Basic Information | |
---|---|
Family ID | F027350 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 195 |
Average Sequence Length | 43 residues |
Representative Sequence | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPASEAAV |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 195 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 72.19 % |
% of genes near scaffold ends (potentially truncated) | 73.85 % |
% of genes from short scaffolds (< 2000 bps) | 89.74 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.538 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.487 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.359 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.385 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.54% Coil/Unstructured: 72.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 195 Family Scaffolds |
---|---|---|
PF01068 | DNA_ligase_A_M | 11.28 |
PF13546 | DDE_5 | 2.56 |
PF12832 | MFS_1_like | 1.54 |
PF04519 | Bactofilin | 1.54 |
PF03401 | TctC | 1.03 |
PF00873 | ACR_tran | 1.03 |
PF04392 | ABC_sub_bind | 1.03 |
PF01255 | Prenyltransf | 1.03 |
PF08734 | GYD | 1.03 |
PF00924 | MS_channel | 1.03 |
PF05368 | NmrA | 0.51 |
PF00034 | Cytochrom_C | 0.51 |
PF14022 | DUF4238 | 0.51 |
PF13545 | HTH_Crp_2 | 0.51 |
PF00027 | cNMP_binding | 0.51 |
PF13701 | DDE_Tnp_1_4 | 0.51 |
PF00211 | Guanylate_cyc | 0.51 |
PF03476 | MOSC_N | 0.51 |
PF03992 | ABM | 0.51 |
PF05974 | DUF892 | 0.51 |
PF13467 | RHH_4 | 0.51 |
PF00436 | SSB | 0.51 |
PF04909 | Amidohydro_2 | 0.51 |
PF13384 | HTH_23 | 0.51 |
PF00303 | Thymidylat_synt | 0.51 |
PF05872 | HerA_C | 0.51 |
PF04679 | DNA_ligase_A_C | 0.51 |
PF13505 | OMP_b-brl | 0.51 |
PF13676 | TIR_2 | 0.51 |
PF12974 | Phosphonate-bd | 0.51 |
PF03928 | HbpS-like | 0.51 |
PF00346 | Complex1_49kDa | 0.51 |
PF11953 | DUF3470 | 0.51 |
PF00561 | Abhydrolase_1 | 0.51 |
COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
---|---|---|---|
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 11.79 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 11.28 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 1.54 |
COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 1.03 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.03 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.03 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.03 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.03 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.03 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.51 |
COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.51 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.51 |
COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.51 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.51 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.51 |
COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.51 |
COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.51 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.54 % |
Unclassified | root | N/A | 18.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c0539446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
3300000156|NODE_c0726019 | All Organisms → cellular organisms → Bacteria | 6798 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100549907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1017373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1084 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1034343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 732 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10030513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
3300000955|JGI1027J12803_108914821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
3300001431|F14TB_103291410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
3300004081|Ga0063454_100999829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
3300004153|Ga0063455_101232949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
3300004633|Ga0066395_11044830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
3300005167|Ga0066672_10850161 | Not Available | 569 | Open in IMG/M |
3300005332|Ga0066388_100633643 | Not Available | 1686 | Open in IMG/M |
3300005332|Ga0066388_101115977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1337 | Open in IMG/M |
3300005332|Ga0066388_107524467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
3300005332|Ga0066388_108231615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 520 | Open in IMG/M |
3300005366|Ga0070659_100864829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
3300005471|Ga0070698_101338029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 667 | Open in IMG/M |
3300005518|Ga0070699_101848429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 553 | Open in IMG/M |
3300005544|Ga0070686_100315392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1164 | Open in IMG/M |
3300005556|Ga0066707_10860874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
3300005557|Ga0066704_10167438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1478 | Open in IMG/M |
3300005713|Ga0066905_100791090 | Not Available | 822 | Open in IMG/M |
3300005713|Ga0066905_101463079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
3300005713|Ga0066905_101701403 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300005713|Ga0066905_102312624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
3300005764|Ga0066903_100162450 | All Organisms → cellular organisms → Bacteria | 3242 | Open in IMG/M |
3300005764|Ga0066903_100169089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3192 | Open in IMG/M |
3300005764|Ga0066903_102687460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
3300005764|Ga0066903_103072206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
3300005764|Ga0066903_103499304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
3300005764|Ga0066903_103755510 | Not Available | 816 | Open in IMG/M |
3300005764|Ga0066903_103950955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
3300005764|Ga0066903_104673868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
3300005764|Ga0066903_105566391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
3300005764|Ga0066903_106250202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
3300005764|Ga0066903_106733235 | Not Available | 597 | Open in IMG/M |
3300005764|Ga0066903_106989691 | Not Available | 585 | Open in IMG/M |
3300005764|Ga0066903_108077653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300005764|Ga0066903_108749537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
3300005764|Ga0066903_109093831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300006049|Ga0075417_10547863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
3300006606|Ga0074062_12657948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1264 | Open in IMG/M |
3300006871|Ga0075434_101275450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
3300006871|Ga0075434_101740436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
3300006880|Ga0075429_100681083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 901 | Open in IMG/M |
3300006904|Ga0075424_102493726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 542 | Open in IMG/M |
3300009089|Ga0099828_10534155 | Not Available | 1057 | Open in IMG/M |
3300009137|Ga0066709_102298339 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300009147|Ga0114129_10592409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1437 | Open in IMG/M |
3300009147|Ga0114129_11989493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
3300009156|Ga0111538_10276997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2123 | Open in IMG/M |
3300009162|Ga0075423_13103425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 509 | Open in IMG/M |
3300009553|Ga0105249_13027008 | Not Available | 540 | Open in IMG/M |
3300010043|Ga0126380_11669895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
3300010046|Ga0126384_10161978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1734 | Open in IMG/M |
3300010046|Ga0126384_10690156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 903 | Open in IMG/M |
3300010046|Ga0126384_10702226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 896 | Open in IMG/M |
3300010046|Ga0126384_10766203 | Not Available | 861 | Open in IMG/M |
3300010046|Ga0126384_12014209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
3300010047|Ga0126382_10722568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 838 | Open in IMG/M |
3300010047|Ga0126382_11331465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
3300010048|Ga0126373_11009336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 897 | Open in IMG/M |
3300010159|Ga0099796_10390799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
3300010333|Ga0134080_10236375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
3300010337|Ga0134062_10664057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300010361|Ga0126378_12474924 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300010361|Ga0126378_13424836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
3300010362|Ga0126377_12381391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300010366|Ga0126379_10362811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1484 | Open in IMG/M |
3300010366|Ga0126379_11307941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
3300010366|Ga0126379_13414924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
3300010376|Ga0126381_101888598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 861 | Open in IMG/M |
3300010376|Ga0126381_103578511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
3300010398|Ga0126383_10802578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1024 | Open in IMG/M |
3300010398|Ga0126383_11784507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
3300010398|Ga0126383_13057909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 546 | Open in IMG/M |
3300010863|Ga0124850_1093853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
3300011106|Ga0151489_1111276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
3300012200|Ga0137382_10144851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1606 | Open in IMG/M |
3300012201|Ga0137365_10107545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2098 | Open in IMG/M |
3300012204|Ga0137374_10400817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1091 | Open in IMG/M |
3300012205|Ga0137362_10650721 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300012206|Ga0137380_10292839 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300012211|Ga0137377_10185504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1997 | Open in IMG/M |
3300012211|Ga0137377_10749801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
3300012211|Ga0137377_11138279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
3300012211|Ga0137377_11948672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
3300012350|Ga0137372_10856149 | Not Available | 649 | Open in IMG/M |
3300012356|Ga0137371_10728923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
3300012357|Ga0137384_10708301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 817 | Open in IMG/M |
3300012359|Ga0137385_11626228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
3300012361|Ga0137360_10992924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 724 | Open in IMG/M |
3300012918|Ga0137396_10289603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1210 | Open in IMG/M |
3300014969|Ga0157376_12806085 | Not Available | 527 | Open in IMG/M |
3300015242|Ga0137412_10292756 | Not Available | 1279 | Open in IMG/M |
3300015372|Ga0132256_100431034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1423 | Open in IMG/M |
3300015372|Ga0132256_101799840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
3300016294|Ga0182041_10740344 | Not Available | 874 | Open in IMG/M |
3300016319|Ga0182033_10273516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1383 | Open in IMG/M |
3300016319|Ga0182033_11157864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
3300016319|Ga0182033_11183996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 684 | Open in IMG/M |
3300016341|Ga0182035_10165812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1714 | Open in IMG/M |
3300016341|Ga0182035_10433002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1111 | Open in IMG/M |
3300016357|Ga0182032_10658215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
3300016387|Ga0182040_10974508 | Not Available | 706 | Open in IMG/M |
3300016404|Ga0182037_12005548 | Not Available | 519 | Open in IMG/M |
3300016422|Ga0182039_10589880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 970 | Open in IMG/M |
3300016422|Ga0182039_12007791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
3300016445|Ga0182038_11044541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
3300016445|Ga0182038_11590583 | Not Available | 588 | Open in IMG/M |
3300018072|Ga0184635_10078894 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300018073|Ga0184624_10417868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300018081|Ga0184625_10358185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
3300018431|Ga0066655_11249722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
3300018468|Ga0066662_11164652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
3300018469|Ga0190270_10204348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1673 | Open in IMG/M |
3300021405|Ga0210387_11820062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 513 | Open in IMG/M |
3300021560|Ga0126371_10545427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1308 | Open in IMG/M |
3300021560|Ga0126371_12271508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 655 | Open in IMG/M |
3300022694|Ga0222623_10193697 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300025910|Ga0207684_10587971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
3300025916|Ga0207663_10949755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
3300025922|Ga0207646_11944502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
3300025945|Ga0207679_10633781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 966 | Open in IMG/M |
3300026304|Ga0209240_1261025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300026326|Ga0209801_1307329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
3300026538|Ga0209056_10085784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2632 | Open in IMG/M |
3300027548|Ga0209523_1056524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
3300027643|Ga0209076_1209995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
3300027654|Ga0209799_1019019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1503 | Open in IMG/M |
3300027654|Ga0209799_1058285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
3300027875|Ga0209283_10543899 | Not Available | 742 | Open in IMG/M |
3300029636|Ga0222749_10315149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 812 | Open in IMG/M |
3300031170|Ga0307498_10080432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
3300031544|Ga0318534_10168669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
3300031545|Ga0318541_10161474 | Not Available | 1233 | Open in IMG/M |
3300031546|Ga0318538_10245351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
3300031546|Ga0318538_10499225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 659 | Open in IMG/M |
3300031561|Ga0318528_10118422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1399 | Open in IMG/M |
3300031564|Ga0318573_10126407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1329 | Open in IMG/M |
3300031564|Ga0318573_10198998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
3300031572|Ga0318515_10182388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1123 | Open in IMG/M |
3300031572|Ga0318515_10662948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
3300031572|Ga0318515_10764147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300031573|Ga0310915_10262778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1215 | Open in IMG/M |
3300031668|Ga0318542_10028032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2396 | Open in IMG/M |
3300031680|Ga0318574_10410397 | Not Available | 791 | Open in IMG/M |
3300031719|Ga0306917_10538764 | Not Available | 917 | Open in IMG/M |
3300031719|Ga0306917_10754209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
3300031719|Ga0306917_10819655 | Not Available | 729 | Open in IMG/M |
3300031719|Ga0306917_10840159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
3300031740|Ga0307468_100892098 | Not Available | 770 | Open in IMG/M |
3300031744|Ga0306918_11500084 | Not Available | 515 | Open in IMG/M |
3300031764|Ga0318535_10334981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
3300031768|Ga0318509_10773703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
3300031771|Ga0318546_10567637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 797 | Open in IMG/M |
3300031777|Ga0318543_10458052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
3300031792|Ga0318529_10275450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 783 | Open in IMG/M |
3300031793|Ga0318548_10165592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1080 | Open in IMG/M |
3300031797|Ga0318550_10055637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1788 | Open in IMG/M |
3300031798|Ga0318523_10102659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1403 | Open in IMG/M |
3300031798|Ga0318523_10341736 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300031805|Ga0318497_10411906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 756 | Open in IMG/M |
3300031833|Ga0310917_10302951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
3300031845|Ga0318511_10138483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1058 | Open in IMG/M |
3300031860|Ga0318495_10409015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
3300031879|Ga0306919_10062199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2514 | Open in IMG/M |
3300031890|Ga0306925_10543040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1233 | Open in IMG/M |
3300031910|Ga0306923_10840814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
3300031912|Ga0306921_10236873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2138 | Open in IMG/M |
3300031912|Ga0306921_10663489 | Not Available | 1201 | Open in IMG/M |
3300031912|Ga0306921_11072631 | Not Available | 904 | Open in IMG/M |
3300031941|Ga0310912_10431615 | Not Available | 1026 | Open in IMG/M |
3300031942|Ga0310916_10240610 | Not Available | 1523 | Open in IMG/M |
3300031942|Ga0310916_10486345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
3300031946|Ga0310910_10297961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1268 | Open in IMG/M |
3300031947|Ga0310909_11355379 | Not Available | 570 | Open in IMG/M |
3300031954|Ga0306926_10209925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2416 | Open in IMG/M |
3300031959|Ga0318530_10223879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
3300032043|Ga0318556_10092700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1521 | Open in IMG/M |
3300032076|Ga0306924_10246192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2053 | Open in IMG/M |
3300032076|Ga0306924_11543014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 702 | Open in IMG/M |
3300032076|Ga0306924_12289041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
3300032261|Ga0306920_101516632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 956 | Open in IMG/M |
3300032261|Ga0306920_102578307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
3300033290|Ga0318519_10012000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3595 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.28% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.26% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.05% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.54% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.03% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.03% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.51% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.51% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_05394461 | 2228664022 | Soil | MTGKNRIMILGPNPDGTYVVEFRTSKGETLAISVPGDGKIE |
NODE_072601911 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTTTGKNRIMIFGPKTDGTYVVEFRMADGEALAISIPGGEARQSCE* |
INPhiseqgaiiFebDRAFT_1005499072 | 3300000364 | Soil | MTGKNRIMILGPNPDGTYVVEFRTSKGETLAISVPGDGKIE* |
AP72_2010_repI_A01DRAFT_10173731 | 3300000579 | Forest Soil | MTTTGKNRFMIYGPKDDATYVIEFRTAGGEALAISIPRTG |
AP72_2010_repI_A01DRAFT_10343432 | 3300000579 | Forest Soil | MSGKNRIMIYGPKDDGTYVVEFRTAAGEALAISIPGGEARVIR |
AF_2010_repII_A1DRAFT_100305132 | 3300000597 | Forest Soil | MTNDGKNRIIIYGPKRDGTYVVEFKTAAGEALAISVPVSIRS* |
JGI1027J12803_1089148212 | 3300000955 | Soil | MENKNRIMIFGPNPDGTYVVEFRTAKGQTLAISVPSG |
F14TB_1032914101 | 3300001431 | Soil | MTDKNRIMIYGPKNDGTYTVEFKTTAGEALAISVPEPS* |
Ga0063454_1009998292 | 3300004081 | Soil | VTGGKNRIMIYGPKDDGAYVIEFKQAGGEALAISIPSWAMP* |
Ga0063455_1012329492 | 3300004153 | Soil | MTGKNRIMIYGPKDDGTYVNEFRTSEGDVLSISIPRSEGATPLRTR* |
Ga0066395_100417277 | 3300004633 | Tropical Forest Soil | VNGKNRIMIFGAKIDGTYVVEFRTATDEMLAISIPRTETAVIRHF |
Ga0066395_110448301 | 3300004633 | Tropical Forest Soil | MAGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEAAVVRY |
Ga0066672_108501611 | 3300005167 | Soil | MTTAGKNRIMISPKSDGTYVIEFTTAAAESLAISSPGTEAAV |
Ga0066675_111942802 | 3300005187 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPSSEAAVVRYFQERMPY |
Ga0066388_1006336434 | 3300005332 | Tropical Forest Soil | MAMTGKNRIMIYGPKNDGTYIVEFRTAAGEALAISIPSTESSVV* |
Ga0066388_1011159774 | 3300005332 | Tropical Forest Soil | MAMTNDGKNRIIIYGPKRDGTYVVEFKTAAGEALAISVPVSIRS* |
Ga0066388_1075244671 | 3300005332 | Tropical Forest Soil | MSVAPEGGRNRIMIYGPKDDGTYVVEFRTAAGEALAISIPRAECAVIRHF* |
Ga0066388_1082316152 | 3300005332 | Tropical Forest Soil | MTTTGKNRIMIYGPKTDGTYVVEFRTAESKSLAISIREPRLR* |
Ga0070659_1008648292 | 3300005366 | Corn Rhizosphere | MTVTGKNRIMILGPKNDGTYVVEFRTVEGEALAISIPRSEAP* |
Ga0070706_1005652932 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTAKNRIMIFGPKPDGTYVVEFRKGESLAISVPRAPRFAHESR* |
Ga0070698_1013380292 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIYRPKNDGTYIVEFRTAEGKTLAISIPRTETAVIRHFQERM |
Ga0070699_1018484291 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAITPDGKNRIMIFGPKNDGTYVVEFRTAEGESLAISIPRTETAVIRH* |
Ga0070686_1003153922 | 3300005544 | Switchgrass Rhizosphere | VTGGKNRIMIYGPKDDGTYIVEFKTAGGEAMAISIPRSEARVIRHFQ |
Ga0066707_108608741 | 3300005556 | Soil | MTITGKNRIMIYGPKDDGTYVVEFRTAEGDVLSISIPRTEAHVVWH |
Ga0066704_101674381 | 3300005557 | Soil | MTTVGKNRIMIFGPKSDGTYVIEFRTAAGESLAIS |
Ga0066905_1007910902 | 3300005713 | Tropical Forest Soil | MAMTGKNRIMIYGPKDDGTYVVEQTAEGDVLAISIPRSEAHVIRHF* |
Ga0066905_1014630792 | 3300005713 | Tropical Forest Soil | MTGKNRIMIFGPKDDGTYVVEFRTADGEVLSISIPRNETA |
Ga0066905_1017014033 | 3300005713 | Tropical Forest Soil | MTTTGKNRIMIYGPKTDGTYVVEFRTAESKSLAISIRERRLR* |
Ga0066905_1023126242 | 3300005713 | Tropical Forest Soil | MAMTDKNRIMIYGPKNDGTYIVEFKTAAGEALAIEYRPCGP* |
Ga0066903_1001624506 | 3300005764 | Tropical Forest Soil | VAVTGKNRIMIFGPKTDGTYVVEFRTATDEVLAISIPRTETAVS* |
Ga0066903_1001690893 | 3300005764 | Tropical Forest Soil | MGQQEMAMTGKNRILIYGPKNDGTYVVKLTTAAGEALAISIPRSEAAVIPHF |
Ga0066903_1008173093 | 3300005764 | Tropical Forest Soil | IMIFGPKTDGTYVVEFRTAAGEALAISIPRTEASVVTGSNH* |
Ga0066903_1026874602 | 3300005764 | Tropical Forest Soil | MAMNDMNRIMIYGPKNDGTYTVEFRTAAGEALAISIPRTEARVIRHFQETQPSANDVC* |
Ga0066903_1030722063 | 3300005764 | Tropical Forest Soil | MALVVTSNNRITIYGPKDDGTYVVEFRTAEGDVLAISIPRSEAHVIRHF |
Ga0066903_1034993041 | 3300005764 | Tropical Forest Soil | RIMIFGPKTDGTYVVEFRTAAGEALAISIPRTETAVIRY* |
Ga0066903_1037555103 | 3300005764 | Tropical Forest Soil | MAMTGKNRIMIYGPKTDGTYVVGFRTAEGAALAKKP* |
Ga0066903_1039509551 | 3300005764 | Tropical Forest Soil | MAQNESAIMAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPASEAAVVR |
Ga0066903_1046738681 | 3300005764 | Tropical Forest Soil | VTGKNRIMIYGPKTDGTYVVEFRTAEGESLAISIPR |
Ga0066903_1055663911 | 3300005764 | Tropical Forest Soil | MTGKNRIMIYGPKNDGTYVVEFRTAAGAVLAISIPRSE |
Ga0066903_1062502022 | 3300005764 | Tropical Forest Soil | MAVTTAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPASEAA |
Ga0066903_1067332351 | 3300005764 | Tropical Forest Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPASEAAVVRYFQ |
Ga0066903_1069896912 | 3300005764 | Tropical Forest Soil | MAMTGKKRAMIFGPKTDGTYVVEFRTAEGAVLAISIPRSE |
Ga0066903_1080776532 | 3300005764 | Tropical Forest Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPASEAA |
Ga0066903_1087495371 | 3300005764 | Tropical Forest Soil | MTTTSKNRITIYGPKDDGTYVVEFKTAADEVLAISAPAAKHG* |
Ga0066903_1090938311 | 3300005764 | Tropical Forest Soil | MAGNDRIMIFGPKSDGTYVVEFRTAAGETLAISIPPSEAAVVRY |
Ga0075417_105478632 | 3300006049 | Populus Rhizosphere | MAMTMDGKNRIMIYGPKEDGTYVVEFKTAAGQAWAISIPRTETAVI |
Ga0074062_126579481 | 3300006606 | Soil | VTGGKNRIMIYGPKDDGAYVIEFKKAGGEAWRSRS |
Ga0075434_1012754501 | 3300006871 | Populus Rhizosphere | MTPAPKNRIMILGPKDNGTYVVEFRTADGEALAISIPRSEAHVIRHF |
Ga0075434_1017404361 | 3300006871 | Populus Rhizosphere | MTPAPKNRIMIFGPKDDGSYVVEFKTAEGEALAISIPRSEAHVIRHFQ |
Ga0075429_1006810831 | 3300006880 | Populus Rhizosphere | LTAKNRIMIFGPKNDGTYIIEFKTAAGEALTISVPEPS* |
Ga0075424_1024937261 | 3300006904 | Populus Rhizosphere | MTTTGKNRIMIFGLKDNGTYVVEFRTAAGEALAIS |
Ga0099828_105341554 | 3300009089 | Vadose Zone Soil | MAMTEAGKNRIMIFGPKADGTYVIEFRTAAGEALAI |
Ga0066709_1022983392 | 3300009137 | Grasslands Soil | MAMTGKSRIMIYGPKDDGTYVVEFRTAGGETLAISIPRTEMAA* |
Ga0114129_105924093 | 3300009147 | Populus Rhizosphere | MTGRNRIMIYGPKEDGSYVVEFRTADGDVLAISIPRNETAGK* |
Ga0114129_119894931 | 3300009147 | Populus Rhizosphere | MNTTGKNRIMIYGPKSDGTYVIEFRTAAGEALAIS |
Ga0111538_102769973 | 3300009156 | Populus Rhizosphere | MTVTGKNRIMILGPKNDGTYVVEFRTVEGEALAISIPRSEAHVIRHFRSD |
Ga0075423_127339851 | 3300009162 | Populus Rhizosphere | MTGRNRIMIYGPKEDGSYVVEFRTADGEVLLVSIPRDETAVIRHFQAQHAARSVR |
Ga0075423_131034252 | 3300009162 | Populus Rhizosphere | MTVTGKNRIMILGPKNDGTYVVEFRTVEGEALAISIPRS |
Ga0105249_130270082 | 3300009553 | Switchgrass Rhizosphere | MTPAPKNRIMILGPKDNGTYVVEFRTADGEALAISIPRSEAHVIRHFQERM |
Ga0126380_116698951 | 3300010043 | Tropical Forest Soil | MAGKNRIMIFGPKDDGTYVVEFRTASGEALAITIPRNETAVIR |
Ga0126384_101619784 | 3300010046 | Tropical Forest Soil | MMGKNRIMIYGPKNDGTYVVEFRTAAGETLAISIPRTEAAVIRHFQ |
Ga0126384_106901561 | 3300010046 | Tropical Forest Soil | MTGNNQIMICGPKSDGTYVVEFRTAAGETLAISIPASE |
Ga0126384_107022261 | 3300010046 | Tropical Forest Soil | MTTTGKNRIMIYGPKDDGTYVVEFKTAADEVLAIS |
Ga0126384_107662031 | 3300010046 | Tropical Forest Soil | MTNKNRIMIYGPKNDATYVVEFRTAEGEALAISIP |
Ga0126384_120142091 | 3300010046 | Tropical Forest Soil | MTITGKNRIIIYGPKDDGTYVVEFKTAADEVLAISAPGGEARVIRHFQE |
Ga0126382_107225681 | 3300010047 | Tropical Forest Soil | MITAGKNRIMIYGPKDDGTYVVEFRTATGETLAISIP |
Ga0126382_113314651 | 3300010047 | Tropical Forest Soil | MTTTGKNRIMIYGPKNDGTYVVEFRTAAGEALAISIP |
Ga0126373_110093362 | 3300010048 | Tropical Forest Soil | MTSTGKNRIMIYGPKTDGTYIIEFRTADGESLVISVPD* |
Ga0099796_103907991 | 3300010159 | Vadose Zone Soil | MTTVGKNRIMIFGPKSDGTYVIEFRTAAGESLAISIPGTEAAVNNP* |
Ga0134080_102363752 | 3300010333 | Grasslands Soil | MAITPDGKNRIMIFDPKNDGTYVAEFKTAAREALAISIPRTETAVIRHFKIVLLS* |
Ga0134062_106640571 | 3300010337 | Grasslands Soil | MTEGKNRIMIFGPKDDGTYVIEFRTADGDVLAISIPRTEAQPVTAW* |
Ga0126378_124749242 | 3300010361 | Tropical Forest Soil | RARAMITAGKNRIMIFGPKDDGTYVVEFRTAAGEALAISIPRTETA* |
Ga0126378_134248361 | 3300010361 | Tropical Forest Soil | MITAGKNRIIIYGPKDDGTYIVEFRTAAGEALAISIP |
Ga0126377_123813911 | 3300010362 | Tropical Forest Soil | MAGKNRIMIFGSKDDGTYVDEFRTASGEAMAITIPRNETAV |
Ga0126379_103628111 | 3300010366 | Tropical Forest Soil | MTTTSKNRIMIYGPKDDGTYVVEFKTAADEVLAIS |
Ga0126379_113079411 | 3300010366 | Tropical Forest Soil | MTTGKNRIMIYGPKDDGTYVVEFRTAAGEALAISIPRSEAGVIRRPIWCG* |
Ga0126379_134149241 | 3300010366 | Tropical Forest Soil | MALSEGKNRIMIFGPKRVGTYVVEFRTSDGQTLAISVPV |
Ga0126381_1018885981 | 3300010376 | Tropical Forest Soil | SAQRTRAMTSTGKNRIMIYGPKTDGTYIIEFRTADGESLVISVPD* |
Ga0126381_1035785112 | 3300010376 | Tropical Forest Soil | MAMTGKNRIMIYGPKDDGTYIVEFRTAAGEALAISI |
Ga0126383_108025784 | 3300010398 | Tropical Forest Soil | MSVAPPSGQDRIMIYGPKCDGTYVVEFKTAAGEGLGISIPATETRVIRYF |
Ga0126383_117845072 | 3300010398 | Tropical Forest Soil | MMGKNRIMIYGPKDDGTYVVEFKTAAGEAPAISIPGGEA |
Ga0126383_130579092 | 3300010398 | Tropical Forest Soil | MTTTGKNRIMIFGPKADGTYVVEFRTAEGESLAISIPRTETAVIR |
Ga0124850_10938531 | 3300010863 | Tropical Forest Soil | MAMTGKNRIMIYGPKDDGTYIVEFRTAAGEALAISITRSEA |
Ga0151489_11112762 | 3300011106 | Soil | VTGGKNRIMIYGPKDDGAYVIEFKKAGGEALAISIPSWAMP* |
Ga0137382_101448515 | 3300012200 | Vadose Zone Soil | MTTPAGKNRIMIFGPKSDGTYVIEFRTAAGESLAISI |
Ga0137365_101075451 | 3300012201 | Vadose Zone Soil | MAMAGKNRIMIYGPKTDGTYVIEFKTAAGEALAISVPEPS* |
Ga0137374_104008171 | 3300012204 | Vadose Zone Soil | MIEGKNRIIIFGPKADGTYVVEFRTAEGAALAISIPGTEAGVIRYF |
Ga0137362_106507211 | 3300012205 | Vadose Zone Soil | MTAGKNRIMIFGPRTDGTYVVEFRMADGEALAVSIPRTEAA* |
Ga0137380_102928391 | 3300012206 | Vadose Zone Soil | MTTPAGKNRIMIFGPKSDGTYVIEFRTATGESLAISIPGTEAAVIR |
Ga0137377_101855045 | 3300012211 | Vadose Zone Soil | MTTPAGKNRIMIFGPKSDGTYVIEFRTAAGESLAIS |
Ga0137377_107498011 | 3300012211 | Vadose Zone Soil | MAMTVDGKNRIMIFGPKSDGTYVVEFRTAQGAALAI |
Ga0137377_111382791 | 3300012211 | Vadose Zone Soil | MAITAAGKNRIMIFGPRTDGTYVVEFRMADGEALAVSIPRTEAA* |
Ga0137377_119486723 | 3300012211 | Vadose Zone Soil | MTTTGKNRIMIFGPKTDGTYVVELRTAEGESLAISIPR |
Ga0137372_108561491 | 3300012350 | Vadose Zone Soil | MAMTGKNRIMFSKDDGTYVVEFRTAAGEALAISISRTECAV |
Ga0137371_107289232 | 3300012356 | Vadose Zone Soil | MTLTPGSQNRIMIYGPKADGTYLIEFKTTAGEALAISVAER |
Ga0137384_107083011 | 3300012357 | Vadose Zone Soil | MSGKNRIMIYRPKNDGTYIVEFRTAEGKTLAISIPRTETA |
Ga0137385_116262282 | 3300012359 | Vadose Zone Soil | MAMTGKNRIMIFGPKNDGTYIIEFRTAAGEARAISIPR |
Ga0137360_109929241 | 3300012361 | Vadose Zone Soil | MAMTEAGKNRIMFFGPKADGTYVIEFRTAAGEALAISIPRTSRPACLMGSN |
Ga0137396_102896031 | 3300012918 | Vadose Zone Soil | MTTVGKNRIMIFGPKSDGTYVIEFRTAAGESLAISIPGTEAAVIRHFQERM |
Ga0157376_128060852 | 3300014969 | Miscanthus Rhizosphere | MAIEMEGRNRIMIYGPQQDGTYVVEFKTAAGQTLAISIPSSE |
Ga0137412_102927562 | 3300015242 | Vadose Zone Soil | MATTVAGKNRIMIYGPKEDGTYVIEFKTAAGEARTARSLP* |
Ga0132256_1004310343 | 3300015372 | Arabidopsis Rhizosphere | MTGRNRIMIYGPKEDGSYVVEFRTADSEVPLVSIPRDETA* |
Ga0132256_1017998402 | 3300015372 | Arabidopsis Rhizosphere | MTEGKNRIMIYGPKNDGTYVLEFRTAEGEALAISIPRS |
Ga0182041_107403443 | 3300016294 | Soil | MASNNRIMIFGPKSDGTYVVEFRTAAGEALAISIPS |
Ga0182033_102735161 | 3300016319 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEA |
Ga0182033_111578643 | 3300016319 | Soil | MAGNNRIMILGPKSDGTYVVEFRTAGGETLAISIPASEAAVVRYFQ |
Ga0182033_111839962 | 3300016319 | Soil | MTTTGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPA |
Ga0182035_101658122 | 3300016341 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPPSEAAVVRYFQERMPY |
Ga0182035_104330023 | 3300016341 | Soil | MMGKNRIMIYGPKADGTYVVEFRTAEGAVLAISIPRFR |
Ga0182032_106582151 | 3300016357 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPSSEAAVV |
Ga0182040_109745082 | 3300016387 | Soil | MTGKNRIMIYGPKTDGTHVVEFRTAEGAVLAISIPRSEAAVI |
Ga0182037_120055482 | 3300016404 | Soil | MSVAPPSGQNRILIYGPKDDGTYVVEFRTAAGEALAMSIPRTETAVIKYFQ |
Ga0182039_105898801 | 3300016422 | Soil | MTTTGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEAA |
Ga0182039_120077911 | 3300016422 | Soil | MTGKNRIMIYGPKTNGTYVVEFRTAQGAVLAISIP |
Ga0182038_110445412 | 3300016445 | Soil | KKNRIMIYGPKNDGTYVVEFRTAEGAVLAISNPRTETVVIRHFQERMP |
Ga0182038_115905832 | 3300016445 | Soil | MMGKNRIMIYGPKNDGTYIVEFRTAAGEALAISIPRTEAAVIR |
Ga0184635_100788941 | 3300018072 | Groundwater Sediment | MTTVGKDRIMIYGPKDDGTYVVEFRTDAGQVFALSIP |
Ga0184624_104178681 | 3300018073 | Groundwater Sediment | MTTVGKDRIMIYGPKDDGTYVVEFRTAEGQSLAISIPTNETGVI |
Ga0184625_103581852 | 3300018081 | Groundwater Sediment | MTEGKNRIMIFGPKADGTYVVEFRTSKGESLAISVPRG |
Ga0066655_112497222 | 3300018431 | Grasslands Soil | MTVDGKNRIMIFGPKDDGTYVAEFRTADGDALAISIPRTEAHVIRHFQERNC |
Ga0066662_111646522 | 3300018468 | Grasslands Soil | MAITPDGKNRIMIFGPKNDGTYVAEFKTAAREALATSIP |
Ga0190270_102043482 | 3300018469 | Soil | VTGGKNRIMIYGPKDDGAYVIEFKKAGGEALAISIPSWAMP |
Ga0210387_118200621 | 3300021405 | Soil | MTTTGKNRIMIFGPKDDGTYVVEFRTAAGEALAISIPGGEA |
Ga0126371_105454273 | 3300021560 | Tropical Forest Soil | MTTTGKNRIMIYGPKDDGTYVVEFGTAAGEALAISIPQD |
Ga0126371_122715083 | 3300021560 | Tropical Forest Soil | MTTTGKNRIMIFGPKSDGTYVAEFRTAAGEALAISIPRTEAAVIRHFQE |
Ga0222623_101936972 | 3300022694 | Groundwater Sediment | MTTEGKNRIMIYGPKDDGTYVVEFRTDAGQTLAISIPRTEAAVIQHFQE |
Ga0207684_105879712 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMNGKNRIMIYGPKADGTYLVEFKTAAGESLAISVPGSEAAVRICRCARVMS |
Ga0207663_109497551 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSKNRIMIYGPKDDGTYVVEFMTAEGDVLSISIPRSEAA |
Ga0207646_119445021 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPASEAAV |
Ga0207679_106337812 | 3300025945 | Corn Rhizosphere | VTGGKYRIMIYGPKDDGAYVIEFKKAGGEALAISIPS |
Ga0209240_12610253 | 3300026304 | Grasslands Soil | MTTPAGKNRIMIFGPKSDGTYVIEFRTAAGESLAISIPGTEAAVI |
Ga0209801_13073291 | 3300026326 | Soil | MTTPAGKNRIMIFGPKSDGTYVIEFRTAAGESLAISIPGTEAAVIRHFQER |
Ga0209056_100857841 | 3300026538 | Soil | MMTPAGKNQIMIFGPKSDGTYVIEFRTATGESLAISIP |
Ga0209523_10565242 | 3300027548 | Forest Soil | MTTTGKNRIMIFGPKDDGTYVVEFRTAAGEALAISIPGGEAR |
Ga0209076_12099952 | 3300027643 | Vadose Zone Soil | MTTPAGKNRIMIFGPKSDGTYVIEFRPAAGESLAISIPGTEAAVNNP |
Ga0209799_10190191 | 3300027654 | Tropical Forest Soil | MAITPDGKNRIMIFGPKNDGTYVVEFKTASGDALAISIPRTETAVI |
Ga0209799_10582852 | 3300027654 | Tropical Forest Soil | MAMTNDGKNRIIIYGPKRDGTYVVEFKTAAGEALAISVPVSIRS |
Ga0209283_105438991 | 3300027875 | Vadose Zone Soil | MGQKEMAMTEAGKNRIMIFGPKADGTYVIEFRTAAGEALAI |
Ga0222749_103151492 | 3300029636 | Soil | MTGKNRIMIYGPKTDATYVVEFRMAEGIPRTETAVIRPLIEGFW |
Ga0307498_100804321 | 3300031170 | Soil | MAMTGKNRIMIYGPKDDGTYVVEFRTAAGNVLTISIPRTET |
Ga0318534_101686691 | 3300031544 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISILSSEAAVVR |
Ga0318541_101614741 | 3300031545 | Soil | MASNNRIMIFGPKSDGTYVVEFRTAAGEALAISIPSSEAAVV |
Ga0318538_102453513 | 3300031546 | Soil | MAMTGKNRIMIYGPKGDGTYIVEFRTAAGEALAISIPRSEQLCC |
Ga0318538_104992251 | 3300031546 | Soil | MTTTGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEAAVVR |
Ga0318528_101184224 | 3300031561 | Soil | MAGNNRIMIFGPRSDGTYVVEFRTAAGETLAISIPPSEAAVVRYFQE |
Ga0318573_101264073 | 3300031564 | Soil | MTTTGKNRIMIFGPKTDATYVVEFRTAEGESLAISIPRTETAVIRH |
Ga0318573_101989983 | 3300031564 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPASEAAVVRYFSGPHALR |
Ga0318515_101823883 | 3300031572 | Soil | MTTTGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEAAVVRYFQER |
Ga0318515_106629482 | 3300031572 | Soil | MMGKNRIMIYGPKADGTYVVEFRTAEGAVLAISIPRSEAALIQHFQERM |
Ga0318515_107641471 | 3300031572 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGEALAISIPSSEAAVVRYFQE |
Ga0310915_102627784 | 3300031573 | Soil | MSVAPPSGQNRVMIYGPKNDGTYIVEFRTADGEALAISIPGGDARVIRHFQ |
Ga0318542_100280321 | 3300031668 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGEMLAISIPASEA |
Ga0318574_104103972 | 3300031680 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPPS |
Ga0306917_105387643 | 3300031719 | Soil | MIYGPKNDGTYVVEFRTAAGETLAISIPRTEATVVRHFQ |
Ga0306917_107542091 | 3300031719 | Soil | TTGKNRIMIFGPKTDATYVVEFRTAEGASLAISIPRTETAVMGD |
Ga0306917_108196553 | 3300031719 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAGGESLAISIPAREAAVVRYFQERMPY |
Ga0306917_108401593 | 3300031719 | Soil | MTTTGKNRIMIFGPKTDATYVVEFRTAEGASLAISIPRTETAVI |
Ga0307468_1008920982 | 3300031740 | Hardwood Forest Soil | MNGKNRIMIYGPKDDGTYVVEFMTADGEVLSISIPRTEAD |
Ga0306918_115000842 | 3300031744 | Soil | MIGKNRIMIYGPKDDGTYVVEFRTAASAVLAISIPRTETAVIR |
Ga0318535_103349811 | 3300031764 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPSSEAAVVRYFQ |
Ga0318509_107737031 | 3300031768 | Soil | LETMSVTGKNRIMIFGPKYDGSYVVEFRTAEGEVLAISIPRNETAVVRHFK |
Ga0318546_105676371 | 3300031771 | Soil | MTTTGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIP |
Ga0318543_104580521 | 3300031777 | Soil | MAMTGKNRIMIYGPKNDGTYVVEFRTAAGETLAISIPRTEAAVVRHFQE |
Ga0318529_102754503 | 3300031792 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGEMLAISIPAS |
Ga0318548_101655921 | 3300031793 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGEALAISIPSSEAAVVRYFQ |
Ga0318550_100556371 | 3300031797 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAGGETLATSIPASEAAVVRYFQE |
Ga0318523_101026595 | 3300031798 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIP |
Ga0318523_103417361 | 3300031798 | Soil | MAITGKNRIMIYGPKDDGTYVVEFRTAAGEALAISIPH |
Ga0318497_104119061 | 3300031805 | Soil | MAMTGKNRIMIYGPKNDGTYVVEFRTAAGETLAISI |
Ga0310917_103029511 | 3300031833 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPSSEAAVVRYF |
Ga0318511_101384831 | 3300031845 | Soil | MMGKNRIMIYGPKDDGTYVVEFRTAAGKVLAISIP |
Ga0318495_104090151 | 3300031860 | Soil | MTMTGNARIMIFGPKSDGTYVVEFRTAAGETLAISIPASETAVVRYFQERM |
Ga0306919_100621992 | 3300031879 | Soil | MNGKKNRIMIYGPKNDGTYVVEFRTAEGAVLAISNPRTETVVIRHFQERMP |
Ga0306925_105430401 | 3300031890 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEAAVVRYFQ |
Ga0306923_108408144 | 3300031910 | Soil | MAMTEAGKNRIMIFGPKADGTYVIEFKAAAGEALAILIPRTETA |
Ga0306921_102368734 | 3300031912 | Soil | MTTTGKNRIMIFGPKTDATYVVEFRTAEGASLAISIPRTETAVMGD |
Ga0306921_106634894 | 3300031912 | Soil | MIYGPKNDGTYVVEFRTAAGETLAISIPRTEATVVRHFQER |
Ga0306921_110726312 | 3300031912 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPPSEAAVV |
Ga0310912_104316151 | 3300031941 | Soil | MAGNNRIMIFGPRSDGTYVVEFRTAAGETLAISIP |
Ga0310916_102406101 | 3300031942 | Soil | MASNNRIMIFGPKSDGTYVVEFRTAAGEALAISIP |
Ga0310916_104863453 | 3300031942 | Soil | MTTTGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEAAVVRYFQDR |
Ga0310910_102979614 | 3300031946 | Soil | MIFGPKADGTYVVEFRTAAGEALAISIPGNEAGVI |
Ga0310909_101726475 | 3300031947 | Soil | MIFGPKTDGTYVVEFRTAAGEALAISIPRTETAVIRHF |
Ga0310909_113553792 | 3300031947 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPSSEAAVVRYFQE |
Ga0306926_102099255 | 3300031954 | Soil | MTGKYRIMIYGPKNDGTYVVEFRTAAGEALAIPGGEAR |
Ga0318530_102238792 | 3300031959 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGEALAISIPSSEAAVVRY |
Ga0318556_100927005 | 3300032043 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAVSIPS |
Ga0306924_102461924 | 3300032076 | Soil | MAMTEAGKNRIMIFGPKADGTYVIEFRTAAGEPLAISIPRTEAAV |
Ga0306924_115430143 | 3300032076 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPPSEA |
Ga0306924_122890411 | 3300032076 | Soil | MTSTGKNRIMIFGPKTDGTYVVEFRTAAGEALAISIPRT |
Ga0306920_1003311191 | 3300032261 | Soil | MTGKNRIMIYGPKTDGTYVVEFRTAAGEALAISIPRSETAVIR |
Ga0306920_1015166323 | 3300032261 | Soil | MTTTGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEAAVVRYFQE |
Ga0306920_1025783071 | 3300032261 | Soil | MPQNGTAIMAGNNRIMIFGPKSDGTYVVEFRTAAGETLAISIPASEAAVV |
Ga0318519_100120006 | 3300033290 | Soil | MAGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPAS |
Ga0318519_102059821 | 3300033290 | Soil | MTTTGNNRIMIFGPKSDGTYVVEFRTAGGETLAISIPASEAAVVRYFQDRIP |
⦗Top⦘ |