
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.51
COG1392Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 familyInorganic ion transport and metabolism [P] 0.51
COG1596Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp foldCell wall/membrane/envelope biogenesis [M] 0.51
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.51
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.51
COG2046ATP sulfurylase (sulfate adenylyltransferase)Inorganic ion transport and metabolism [P] 0.51
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.51
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.51
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 0.51
COG2948Type IV secretory pathway, VirB10 componentIntracellular trafficking, secretion, and vesicular transport [U] 0.51
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.51
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 0.51
COG4826Serine protease inhibitorPosttranslational modification, protein turnover, chaperones [O] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.49 %
UnclassifiedrootN/A0.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001546|JGI12659J15293_10051761All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300001593|JGI12635J15846_10610123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300003505|JGIcombinedJ51221_10145052All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300005167|Ga0066672_10061828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2187Open in IMG/M
3300005178|Ga0066688_10102456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1751Open in IMG/M
3300005332|Ga0066388_103970299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae754Open in IMG/M
3300005435|Ga0070714_101409306All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300005436|Ga0070713_100602301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1044Open in IMG/M
3300005439|Ga0070711_100974707All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium726Open in IMG/M
3300005445|Ga0070708_100166309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2057Open in IMG/M
3300005445|Ga0070708_100951970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter806Open in IMG/M
3300005459|Ga0068867_100734114All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300005526|Ga0073909_10593566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae546Open in IMG/M
3300005532|Ga0070739_10554123All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005555|Ga0066692_10118055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1596Open in IMG/M
3300005561|Ga0066699_10247970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1256Open in IMG/M
3300005602|Ga0070762_10467384All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300005610|Ga0070763_10516815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300005712|Ga0070764_10241494All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300005938|Ga0066795_10027639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1642Open in IMG/M
3300005952|Ga0080026_10126188All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300006050|Ga0075028_100484662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium720Open in IMG/M
3300006052|Ga0075029_100106236All Organisms → cellular organisms → Bacteria1690Open in IMG/M
3300006162|Ga0075030_100021480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus5549Open in IMG/M
3300006175|Ga0070712_100000240All Organisms → cellular organisms → Bacteria30823Open in IMG/M
3300006176|Ga0070765_100585573All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300006176|Ga0070765_102120590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300006797|Ga0066659_10509185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.966Open in IMG/M
3300007258|Ga0099793_10040288All Organisms → cellular organisms → Bacteria → Acidobacteria2025Open in IMG/M
3300009029|Ga0066793_10042723All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → unclassified Caldithrix → Caldithrix sp. RBG_13_44_92553Open in IMG/M
3300009029|Ga0066793_10291422All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300009029|Ga0066793_10427615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300009038|Ga0099829_11753095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300009148|Ga0105243_10688097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae995Open in IMG/M
3300009174|Ga0105241_10622439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae977Open in IMG/M
3300009177|Ga0105248_10447780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1455Open in IMG/M
3300009524|Ga0116225_1341714All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300009621|Ga0116116_1089659All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300009645|Ga0116106_1151179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300009700|Ga0116217_10483680All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300009700|Ga0116217_10567906All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300010046|Ga0126384_10060310All Organisms → cellular organisms → Bacteria → Acidobacteria2655Open in IMG/M
3300010321|Ga0134067_10201410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300010360|Ga0126372_11714747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae670Open in IMG/M
3300010361|Ga0126378_10005517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia9839Open in IMG/M
3300010362|Ga0126377_12036747All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300010366|Ga0126379_10072723All Organisms → cellular organisms → Bacteria2941Open in IMG/M
3300010366|Ga0126379_10537483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1246Open in IMG/M
3300010373|Ga0134128_10894990All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300010400|Ga0134122_10181140All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300011270|Ga0137391_10811514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300011271|Ga0137393_10213353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1632Open in IMG/M
3300012096|Ga0137389_11347854All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012200|Ga0137382_10725984All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium713Open in IMG/M
3300012201|Ga0137365_10263811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1279Open in IMG/M
3300012201|Ga0137365_10874715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium656Open in IMG/M
3300012209|Ga0137379_10436016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1219Open in IMG/M
3300012212|Ga0150985_120550182All Organisms → cellular organisms → Bacteria1523Open in IMG/M
3300012354|Ga0137366_10741480All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300012361|Ga0137360_11278644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300012683|Ga0137398_10851792All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300012922|Ga0137394_10807209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae786Open in IMG/M
3300012923|Ga0137359_10748971All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300012929|Ga0137404_10925776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis795Open in IMG/M
3300012944|Ga0137410_11282535All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300012944|Ga0137410_11889540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300012955|Ga0164298_11674426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium504Open in IMG/M
3300012957|Ga0164303_10535932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis757Open in IMG/M
3300012961|Ga0164302_10138056All Organisms → cellular organisms → Bacteria → Acidobacteria1416Open in IMG/M
3300012971|Ga0126369_10280961All Organisms → cellular organisms → Bacteria → Acidobacteria1655Open in IMG/M
3300012986|Ga0164304_10320761All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300012986|Ga0164304_10493650All Organisms → cellular organisms → Bacteria → Acidobacteria892Open in IMG/M
3300013306|Ga0163162_11351219All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300014052|Ga0120109_1169270All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300014156|Ga0181518_10241779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae921Open in IMG/M
3300014501|Ga0182024_10005865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae27251Open in IMG/M
3300014501|Ga0182024_10089079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4552Open in IMG/M
3300014838|Ga0182030_10339600All Organisms → cellular organisms → Bacteria → Acidobacteria1616Open in IMG/M
3300015371|Ga0132258_10094441All Organisms → cellular organisms → Bacteria7026Open in IMG/M
3300015371|Ga0132258_12161486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1398Open in IMG/M
3300015372|Ga0132256_102845629All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300016270|Ga0182036_11472901All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300016371|Ga0182034_11073064All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300016445|Ga0182038_10036857All Organisms → cellular organisms → Bacteria3141Open in IMG/M
3300017822|Ga0187802_10139112All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300017822|Ga0187802_10165729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300017823|Ga0187818_10018827All Organisms → cellular organisms → Bacteria2953Open in IMG/M
3300017823|Ga0187818_10019227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2925Open in IMG/M
3300017928|Ga0187806_1210498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium662Open in IMG/M
3300017937|Ga0187809_10405144All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300017940|Ga0187853_10235712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis844Open in IMG/M
3300017943|Ga0187819_10797512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300017955|Ga0187817_10451549All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300017959|Ga0187779_10639009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium715Open in IMG/M
3300017974|Ga0187777_11228663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300017994|Ga0187822_10016432All Organisms → cellular organisms → Bacteria1850Open in IMG/M
3300018006|Ga0187804_10173242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae915Open in IMG/M
3300018007|Ga0187805_10055819All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300018007|Ga0187805_10421665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300018014|Ga0187860_1201394All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium816Open in IMG/M
3300018022|Ga0187864_10331975All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300018029|Ga0187787_10120636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium862Open in IMG/M
3300018040|Ga0187862_10006588All Organisms → cellular organisms → Bacteria10527Open in IMG/M
3300018468|Ga0066662_10028190All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3288Open in IMG/M
3300019882|Ga0193713_1109048All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
3300020022|Ga0193733_1024522All Organisms → cellular organisms → Bacteria → Acidobacteria1702Open in IMG/M
3300020579|Ga0210407_11465261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300020580|Ga0210403_10006250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10006Open in IMG/M
3300020581|Ga0210399_10135228All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2031Open in IMG/M
3300021088|Ga0210404_10599110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium626Open in IMG/M
3300021181|Ga0210388_11363665All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300021344|Ga0193719_10061360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1631Open in IMG/M
3300021420|Ga0210394_10074465All Organisms → cellular organisms → Bacteria → Acidobacteria2939Open in IMG/M
3300021559|Ga0210409_10075462All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3129Open in IMG/M
3300023056|Ga0233357_1024642All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300024295|Ga0224556_1028182All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300025475|Ga0208478_1049624All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300025507|Ga0208188_1065129All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300025898|Ga0207692_10582295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60718Open in IMG/M
3300025914|Ga0207671_11050901All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300025928|Ga0207700_10651205All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300025986|Ga0207658_10756955All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300025986|Ga0207658_11246534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae680Open in IMG/M
3300026041|Ga0207639_11484382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis636Open in IMG/M
3300026088|Ga0207641_12461039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium519Open in IMG/M
3300026122|Ga0209926_1051007All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300026223|Ga0209840_1003607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3438Open in IMG/M
3300026306|Ga0209468_1110242All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300026307|Ga0209469_1091816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium874Open in IMG/M
3300026308|Ga0209265_1170898All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300026335|Ga0209804_1209859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium796Open in IMG/M
3300026515|Ga0257158_1108977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300026530|Ga0209807_1081724All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300026532|Ga0209160_1158650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1015Open in IMG/M
3300026532|Ga0209160_1191696All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300027045|Ga0207726_1035962All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300027330|Ga0207777_1037439All Organisms → cellular organisms → Bacteria → Acidobacteria878Open in IMG/M
3300027570|Ga0208043_1012003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2870Open in IMG/M
3300027667|Ga0209009_1023540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1505Open in IMG/M
3300027748|Ga0209689_1107753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1424Open in IMG/M
3300027842|Ga0209580_10350850All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300027875|Ga0209283_10957899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium513Open in IMG/M
3300027898|Ga0209067_10356480All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300027898|Ga0209067_10416083All Organisms → cellular organisms → Bacteria → Acidobacteria754Open in IMG/M
3300027986|Ga0209168_10006715All Organisms → cellular organisms → Bacteria7254Open in IMG/M
3300028678|Ga0302165_10113736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300028780|Ga0302225_10349912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300028828|Ga0307312_11122505All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300029636|Ga0222749_10358264All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300029923|Ga0311347_10113654All Organisms → cellular organisms → Bacteria → Proteobacteria1682Open in IMG/M
3300030520|Ga0311372_12127783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300030659|Ga0316363_10216126All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300030838|Ga0311335_11011311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium593Open in IMG/M
3300030906|Ga0302314_11577078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300030916|Ga0075386_12076280All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae547Open in IMG/M
3300031152|Ga0307501_10006617All Organisms → cellular organisms → Bacteria → Acidobacteria1754Open in IMG/M
3300031525|Ga0302326_10246201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2920Open in IMG/M
3300031546|Ga0318538_10279514All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300031546|Ga0318538_10669959All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300031680|Ga0318574_10027592All Organisms → cellular organisms → Bacteria2839Open in IMG/M
3300031715|Ga0307476_10031076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3549Open in IMG/M
3300031744|Ga0306918_10518867All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300031747|Ga0318502_11029161All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300031753|Ga0307477_10511423All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300031754|Ga0307475_11233956All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium581Open in IMG/M
3300031754|Ga0307475_11352608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae550Open in IMG/M
3300031778|Ga0318498_10347945All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300031792|Ga0318529_10528367All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031823|Ga0307478_11819799All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300031833|Ga0310917_11045897All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium546Open in IMG/M
3300031846|Ga0318512_10690155All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300031912|Ga0306921_10139798All Organisms → cellular organisms → Bacteria2828Open in IMG/M
3300031942|Ga0310916_10196100All Organisms → cellular organisms → Bacteria1688Open in IMG/M
3300031942|Ga0310916_10469239Not Available1072Open in IMG/M
3300031942|Ga0310916_11000437All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300031954|Ga0306926_10226069All Organisms → cellular organisms → Bacteria2322Open in IMG/M
3300031954|Ga0306926_11629907All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300031962|Ga0307479_10628588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1055Open in IMG/M
3300032001|Ga0306922_11009294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium858Open in IMG/M
3300032044|Ga0318558_10428455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium659Open in IMG/M
3300032054|Ga0318570_10276941All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300032066|Ga0318514_10580742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae597Open in IMG/M
3300032160|Ga0311301_10002717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae66604Open in IMG/M
3300032160|Ga0311301_11823896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae722Open in IMG/M
3300032205|Ga0307472_101688097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300032261|Ga0306920_100162068All Organisms → cellular organisms → Bacteria3334Open in IMG/M
3300032261|Ga0306920_102883171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium652Open in IMG/M
3300032782|Ga0335082_10000176All Organisms → cellular organisms → Bacteria → Acidobacteria64413Open in IMG/M
3300032829|Ga0335070_10060805All Organisms → cellular organisms → Bacteria4103Open in IMG/M
3300032897|Ga0335071_10182485All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300032954|Ga0335083_10225384All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300033134|Ga0335073_10956503All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300033158|Ga0335077_10441536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1389Open in IMG/M
3300033158|Ga0335077_11515752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300033433|Ga0326726_10674551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium996Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.13%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.59%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.05%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.05%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.05%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.05%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.54%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.54%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.03%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.03%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.03%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.03%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.51%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.51%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.51%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.51%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.51%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.51%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.51%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.51%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025475Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026122Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028678Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12659J15293_1005176113300001546Forest SoilMLIIGCDYHPGFQQIACVDTDTGELSEHRLAHREEAEAFY
JGI12635J15846_1061012313300001593Forest SoilMLIIGCDYHPGFQQIAFVETETGEFGERRLAHREEAEQFYGTLKEHSVRV
JGIcombinedJ51221_1014505223300003505Forest SoilMLIIGCDYHPGFQQIAFVDTDTGELHERRLQHREEGEGFYRDLAAKGMKVRVVVCNRTPSN*
Ga0066672_1006182823300005167SoilMLIIGCDYHPGFQQIAFVDTDTGELQERRLLHREEAEKFYRDLAA*
Ga0066688_1010245643300005178SoilMLIIGCDYHPGFQQIASVDTDTGELQERRLLHREEAEKFYRDLAA*
Ga0066388_10397029923300005332Tropical Forest SoilMLIVGCDYHPGFQQIAVVDTETGDFLERRLQHREEAEKF*
Ga0070714_10140930623300005435Agricultural SoilMLIVGCDYHPGFQQIAFVDTDTGELQERRLQHREEAERFYRDLAARGMKVR
Ga0070713_10060230123300005436Corn, Switchgrass And Miscanthus RhizosphereMQGCDHHPGFQQIAFVDAETGECGERRVQHREEAEKFYRELVATGMTVGVGMEARGHAL*
Ga0070711_10097470713300005439Corn, Switchgrass And Miscanthus RhizosphereMTIIGCDYHPGFQQIAFVDTETGDYGEQRLAHSEGAEKFYRDL
Ga0070708_10016630913300005445Corn, Switchgrass And Miscanthus RhizosphereMIIGCDYHPGFQQIACVNTETGELSERRLSHREEAEQFYRDLKG
Ga0070708_10095197013300005445Corn, Switchgrass And Miscanthus RhizosphereMLIIGCDYHPGFQQIAFIDSESGEWKERRLGHREEAEQFYRDLKVRGVKV
Ga0068867_10073411413300005459Miscanthus RhizosphereMIIVGCDYHPGFQQIAFVDTDSGELQERRLQHCEEAEKFYRNLA
Ga0073909_1059356623300005526Surface SoilMIIMGVDYHAEFQQLAFVDTDTGELSEARLRNPEQAEQFYRELA
Ga0070739_1055412323300005532Surface SoilMLIIGCDYHPGFQQIAWADSDTGELSERHLLHREEARAGL
Ga0066692_1011805533300005555SoilMIIVGCDYHPGFQQIAFVDTDTGELQERRLQHREEAEKFYRDLATQGMKVRVG
Ga0066699_1024797013300005561SoilYHPGFQQIAFVDTDTGELQERRLLHREEAEKFYRDLAA*
Ga0070762_1046738423300005602SoilYHPGFQQIAFVDTDTGEFQERRLQHREEAEKFYRDLAASPPD*
Ga0070763_1051681513300005610SoilMLIIGCDYHPAFQQIAFVDTETGDYGEQRLAHSEGAEKFYR
Ga0070764_1024149413300005712SoilMLIIGCDYHPAFQQIAFVDTETGDYGEQRLAHSEGAEKFY
Ga0066795_1002763923300005938SoilMIIIGLDYHPGFQQIAFVDTDTGEFEERHLEHREEAEKFYP*
Ga0080026_1012618813300005952Permafrost SoilMIIIRMRLSPGFQQIAFVDTDTGELREQRLLHREEGEKFYRDLAAQGAKVHVGMGRAGRSL*
Ga0075028_10048466213300006050WatershedsMMIIGCDYHPAFQQIAFVDTATGELQERRLQHREEAEKFYRD
Ga0075029_10010623623300006052WatershedsMLIIGCDYHPAFQQIAFVDTDTGDCGERRLQHREEAE
Ga0075030_10002148013300006162WatershedsMMIIGCDYHPAFQQIAFVDTDTGELEELRLQHREAAEKFYRNLAAQ
Ga0070712_10000024013300006175Corn, Switchgrass And Miscanthus RhizosphereMRLHPTFQQIAFVDTDTGELQERRLEHREEAEKFYRGLGVQGM
Ga0070765_10058557333300006176SoilQQIAFVDTDTGEFQERRLQHREEAEKFYRDLAANPPD*
Ga0070765_10212059013300006176SoilMFIIGADYHPAFQQIAFVDTDTGELQERRLGHREEAEKFYRDLAAIRRL*
Ga0066659_1050918523300006797SoilMLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEDD*
Ga0099793_1004028823300007258Vadose Zone SoilMTIIGCDYRPGFQQIAFVDTETGDYGEQRLEHSEGAEKFYRDLAAQGEGGTSGNGS*
Ga0066793_1004272313300009029Prmafrost SoilMIIIGLDYHPGFQQIAFVDTDTGEFEERHLEHREEAEKFY
Ga0066793_1029142213300009029Prmafrost SoilLDYHPGFQQIAFVDTDTGEFEERHLEHREEAEKFYP*
Ga0066793_1042761523300009029Prmafrost SoilMLIIGLDYHPGFQQIAFVDTDTGELQERRLQHREEAEKFYRDLAAQGMKVSVGMEA
Ga0099829_1175309523300009038Vadose Zone SoilMIIVGCDYHPGFQQIAFVDTDTGELQERRLQHREEA
Ga0105243_1068809723300009148Miscanthus RhizosphereMIIVGCDYHPGFQQIAFVDTDSGELQERRLQHCEEAE
Ga0105241_1062243923300009174Corn RhizosphereMLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEA
Ga0105248_1044778013300009177Switchgrass RhizosphereMLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEAEKFYRELAASGVKV
Ga0116225_134171433300009524Peatlands SoilMLIIGCDYHAGFQQIAWVETETGECGERRVAHREEAEQFYGELKQG
Ga0116116_108965913300009621PeatlandVDYHPGFQQTAFVDMDTGELQERRLQHREEAEKFYRDLGAQGASV
Ga0116106_115117913300009645PeatlandMITIGADYHPGFQQIAFVDTDTGELQERRLEHREDAEKFY
Ga0116217_1048368013300009700Peatlands SoilMLIIGRDYHPGFQQIALVDSETGEVNERRLEHREEAEKFYRDL*
Ga0116217_1056790623300009700Peatlands SoilMLIIGCDYHPGFQQIAWVETETGECGERRLAHREE
Ga0126384_1006031013300010046Tropical Forest SoilMIIIGCDYHPGFQEIAFVDTETGDCGEQRLETVRERKS
Ga0134067_1020141033300010321Grasslands SoilDYHPGFQQIAFVDTDTGELQERRLLHREEAEKFYRDLAA*
Ga0126372_1171474713300010360Tropical Forest SoilMMIIGCDYHPGFQQIAFVDTDTGEFQEARLQHREQAEKFYRE
Ga0126378_1000551733300010361Tropical Forest SoilMIFIGCDYHPGFQQIAFVDFETGHCGEQPLEHPSESLGLG*
Ga0126377_1203674723300010362Tropical Forest SoilMLIIGCDYHPGFQQIAFMDTDSGEFQEQRLAHREEAEKFYRERDQRLL*
Ga0126379_1007272333300010366Tropical Forest SoilMNIIGCDYHPGFQQIAFVDTETGDYGEQRLQHSEGAEKFYRDLASQGQKVR
Ga0126379_1053748323300010366Tropical Forest SoilMLIIGCDYHPGFQQIAFVDDVTGDCGEWRLEHREEAEQFYR
Ga0134128_1089499023300010373Terrestrial SoilMIIIGCDYHPGVQQIAWADTETGEFQETRLQHREAAEQF
Ga0134122_1018114013300010400Terrestrial SoilMTIIGCDYHPGFQQIAFVDTETGDYGEQRLAHSEGAEK
Ga0137391_1081151433300011270Vadose Zone SoilMKIIGCDYHTGFQQIAAVDTETGELEERRLQHGEEAEQF
Ga0137393_1021335333300011271Vadose Zone SoilMMIIGCDYHPAFQQIAFVDTDTGELQERHLQHREEAEKFYRDLAAQGMKVRVGM
Ga0137389_1134785413300012096Vadose Zone SoilMIIIGCDYLRGFEQIAFVDRDTGEFEERRVEHREEAEKFYR
Ga0137382_1072598423300012200Vadose Zone SoilMMIIGCDYHPGFPQIAYVNPETGEVRERRLGHKEEAEQFYRELRGRGMQL
Ga0137365_1026381133300012201Vadose Zone SoilMLIIGCDYHPAFQQIAFVDTDTGELQEGRLQHREEAEKFYRDLAAQG
Ga0137365_1087471513300012201Vadose Zone SoilMLIIGCDYHPAFQQIAFVDTDTGELQERRRQHREEAEKFYRDL
Ga0137379_1043601613300012209Vadose Zone SoilMLIIGCNYHPAFQQIAFVDTDTGELQEGRLQHREE
Ga0150985_12055018233300012212Avena Fatua RhizosphereMLIIGCDYHPGFQQIALVDTDTGELSQRRLLHREEAEQFYR
Ga0137366_1074148013300012354Vadose Zone SoilMLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEAEKFYRDL
Ga0137360_1127864413300012361Vadose Zone SoilMMIIGCDYHPAFQQIAFVDTDTGELRERRLQHREEAEKFYRDLATQGIKVR
Ga0137398_1085179213300012683Vadose Zone SoilMKIIGCDYHPGFQQIAFMDTETGELQERRLQHPEEAETFYRELARRE*
Ga0137394_1080720923300012922Vadose Zone SoilMIIIGCDYHPGFQQIAFVDLDCGELQERRLHHREEAEKF
Ga0137359_1074897123300012923Vadose Zone SoilMNIIGCDYHPGFQQIAWLDTQTGEVVERRLGHREEA
Ga0137404_1092577623300012929Vadose Zone SoilMLIIGCDYYPGFQQIAFVDTETGKVGERRLTHREEAEQFYRDLKGRGSTVLGEGP*
Ga0137410_1128253513300012944Vadose Zone SoilMLIIGCDYHPGFQQIAFLDSESGEWKERRLGHREEAEQFYR
Ga0137410_1188954013300012944Vadose Zone SoilMMIIGCDYHPGFQQIAFVDMETGELRERRLAHREEAERFYRDLGAHRVS
Ga0164298_1167442613300012955SoilMLIIGCDYHPGFQQIAFLDTDTGELAERRLAHSDEA
Ga0164303_1053593213300012957SoilMMIIGCDYHPGFQQIAFVDTDSGELQELRLQHREEAEKFYRDLGAQG
Ga0164302_1013805623300012961SoilMFIVGCDYHPGFQQIACVETDTGALSGTALGHPEQAEQFYR
Ga0126369_1028096113300012971Tropical Forest SoilPSFEQIAFVDTDTGEFQEQRLAHREEAKSFIAILRP*
Ga0164304_1032076113300012986SoilMMIIGCDYHPGFQQLAYVNTDTGELSEGRLGHKQQA
Ga0164304_1049365013300012986SoilMFIVGCDYHPGFQQIACVETDTGALSGTALGHPEQAEQFYRE
Ga0163162_1135121923300013306Switchgrass RhizosphereMIIVGCDYHPGFQQIAFVDTDSGELQERRLQHCEEAEKFYRNLAAQG
Ga0120109_116927013300014052PermafrostMLIIGCDYHPGFQQIAFVDSATGELQERRLQHREE
Ga0181518_1024177923300014156BogMVIIGCDYHPGFQQIGFVDTETGDYGEQRLEHSEGAEKFYRDLAAQGKKVRVG
Ga0182024_1000586513300014501PermafrostMLIIGCDYPPAFQQIAFVDTATGDCGERRLEHREEAEKFYRDLAAQGMK
Ga0182024_1008907953300014501PermafrostMLIIGCDYHPAFQQIAFVDTATGECGERQLEHREEAEKLYRDLAAQGMKVRVG
Ga0182030_1033960043300014838BogMIIVGCDYHPGFQQIAFVDCETGDCGERRLEHREEAEKFYRE
Ga0132258_1009444173300015371Arabidopsis RhizosphereMLIIGCDYHPGFQQIALVDTDTGELSERRLAHPEQAEQFYRELK
Ga0132258_1216148643300015371Arabidopsis RhizosphereMLIIGCDYHPGFQQIAFVAPETGECGERRLAHREEAAQFYRKLSERSLRVRVEIW*
Ga0132256_10284562913300015372Arabidopsis RhizosphereMMIIGCDYHPGFQQIAFIDTETDECGEHRLPHREE
Ga0182036_1147290113300016270SoilMTIIGCDYHPGFQQIAFVDLETGDCGEQQLKHCEGAEKFYRD
Ga0182034_1107306423300016371SoilMLIIGLDYHPEFQQIAFVDDETGEFGERQLLHQNGEAEKFYRE
Ga0182038_1003685713300016445SoilMLCIIGCDYHPGFQQIAFVDTETGDCEEQRLEHCEGAQKFYRDLATQGKKVRVG
Ga0187802_1013911223300017822Freshwater SedimentMLIIGCDDDPGLQQSAWVDSETGELEERRLVHRQESEWFYPQLI
Ga0187802_1016572923300017822Freshwater SedimentMVIIGADYHPGFQQIAFVDTDTGEFQERRLQHREEA
Ga0187818_1001882713300017823Freshwater SedimentMIIVGWDYHPGFQQIAYIAYVDSETGELQERRLGHREEVEKFYRDLA
Ga0187818_1001922713300017823Freshwater SedimentMIMVGCDYHPGFQQIAFVDTDTGEVQERRLQHRDETEEFYRDLAARGMKV
Ga0187806_121049813300017928Freshwater SedimentMMIIGCDYHPAFQQIALVDTDSGELQEWRLQHREEAEKFYRNLAAQGMKVRVEMEASGHARV
Ga0187809_1040514413300017937Freshwater SedimentMLILGCDYHPGFQQNACVDTDGGKLSEHRLPHREQPSSFTTH
Ga0187853_1023571213300017940PeatlandMITIGADYHPGFQQIAFVDTDTGELQERRLEHREDAEKFYRDL
Ga0187819_1079751223300017943Freshwater SedimentMMIIGCDYHPAFQQIAFVDTDTGELRERRLQHREEAEKFY
Ga0187817_1045154923300017955Freshwater SedimentMLIIGCDYHPGFQQIAFVETETGEYGERRLTHREEAEQFYGA
Ga0187779_1063900913300017959Tropical PeatlandMLIIGCDYHPGFQQIAFVDTATGESGEQRLEHVEGAEQFYRDLRARSSEV
Ga0187777_1122866313300017974Tropical PeatlandMLIIGCDYHPGFQQIAFVDTDTGELSERRLGHREQAEQFYRE
Ga0187822_1001643223300017994Freshwater SedimentMIIIGCDYHPGFRQIAWLDTDTGELSEARLGHKEQAGNPHGVQ
Ga0187804_1017324233300018006Freshwater SedimentMIIGCDYHPAFQQIALVDTDSGELQEWRLQHREEAEKFYRNLAAQGMK
Ga0187805_1005581923300018007Freshwater SedimentMLIIGCDYHPGFQQIAFVDAETGECGERRLTHREEAE
Ga0187805_1042166523300018007Freshwater SedimentMFIIGCDYHPGFQQIACVDTDTGELSERRLAHREQ
Ga0187860_120139413300018014PeatlandMMIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEAEKFYRNLA
Ga0187864_1033197513300018022PeatlandMIIRGADYHPGFQQIAFVDTDTGELQERRLQHREE
Ga0187787_1012063623300018029Tropical PeatlandMLTMGCDYHPGLQQIAFVDDETGECGERQLAHREEAEPFNGALQQQGLRMRVGM
Ga0187862_1000658893300018040PeatlandMITIGADYHPGFQQIAFVDTDTGELQERRLEHREDAE
Ga0066662_1002819043300018468Grasslands SoilMLIIGCDYHPGFQQIAFVDTDTGELQERRLLHREEAEKFYRDLAA
Ga0193713_110904823300019882SoilMLIIGCDYHPGFQQIAFVDTETGDLGERRLTHREEAEQFYGT
Ga0193733_102452233300020022SoilMLIIGCDYHPGFQQIAFVDTDTGELSERRLGHREQ
Ga0210407_1146526113300020579SoilMIIIECDYHPGFQQIAFVDTDTGECGERRLGHREEAEKFYRDLRAQGA
Ga0210403_1000625033300020580SoilMIVIGADYHPGFQQIAFVDTDTGEFQERRLQHREEAEKFYRDLAAQGMQVRVGCV
Ga0210399_1013522843300020581SoilMLIIGCDYRPGFQQIAFVDAETGECGERRLAHRDEAEQFYKAL
Ga0210404_1059911013300021088SoilMLIIGCDYHPGFQQIAFVDTETGDCGERRLTHREEAEQFYQDLK
Ga0210388_1136366523300021181SoilMLIIGCEYHPGFQQIAFVDKETGECGERRLSHREEAEQFYRALLGQ
Ga0193719_1006136033300021344SoilMIIMGCDYHPGLQQIAYGNPDTGELREVRLGHKEEAEQFYRGLKTHGVPVRIGME
Ga0210394_1007446513300021420SoilMTIGTDFYPGFQQIAFVDTDTGEFQERQLQHREEAEKFYRELAAQGQKV
Ga0210409_1007546213300021559SoilMLIIGCDYHPGFQQIAWVDTDTGEFQEQRLEHSLEA
Ga0233357_102464223300023056SoilMLIIGCDYHPGMQQIAWFDKQSGECGEQRLEHGTG
Ga0224556_102818243300024295SoilDFHPEFQQIASVDTDTGEVQEKRLAHREEAEKFYRALAGQKTSGEN
Ga0208478_104962413300025475Arctic Peat SoilMLIIGCDYHPGFQQIAFVDQETGECGERRLQHPEEAQ
Ga0208188_106512913300025507PeatlandMMIIMMIIGCDYHPGFQQIALVDTDTGDCGERRLQHREE
Ga0207692_1058229513300025898Corn, Switchgrass And Miscanthus RhizosphereMLIIGCDYRPSFQQIAFVDTESGELKEQRLAHREAAE
Ga0207671_1105090123300025914Corn RhizosphereMIIVGCDYHPGFQQIAFVDTDSGELQERRLQHCEEAEKFYRNLAAQGMKVR
Ga0207700_1065120523300025928Corn, Switchgrass And Miscanthus RhizosphereMLIVGCDCHPGFQQIALVDTDTGELSERRFFNREERHF
Ga0207658_1075695523300025986Switchgrass RhizosphereQQIAFVNSETGGLEERRLQHREEAEKFYRDLATGGSD
Ga0207658_1124653423300025986Switchgrass RhizosphereMLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEAEKFYRELAASGV
Ga0207639_1148438213300026041Corn RhizosphereMLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEAE
Ga0207641_1246103913300026088Switchgrass RhizosphereMLIVGCDYHPGFQQIAFVDMETGELQERRLAHPEEAV
Ga0209926_105100723300026122SoilMMIIGCAFHPGFQQIAYVEQETGEYGERRLSHREEA
Ga0209840_100360713300026223SoilMIIIGLDYHPGFQQIAFVDTDTGEFEERHLEHREEAEKFYP
Ga0209468_111024213300026306SoilMIIVGCDYHPGFQQIAFVDTDTGELQERRLQHREEAEKFYRDL
Ga0209469_109181613300026307SoilMIIVGCDYHPGFQQIAFVDTDTGELQERRLQHREE
Ga0209265_117089823300026308SoilMLIIGCDYHPGFQQIAFLNTDGGELGERRLAHREEAEQFYGKL
Ga0209804_120985913300026335SoilMLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEAERFYRELATRGRKVR
Ga0257158_110897713300026515SoilMLIIGCDYHPVFQQIACVDTETGDYGEQRLAHSEGAE
Ga0209807_108172413300026530SoilMFIIGCDYHPGFQQIAFVDTDTGELSERRLAHREQA
Ga0209160_115865013300026532SoilMIIIGCDYHPGFQQIAFVDTDSGEWNEGKLGHREEA
Ga0209160_119169613300026532SoilMMIIGCDYHPAFQQIAFVDTDTGECGEQRLQHREEAEKFYRDLAAQGV
Ga0207726_103596213300027045Tropical Forest SoilMLVIGCDYHPGFQQIAFVDDVTGDCGERQLEHREE
Ga0207777_103743923300027330Tropical Forest SoilMLVIGCDYHPGFQQIAFVDDVTGDCGERQLEHREEAEQFYRQIGERG
Ga0208043_101200363300027570Peatlands SoilMLIIDYHPGFQQIAFVDTESGELNERRLAHREEAERFYQELKQR
Ga0209009_102354023300027667Forest SoilMLIIGCDYHPAFEQIAFVDTATGDCGERRLEHREGAEKFYRDLAAQ
Ga0209689_110775323300027748SoilMLIIGCDYHPAFQQIAFVDTDTGELQERRLQHREEDD
Ga0209580_1035085013300027842Surface SoilMFIIGCDYHPGFQQIACVDTDTGELGERRLAHREEAEQFYRELK
Ga0209283_1095789913300027875Vadose Zone SoilMIIIDCDYHPGFQQIAFVDTDSGELQERRLQHREEAETFYRELAAEG
Ga0209067_1035648023300027898WatershedsMLIIGCDYHPGFQQIAFVDTDTGELKERRLEHREPAEQFYRDL
Ga0209067_1041608313300027898WatershedsMMIIGCDYHPAFRQIAFLDTDTGELQERRLQHPEEAEQFYRDLSAQG
Ga0209168_10006715103300027986Surface SoilMLIIGCDYHPGFQQIAFVDTETGDCGERRLTHREEAE
Ga0302165_1011373623300028678FenMLIIGCDYHPGFQQIAFVDTETGDLQERRLEHREE
Ga0302225_1034991233300028780PalsaMIIIGLDYHPGFQQIAFVDTDTGEIQERRLEHREEAEKF
Ga0307312_1112250523300028828SoilMVIIGVDLHPEFQQIASVDTETGDVQEKRLAHREEAEAFYRALAGQKVR
Ga0222749_1035826413300029636SoilMLIIGCDYHPGFQQLAFVDTDTGELKERRLPHREQAEQFYRELRQQSMVVRV
Ga0311347_1011365453300029923FenMLIIGCDYHPGFQQIAFVDTETGDLQERRLEHREEAEKFYRELAARGKDI
Ga0311372_1212778313300030520PalsaMIIGCDYHPGFQQIALVDSETGDLQERRLEHREEAE
Ga0316363_1021612623300030659Peatlands SoilMLIIGCDYHPGFQQIAWVETETGECGERRLAHREEAEQFY
Ga0311335_1101131113300030838FenMLIIGCDYHPGFQQIAFVDTETGDLQERRLEHREEAEKFYRDLAAQGKDI
Ga0302314_1157707813300030906PalsaMMIIGCDYHPGFQQIALVDSETGDLQERRLEHREEAE
Ga0075386_1207628013300030916SoilMLIIGCDYHPGFQQIAFVDTESGEVGERRLSHREEAEQFYRELKQR
Ga0307501_1000661713300031152SoilMIIIGCDYHPGFQQIASVNTDTGDISEARLGHKEQ
Ga0302326_1024620173300031525PalsaMIIIGLDYHPGFQQIAFVDTDTGEIQERRLEHREEAEKFYRDLGAQGATVRVG
Ga0318538_1027951423300031546SoilMIIIGCDYPGFQQIAFVDTETGDCGEQRLEHGEGAQKFYRDLATHGKKMRVG
Ga0318538_1066995913300031546SoilMIIVRCDDHPGFQQIAFVDTDTGELQERRLQHPEEAEPFYRDLAAH
Ga0318574_1002759243300031680SoilMLCIIGCDYHPGFQQIGFVDTETGDCGEQRLEHCEGAQKFYRDLATQGKKVR
Ga0307476_1003107613300031715Hardwood Forest SoilEKGADMLIIGCDYHPAFQQIAFVDTATGDCGERRLEHREEAGV
Ga0306918_1051886713300031744SoilMLIIGCDYHPGFQQIAGVDTDTGELSEHRLAHREQAEQF
Ga0318502_1102916123300031747SoilMLIIGWDYHPGFQQIACVNSETGECGEQQLEHCAGETEKFYRDLKLR
Ga0307477_1051142323300031753Hardwood Forest SoilMLIIGCDYHPGFQQIAFVDTDTGELSERRLGHREEAEQFYHELKQR
Ga0307475_1123395613300031754Hardwood Forest SoilMLIIGCDYHPGFQQIALVDRETGECGEGRLAHREEAEQFYRELKQRG
Ga0307475_1135260823300031754Hardwood Forest SoilMLIIGCDYHPGVQQIAWVDMETGECGEQRLTHQGGEAEDFYRGLKKREAVCA
Ga0318498_1034794523300031778SoilMIIIGCDYPGFQQIAFVDTETGDCGEQRLEHGEGAQKFYRDLATHGK
Ga0318529_1052836723300031792SoilMIIVGCDDHPGLPQIAFVDTDTGELQERRLQHPEEAEPFYRDLAAHGI
Ga0307478_1181979923300031823Hardwood Forest SoilMLITGCDYHPGFQQIAFVDRETGECGERRLAHRKEI
Ga0310917_1104589713300031833SoilMLIIGCDDHPGFQQIALVDTETGDCGEQRLEHCEG
Ga0318512_1069015533300031846SoilMIIVECDDHPGFQQIAFVDTDTGELQERRLQHPEEAEHFYRAWQPKE
Ga0306921_1013979843300031912SoilMLTIGCDYHPGFQQIACVDTDTGELSERRLAHREQIRISRQSNH
Ga0310916_1019610023300031942SoilMIIVGCDDHPGLPQIAFVDTDTGELQERRLQHPEEAEPFYRDLAA
Ga0310916_1046923923300031942SoilMIIVECDDHPGFQQIAFVDTDTGELQERRLQHPEEAEPFYRDLAAHGIK
Ga0310916_1100043713300031942SoilMLIIGCDYHPGFQQIALVETDTGELGERRLAHREHAEQF
Ga0306926_1022606923300031954SoilMIIVGCDDHPGLPQIAFVDTDTGELQERRLQHPEEAEPFYRDL
Ga0306926_1162990713300031954SoilMIIIGTDYHPGFQQIALVDTETGDCVERRLEHCEEAEKFY
Ga0307479_1062858813300031962Hardwood Forest SoilMLIIGCDYHPGFQQIAFVDTDTGELSERRLGHREQAEQFYRELKQRNL
Ga0306922_1100929413300032001SoilMIIIGTDYHPGFQQIALVDTETGDCVERRLEHCEEAEKFYRDLAARAV
Ga0318558_1042845513300032044SoilMIIIGTDYHPGFQQIALVDTETGDCVERRLEHREEAEKFY
Ga0318570_1027694113300032054SoilMIIVECDDHPGFQQIAFVDTDTGELQERRLQHPEEAEPFYRDLAAHGIKGRVGME
Ga0318514_1058074223300032066SoilMIIIGTDYHPGFQQIALVDTETGDCVERRLEHCEEAEKFYRDLAARAVPIRFGMEA
Ga0311301_1000271713300032160Peatlands SoilMLIIGRDYHPGFQQIALVDSETGEVNERRLEHREEAEKFYRDL
Ga0311301_1182389623300032160Peatlands SoilMIIVGCDYHPGFQQIAFVDTDSGELQERRLQHREEAEKFYRKLAAQG
Ga0307472_10168809713300032205Hardwood Forest SoilMIGADYHPGFQQIAFVDTDTGELQERRLQHPEEAEKFYRDLAAQ
Ga0306920_10016206813300032261SoilMIIVECDDHPGFQQIAFVDTDTGELQERRLQHPEEAEPFYRDLAA
Ga0306920_10288317113300032261SoilMTIIGCDHHPGFQQIAFVDLETGDCGEQQLKHCEGAEKFYRDLASE
Ga0335082_1000017613300032782SoilVLIIGCDYHPGFQQIACVDTDGGELSEHHLAHREQAEQFYRE
Ga0335070_1006080573300032829SoilMLIIGCDYHPGFQQIALVDGETGELSERRLLHREQAEQFY
Ga0335071_1018248513300032897SoilMLIIGCDYHPGFQQIACVDTDGGELSERRLAHREQAEQ
Ga0335083_1022538433300032954SoilMLIIGLDYHPEFQQIAFVDDETGEFGERQLLHQNGEAEKF
Ga0335073_1095650323300033134SoilMLIIGCDYHPGFQQSALVDTDTGELSERRLLHREEAEQFYRKLQ
Ga0335077_1044153613300033158SoilMFIIGCDYHPGFQQIACVDTDTGELSEHRLAHREQAEQFYQGLKQQNLRA
Ga0335077_1151575213300033158SoilMLIIGCDYHPGFQQIACVDTDGGELSEHHLAHREQAEQFYRELK
Ga0326726_1067455113300033433Peat SoilMISIGCDYHPGFQQIAWIDTESGELNERRLAHREEAERFYRDLGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.