Basic Information | |
---|---|
Family ID | F027364 |
Family Type | Metagenome |
Number of Sequences | 195 |
Average Sequence Length | 47 residues |
Representative Sequence | MSSDKDPGNAARGSLRLAPTCAEVEVEKAKLPRQFVNFTFYRA |
Number of Associated Samples | 146 |
Number of Associated Scaffolds | 195 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 98.97 % |
% of genes from short scaffolds (< 2000 bps) | 97.44 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (61.538 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (11.795 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.795 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (68.205 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 0.00% Coil/Unstructured: 87.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 195 Family Scaffolds |
---|---|---|
PF00355 | Rieske | 19.49 |
PF13442 | Cytochrome_CBB3 | 12.31 |
PF02537 | CRCB | 4.62 |
PF00033 | Cytochrome_B | 2.56 |
PF02641 | DUF190 | 2.56 |
PF13631 | Cytochrom_B_N_2 | 1.54 |
PF00034 | Cytochrom_C | 1.03 |
PF08802 | Obsolete Pfam Family | 0.51 |
PF14136 | DUF4303 | 0.51 |
PF07927 | HicA_toxin | 0.51 |
PF00491 | Arginase | 0.51 |
COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
---|---|---|---|
COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 4.62 |
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 2.56 |
COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 2.56 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.51 |
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.54 % |
Unclassified | root | N/A | 38.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725004|GPKC_F5V46DG02DIHR1 | Not Available | 526 | Open in IMG/M |
2067725004|GPKC_F5V46DG04IYZQA | Not Available | 513 | Open in IMG/M |
2162886012|MBSR1b_contig_12642948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1004 | Open in IMG/M |
3300000953|JGI11615J12901_10045994 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 852 | Open in IMG/M |
3300000956|JGI10216J12902_108503190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
3300000956|JGI10216J12902_118204408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300001326|A2835W6_1015144 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300001361|A30PFW6_1363478 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300004114|Ga0062593_101112917 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 821 | Open in IMG/M |
3300004156|Ga0062589_101117087 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300005093|Ga0062594_102593355 | Not Available | 559 | Open in IMG/M |
3300005093|Ga0062594_102880068 | Not Available | 536 | Open in IMG/M |
3300005288|Ga0065714_10498076 | Not Available | 525 | Open in IMG/M |
3300005290|Ga0065712_10547004 | Not Available | 620 | Open in IMG/M |
3300005293|Ga0065715_10098502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3538 | Open in IMG/M |
3300005295|Ga0065707_11031259 | Not Available | 531 | Open in IMG/M |
3300005330|Ga0070690_100940791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
3300005331|Ga0070670_100625228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 965 | Open in IMG/M |
3300005333|Ga0070677_10132169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
3300005334|Ga0068869_101429113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300005337|Ga0070682_101154403 | Not Available | 651 | Open in IMG/M |
3300005338|Ga0068868_101862778 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300005340|Ga0070689_100787199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
3300005341|Ga0070691_10169588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 1130 | Open in IMG/M |
3300005355|Ga0070671_101273557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300005364|Ga0070673_101101256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300005364|Ga0070673_101409934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300005406|Ga0070703_10299003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300005444|Ga0070694_100967117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300005444|Ga0070694_101297745 | Not Available | 612 | Open in IMG/M |
3300005458|Ga0070681_10953722 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300005459|Ga0068867_100555575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
3300005468|Ga0070707_101551728 | Not Available | 629 | Open in IMG/M |
3300005518|Ga0070699_101700040 | Not Available | 578 | Open in IMG/M |
3300005543|Ga0070672_101851566 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005546|Ga0070696_101159218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300005549|Ga0070704_101567804 | Not Available | 607 | Open in IMG/M |
3300005564|Ga0070664_102095492 | Not Available | 537 | Open in IMG/M |
3300005577|Ga0068857_101411839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300005577|Ga0068857_101680819 | Not Available | 620 | Open in IMG/M |
3300005577|Ga0068857_101701024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300005577|Ga0068857_102090228 | Not Available | 556 | Open in IMG/M |
3300005578|Ga0068854_101676911 | Not Available | 581 | Open in IMG/M |
3300005578|Ga0068854_102231092 | Not Available | 507 | Open in IMG/M |
3300005615|Ga0070702_100917594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300005616|Ga0068852_101038958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
3300005617|Ga0068859_100316076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1656 | Open in IMG/M |
3300005617|Ga0068859_102736043 | Not Available | 542 | Open in IMG/M |
3300005618|Ga0068864_101141985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 776 | Open in IMG/M |
3300005618|Ga0068864_101781048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300005719|Ga0068861_100006807 | All Organisms → cellular organisms → Bacteria | 7808 | Open in IMG/M |
3300005840|Ga0068870_10765703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300005841|Ga0068863_101378747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300005843|Ga0068860_100441592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 1292 | Open in IMG/M |
3300005843|Ga0068860_100490454 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300005843|Ga0068860_101830854 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300005844|Ga0068862_100211973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1750 | Open in IMG/M |
3300005844|Ga0068862_101629804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300005844|Ga0068862_102202844 | Not Available | 563 | Open in IMG/M |
3300005887|Ga0075292_1018173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
3300005985|Ga0081539_10200957 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300006169|Ga0082029_1588681 | Not Available | 725 | Open in IMG/M |
3300006173|Ga0070716_100621384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300006755|Ga0079222_11996880 | Not Available | 570 | Open in IMG/M |
3300006797|Ga0066659_11292415 | Not Available | 609 | Open in IMG/M |
3300006846|Ga0075430_100534319 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300006846|Ga0075430_101288951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300006852|Ga0075433_11335318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300006881|Ga0068865_101433665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300006894|Ga0079215_10067333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
3300006894|Ga0079215_10902313 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300006904|Ga0075424_101654027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
3300006918|Ga0079216_11011601 | Not Available | 643 | Open in IMG/M |
3300006931|Ga0097620_102534273 | Not Available | 564 | Open in IMG/M |
3300007004|Ga0079218_10229696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1444 | Open in IMG/M |
3300007004|Ga0079218_10912776 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300007076|Ga0075435_100802315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
3300007258|Ga0099793_10511328 | Not Available | 597 | Open in IMG/M |
3300009093|Ga0105240_12233590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 567 | Open in IMG/M |
3300009098|Ga0105245_11162933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300009098|Ga0105245_12397667 | Not Available | 581 | Open in IMG/M |
3300009101|Ga0105247_10639229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300009101|Ga0105247_11075326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300009147|Ga0114129_12665989 | Not Available | 596 | Open in IMG/M |
3300009156|Ga0111538_11899670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
3300009174|Ga0105241_10182586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1741 | Open in IMG/M |
3300009174|Ga0105241_10807467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
3300009174|Ga0105241_12061922 | Not Available | 563 | Open in IMG/M |
3300009177|Ga0105248_11315471 | Not Available | 818 | Open in IMG/M |
3300009545|Ga0105237_10617790 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300009551|Ga0105238_11143013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
3300009553|Ga0105249_10276609 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
3300010039|Ga0126309_10161392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1213 | Open in IMG/M |
3300010040|Ga0126308_10330708 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1006 | Open in IMG/M |
3300010040|Ga0126308_11061236 | Not Available | 569 | Open in IMG/M |
3300010041|Ga0126312_11091107 | Not Available | 586 | Open in IMG/M |
3300010044|Ga0126310_10467492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
3300010045|Ga0126311_10167914 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300010362|Ga0126377_13312373 | Not Available | 521 | Open in IMG/M |
3300010373|Ga0134128_12520445 | Not Available | 567 | Open in IMG/M |
3300010397|Ga0134124_10862388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 909 | Open in IMG/M |
3300010397|Ga0134124_12536641 | Not Available | 555 | Open in IMG/M |
3300010399|Ga0134127_12087469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300010400|Ga0134122_12581186 | Not Available | 558 | Open in IMG/M |
3300010401|Ga0134121_12248772 | Not Available | 583 | Open in IMG/M |
3300010401|Ga0134121_13287857 | Not Available | 501 | Open in IMG/M |
3300010403|Ga0134123_13167615 | Not Available | 529 | Open in IMG/M |
3300011119|Ga0105246_11002684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
3300011269|Ga0137392_11339001 | Not Available | 575 | Open in IMG/M |
3300011444|Ga0137463_1018889 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
3300012043|Ga0136631_10401153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300012198|Ga0137364_10775802 | Not Available | 724 | Open in IMG/M |
3300012198|Ga0137364_11021839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300012199|Ga0137383_10825617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300012351|Ga0137386_10477415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
3300012358|Ga0137368_10100120 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
3300012362|Ga0137361_11436573 | Not Available | 613 | Open in IMG/M |
3300012582|Ga0137358_10902985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300012918|Ga0137396_10537657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 866 | Open in IMG/M |
3300012929|Ga0137404_10533713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
3300012944|Ga0137410_10197749 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300012944|Ga0137410_11231871 | Not Available | 645 | Open in IMG/M |
3300012958|Ga0164299_10654949 | Not Available | 727 | Open in IMG/M |
3300012958|Ga0164299_10790688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300012986|Ga0164304_11889877 | Not Available | 500 | Open in IMG/M |
3300012989|Ga0164305_10163356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
3300013306|Ga0163162_11332647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
3300013306|Ga0163162_12590248 | Not Available | 583 | Open in IMG/M |
3300013307|Ga0157372_12907166 | Not Available | 548 | Open in IMG/M |
3300013308|Ga0157375_11520212 | Not Available | 790 | Open in IMG/M |
3300014487|Ga0182000_10453121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300014745|Ga0157377_11546331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 529 | Open in IMG/M |
3300015086|Ga0167655_1046660 | Not Available | 656 | Open in IMG/M |
3300015200|Ga0173480_11084832 | Not Available | 533 | Open in IMG/M |
3300015262|Ga0182007_10124368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
3300015372|Ga0132256_101178332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
3300015372|Ga0132256_101524678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300015374|Ga0132255_105976337 | Not Available | 515 | Open in IMG/M |
3300017997|Ga0184610_1148635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300018075|Ga0184632_10211040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
3300018429|Ga0190272_10374957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1147 | Open in IMG/M |
3300018429|Ga0190272_10737276 | Not Available | 894 | Open in IMG/M |
3300018429|Ga0190272_12263038 | Not Available | 585 | Open in IMG/M |
3300018429|Ga0190272_12582192 | Not Available | 555 | Open in IMG/M |
3300018429|Ga0190272_13294803 | Not Available | 504 | Open in IMG/M |
3300018429|Ga0190272_13327367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 502 | Open in IMG/M |
3300018476|Ga0190274_13269693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300019377|Ga0190264_11319606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300019877|Ga0193722_1034353 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 1308 | Open in IMG/M |
3300020016|Ga0193696_1165574 | Not Available | 536 | Open in IMG/M |
3300021081|Ga0210379_10326130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300021445|Ga0182009_10362944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300021445|Ga0182009_10553308 | Not Available | 611 | Open in IMG/M |
3300022694|Ga0222623_10204080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300025907|Ga0207645_10956807 | Not Available | 581 | Open in IMG/M |
3300025908|Ga0207643_10631470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300025911|Ga0207654_10447677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300025911|Ga0207654_11371376 | Not Available | 516 | Open in IMG/M |
3300025923|Ga0207681_11709866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300025924|Ga0207694_11419917 | Not Available | 586 | Open in IMG/M |
3300025931|Ga0207644_11165105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300025933|Ga0207706_10989130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300025935|Ga0207709_10618896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
3300025936|Ga0207670_11465506 | Not Available | 580 | Open in IMG/M |
3300025936|Ga0207670_11660115 | Not Available | 543 | Open in IMG/M |
3300025945|Ga0207679_10603456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
3300025960|Ga0207651_10681373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300025960|Ga0207651_11581143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300025981|Ga0207640_10167903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1632 | Open in IMG/M |
3300025981|Ga0207640_11425846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300025981|Ga0207640_12190873 | Not Available | 502 | Open in IMG/M |
3300026023|Ga0207677_11775450 | Not Available | 572 | Open in IMG/M |
3300026023|Ga0207677_12077903 | Not Available | 528 | Open in IMG/M |
3300026035|Ga0207703_10668856 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300026035|Ga0207703_11878216 | Not Available | 575 | Open in IMG/M |
3300026088|Ga0207641_10762331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
3300026088|Ga0207641_12184441 | Not Available | 554 | Open in IMG/M |
3300026095|Ga0207676_10614589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300026095|Ga0207676_11743578 | Not Available | 621 | Open in IMG/M |
3300026295|Ga0209234_1099721 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300027018|Ga0208475_1021963 | Not Available | 626 | Open in IMG/M |
3300027637|Ga0209818_1137495 | Not Available | 676 | Open in IMG/M |
3300027778|Ga0209464_10017464 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
3300027979|Ga0209705_10471791 | Not Available | 616 | Open in IMG/M |
3300028146|Ga0247682_1078596 | Not Available | 606 | Open in IMG/M |
3300028380|Ga0268265_11009606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
3300028380|Ga0268265_12156594 | Not Available | 564 | Open in IMG/M |
3300028381|Ga0268264_10847870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300028381|Ga0268264_11577123 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 667 | Open in IMG/M |
3300031548|Ga0307408_101925291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300031740|Ga0307468_101209036 | Not Available | 682 | Open in IMG/M |
3300031740|Ga0307468_101511634 | Not Available | 623 | Open in IMG/M |
3300031740|Ga0307468_102527376 | Not Available | 503 | Open in IMG/M |
3300031908|Ga0310900_10937501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 708 | Open in IMG/M |
3300032180|Ga0307471_100522466 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.69% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.13% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.13% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.62% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.10% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.59% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.59% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.05% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.05% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.54% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.54% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.03% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.03% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.03% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.03% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.51% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.51% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.51% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.51% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.51% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.51% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.51% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.51% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001326 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-35cm)- 6 month illumina | Environmental | Open in IMG/M |
3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKC_07001590 | 2067725004 | Soil | MSSDKDPGNAPRGSLRLAPTCSEVEVEKARLPRQFVNFTF |
GPKC_06455920 | 2067725004 | Soil | MSSDKDPGNAARGSLRLAPTNSEIEVEKARLPRQFVN |
MBSR1b_0820.00001890 | 2162886012 | Miscanthus Rhizosphere | MSADKEQANNTRGALRLAPTHSEVEEQKAKLPRQFVNFTFYKT |
JGI11615J12901_100459943 | 3300000953 | Soil | MSSDKDPGNAARGSLRLAPNQAEVEVEKAKLPRQFVNFTFYKARPEWRV |
JGI10216J12902_1085031901 | 3300000956 | Soil | MSSDKEQAGNNRGALRLATNCSEVEEQKAKLPRQFVNFTFYRARPEWRL |
JGI10216J12902_1182044081 | 3300000956 | Soil | MSSDKDPGNARGSLRLAPASSELEIEKAKLPRQFVNFTF |
A2835W6_10151442 | 3300001326 | Permafrost | MSTDNEHGSATRGSLRLAPNSVELEEQKAKLPRQFVNFTFYRATPEWRMLAEDEKRRCK |
A30PFW6_13634782 | 3300001361 | Permafrost | MSTDNEHGSATRGSLRLAPNSVELEEQKAKLPRQFVNFTFYRATPEWRMLAEDEKRRCKE |
Ga0062593_1011129171 | 3300004114 | Soil | MSSDKDPGSAVRGSLRLAPSNAEVEVEKAKLPRQFVNFTF |
Ga0062589_1011170871 | 3300004156 | Soil | MGSDKEQGSATRGSLRLAPNCVELEEQKAKLPRQFVNFTFYSARPEWRMLAADEKRRCK |
Ga0062594_1025933552 | 3300005093 | Soil | MSSDKDPGNAARGSLRLAPTCAEVEVEKAKLPRQFVNFTFYRA |
Ga0062594_1028800682 | 3300005093 | Soil | MSSDKDPNNAARGSLRLAPNVAEVEVQKAKLPRQFVTFTFYKAR |
Ga0065714_104980762 | 3300005288 | Miscanthus Rhizosphere | MSSDKDPGNAARGSLRLAPAHAEVEVEKAKLPRQFVNFTFYKARPDWRLLSEGDKQRCRDGF |
Ga0065712_105470041 | 3300005290 | Miscanthus Rhizosphere | MSSDKDPGNAARGSLRLAPTSAEVEVEKAKLPRQFVNFTFYRARPEWRLLSNMDKQRGRDEFQQ |
Ga0065715_100985021 | 3300005293 | Miscanthus Rhizosphere | MSTDKDPGNSARGSSLRLAPTCSELEVEKAKLPRQFVNFTFYHARP |
Ga0065707_110312592 | 3300005295 | Switchgrass Rhizosphere | MSSDKDPGNAARGSLRLAPTCAEVEVEKAKLPRQFVNFTFYR |
Ga0070690_1009407911 | 3300005330 | Switchgrass Rhizosphere | MSSDKDPGNAARGSLRLAPAHAEVEVEKAKLPRQFVNFTFYKARPDWRLLS |
Ga0070670_1006252281 | 3300005331 | Switchgrass Rhizosphere | MSSDKESNSATRGSLRLAPAVEEVERAKAKLPRQFVNFTFYH |
Ga0070677_101321694 | 3300005333 | Miscanthus Rhizosphere | MSTDKDTANALRGSLRLAPTCDEVEEQKSKLPRQFVNFTFYGAQPAWRQLSAA |
Ga0068869_1014291131 | 3300005334 | Miscanthus Rhizosphere | MSSDKDPMIARGSLRLAPASSELEIEKAKLPRQFVNFTFYKARP |
Ga0070682_1011544032 | 3300005337 | Corn Rhizosphere | MSSDTDSVSNNRGSLRLAPSSAEVETEKARLPRQFVNFTFYHARP |
Ga0068868_1018627783 | 3300005338 | Miscanthus Rhizosphere | MSADKEQANNTRGALRLAPTHSEVEEQKAKLPRQFVNFTFYKTRPEWRLLAANDKQ |
Ga0070689_1007871992 | 3300005340 | Switchgrass Rhizosphere | MSSDKDPGSAARGSLRLAPAQAEVEFEKAKLPRQFVNFTFYHARP |
Ga0070691_101695881 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSDKDPGNAARGSLRLAPTHAEVEVEKAKLPRQFVNFTFYHARP |
Ga0070671_1012735571 | 3300005355 | Switchgrass Rhizosphere | MSSDKDQGNATRGSLRLAPAHAAVEIEKAKLPRQFVNFTFYHARPEWRLLSDD |
Ga0070673_1011012561 | 3300005364 | Switchgrass Rhizosphere | MVSDKDPGNAARGSLRLAPTHAEVEVEKAKLPRQFVNFTFYH |
Ga0070673_1014099342 | 3300005364 | Switchgrass Rhizosphere | MSSDKESNGATRGSLRLAPAVEEVERAKAKLPRQFVNFTFYHAR |
Ga0070703_102990032 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDNESNSAARGSLRLAPAYAEVEKEKAKLPRQFVNFTFYHARPEW |
Ga0070694_1009671171 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDKEQAGNNRGALRLATNCSEVEEQKAKLPRQFVNFTFYRA |
Ga0070694_1012977452 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDKDPGNAARGSLRLAPTSAEVEVEKAKLPRQFVNFTFYRARPEWR |
Ga0070681_109537222 | 3300005458 | Corn Rhizosphere | MSSDKDPSSARGSLRLAPASSELEVEKAKLPRQFVNFTFFKARPDWRLLSDAEKQRC |
Ga0068867_1005555752 | 3300005459 | Miscanthus Rhizosphere | MSTDKEPGIATRGALRLAPNCDEVEEQKAKLPRQFVNFTFYH |
Ga0070707_1015517281 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSEKENSSALRGSLRLAPDCTELEEQKAKLPRQFVNFTFYRARPEW |
Ga0070699_1017000401 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTDKDQGSATRGSLRLAPSCAELEELKTKLPRQFVNFTFYRARPEWRLL |
Ga0070672_1018515662 | 3300005543 | Miscanthus Rhizosphere | MSTDKDTANALRGSLRLAPTCDEVEEQKSKLPRQFVNFTFYGAQPAWRQLSA |
Ga0070696_1011592181 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDNDPGSAARGSLRLAPAYAEVEVEKAKLPRQFVNFTF |
Ga0070704_1015678041 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDKDPSNATRGSLRLAPAAAEVEIEKAKLPRQFVNFTFYHARP |
Ga0070664_1020954921 | 3300005564 | Corn Rhizosphere | MSSDNDPGSAARGSLRLAPAYAEVEVEKAKLPRQFVNFTFYKARPEWRLLTDGDKQRCRDGF |
Ga0068857_1014118392 | 3300005577 | Corn Rhizosphere | MATDKDQGNATRGSLRLAPNCIELDEQKAKLPRQFV |
Ga0068857_1016808192 | 3300005577 | Corn Rhizosphere | MSSDKEQAGNNRGALRLATNCSEVEEQKAKLPRQFVNFTFYRARPEWRLLSNE |
Ga0068857_1017010241 | 3300005577 | Corn Rhizosphere | MSSDKDPASSTRGSLRLAPAAAEVEIEKAKLPRQFVNF |
Ga0068857_1020902282 | 3300005577 | Corn Rhizosphere | MSSDQDSNAPRGSLRLAPAYAEVEREKAKLPRQFVNFTFYHARP |
Ga0068854_1016769113 | 3300005578 | Corn Rhizosphere | MSSDKDQGNAARGSLRLAPAHTAVEIEKAKLPRQFVNFTFY |
Ga0068854_1022310923 | 3300005578 | Corn Rhizosphere | MSSDKDQGNAPRGSLRLAPAHAAVEIEKAKLPRQFVNFTFYHARPEWRLLSDDDKQR |
Ga0070702_1009175942 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTDKDTANALRGSLRLAPTCDEVEEQKSKLPRQFVNFTFYGAQPAW |
Ga0068852_1010389581 | 3300005616 | Corn Rhizosphere | MSSDKDPANSTRGSLRLAPTAADVEIEKAKLPRQFVNFTFYHARPEWR |
Ga0068859_1003160761 | 3300005617 | Switchgrass Rhizosphere | MSSDKDPNNAARGSLRLAPNVAEVEVQKAKLPRQFVT |
Ga0068859_1027360431 | 3300005617 | Switchgrass Rhizosphere | MSSDKEQASNNRGALRLATNCSEVEEQKAKLPRQFVNFTFYRARPEWR |
Ga0068864_1011419851 | 3300005618 | Switchgrass Rhizosphere | MSADKEQANNTRGALRLAPTHSEVEEQKAKLPRQFVNFTF |
Ga0068864_1017810481 | 3300005618 | Switchgrass Rhizosphere | MSSDQDSNAPRGSLRLAPAYAEVEREKAKLPRQFVNF |
Ga0068861_10000680713 | 3300005719 | Switchgrass Rhizosphere | MSSDKEPVNNRGSLRLAPASSELEVEKAKLPRQFVN |
Ga0068870_107657031 | 3300005840 | Miscanthus Rhizosphere | MSSDKDPGNAPRGSLRLAPAYAEVEVEKAKLPRQYVTFTFYKARPEWRLLAD |
Ga0068863_1013787471 | 3300005841 | Switchgrass Rhizosphere | MSSDKDPVNAARGSLRLAPNAVEVEIEKAKLPRQFVNFT |
Ga0068860_1004415923 | 3300005843 | Switchgrass Rhizosphere | MSSDKDPGNAPRGSLRLAPAYAEVEVEKAKLPRQY |
Ga0068860_1004904541 | 3300005843 | Switchgrass Rhizosphere | MSSDKDPNSATRGSLRLAPAYEEVETEKAKLPRQYVTFTFYKARPEWRQLADGDKERCRDGF |
Ga0068860_1018308541 | 3300005843 | Switchgrass Rhizosphere | MSADKEQANNTRGALRLAPTHSEVEEQKAKLPRQFVNFTFYKTRPEWRLLAANDKQRCR |
Ga0068862_1002119733 | 3300005844 | Switchgrass Rhizosphere | MSSDKDPNNATRGSLRLAPNVAEVEVQKAKLPRQFVTFTFYKAR |
Ga0068862_1016298042 | 3300005844 | Switchgrass Rhizosphere | MSSDKESNGATRGSLRLAPAVEEVERAKAKLPRQFVN |
Ga0068862_1022028442 | 3300005844 | Switchgrass Rhizosphere | MSSDKDPNSATRGSLRLAPAYEEVEVEKAKLPRQYVTFTFYK |
Ga0075292_10181731 | 3300005887 | Rice Paddy Soil | MSNDKENNVRGSLRLAPNCVEIEKEKSKLPRQFVNFTFYR |
Ga0081539_102009571 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MSSDKDPVNAARGSLRLAPNAVEVEIEKAKLPRQFVNFTFYHARPEWRLLSAEDKQRCRD |
Ga0082029_15886812 | 3300006169 | Termite Nest | MSSDNESVNAGRGALRLAPTTSEVEEQKAKLPRQFVNFTSYRD* |
Ga0070716_1006213842 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDKEQGNAARGSLRLAPTCVELEEQKAKLPRQFVNFT |
Ga0079222_119968801 | 3300006755 | Agricultural Soil | MSSDKESNGATRGSLRLAPAYAEVEKEKAKLPRQFVNFTFYHARPEWRQL |
Ga0066659_112924151 | 3300006797 | Soil | MATDKDQGGATRGSLRLAPNCIELEEQKAKLPRQFVNFTFYHARPEWHTLADGDKKRCKEEF |
Ga0075430_1005343191 | 3300006846 | Populus Rhizosphere | MSTDNDSANATRGSLRLAPSHTEVEIEKARLPRQFVNFTFYHARPEWRLLSASDKQQC |
Ga0075430_1012889512 | 3300006846 | Populus Rhizosphere | MSSDTDSVNNNRGSLRLAPSSTEVETEKARLPRQFVNFTFYHA |
Ga0075433_113353181 | 3300006852 | Populus Rhizosphere | MSSDKDPGNAARGSLRLAPASSEVEIEKARLPRQFVNFTFYKARPEWRLLSVADK |
Ga0068865_1014336652 | 3300006881 | Miscanthus Rhizosphere | MTTDNEPGNGPRGSLRLAPNCIELEEHKAKLPRQFVNFTFYHARP |
Ga0079215_100673331 | 3300006894 | Agricultural Soil | MSTEKDSGNAVRKSLRLAPTCGEVEELKAKLPRQFVNFTFYGARSEWR |
Ga0079215_109023131 | 3300006894 | Agricultural Soil | MSTDKEQGNATRGSLRLAPTSTEIEEQKAKLPRQFVNFTFYHARPQWLMLSNGDKER |
Ga0075424_1016540271 | 3300006904 | Populus Rhizosphere | MDTEKENNSATRGSLRLAPNYIELEEHKAKLPRQFVNFTF |
Ga0079216_110116011 | 3300006918 | Agricultural Soil | MSSENESANAPRGSLRLAPSHTEIEVEKAKLPRQFVNFTF* |
Ga0097620_1025342732 | 3300006931 | Switchgrass Rhizosphere | MSSDKDQNNATRGSLRLAPAYAEVEEIEKAKLPRQFVNFTFYHA |
Ga0079218_102296961 | 3300007004 | Agricultural Soil | MSSDKEQSPAPKTPLRLAPNCVEFEEQKAKLPRQFVNFTFYH |
Ga0079218_109127762 | 3300007004 | Agricultural Soil | MISDNDPGNAARGSLRLAPTHAEVEVEKAKLPRQFVNFTFYHARPEWRLLSDAD |
Ga0075435_1008023151 | 3300007076 | Populus Rhizosphere | MSSDKEQASNNRGALRLATNCSEMEEQKAKLPRQFVNF |
Ga0099793_105113281 | 3300007258 | Vadose Zone Soil | MSTDKEPGIAARGSLRLAPNCDEIEEQKAKLPRQFVNFTF |
Ga0105240_122335901 | 3300009093 | Corn Rhizosphere | MSGDNDSVSATRGSLRLAPTSSEVEEQKAKLPRQFVNFTFYRARP |
Ga0105245_111629331 | 3300009098 | Miscanthus Rhizosphere | MSSDNDPSNAARGSLRLAPNVAEVEVQKAKLPRQFVNFTFYHARPEWRLLSNDDKQRCRD |
Ga0105245_123976672 | 3300009098 | Miscanthus Rhizosphere | MSSDKDPGNAARGSLRLAPTCAEVEVEKAKLPRQFVNFTFYRARPEWRL |
Ga0105247_106392291 | 3300009101 | Switchgrass Rhizosphere | MSSDKDPGNAARGSLRLAPTCAEVEVEKAKLPRQFVNFTFYRARPEWRLLSDN |
Ga0105247_110753262 | 3300009101 | Switchgrass Rhizosphere | MSTDKDPGNSARGSSLRLAPTCSELEVEKAKLPRQFVNFTFYHARPEWRLLSA |
Ga0114129_126659891 | 3300009147 | Populus Rhizosphere | MSTDQESNSATRGSLRLAPAYAEIEKERAKLPRQFVNFTFYHARPEWRLLSNDDKQRC |
Ga0111538_118996703 | 3300009156 | Populus Rhizosphere | MSADKEQANNTRGALRLAPTHSEVEEQKAKLPRQFV |
Ga0105241_101825861 | 3300009174 | Corn Rhizosphere | MSSDKEPVNARGSLRLAPASSELEIEKAKLPRQFVNFTFYKARPEWRLL |
Ga0105241_108074671 | 3300009174 | Corn Rhizosphere | MSSDKDPQNSRGSLRLAPASSAQEVEKAKLPRQFVNFTFYKARPEWRLLAAEDKQR |
Ga0105241_120619222 | 3300009174 | Corn Rhizosphere | MSSDKEQVSNNRSALRLATNCSEGEEHKAKLPRQFVNFTF |
Ga0105248_113154711 | 3300009177 | Switchgrass Rhizosphere | MSSSDKEQAGNTRGALRLAPTCSEVEEQKAKLPRQFVNFT |
Ga0105237_106177903 | 3300009545 | Corn Rhizosphere | MSSDKDPGNAARGSLRLAPAHAEVEVEKAKLPRQFVNFTFYKARPEWRLLSDGDKQRCRD |
Ga0105238_111430131 | 3300009551 | Corn Rhizosphere | MSSDKDQNNATRGSLRLAPAYAEVEEIEKAKLPRQFVNFTF |
Ga0105249_102766091 | 3300009553 | Switchgrass Rhizosphere | MSTDKEPGIAARGALRLAPNCDEVEEQKAKLPRQFVNFTFYHARPEWR |
Ga0126309_101613923 | 3300010039 | Serpentine Soil | MSTDNEPGNGPRGSLRLAPNCIELEEHKAKLPRQFVNFTFYHA |
Ga0126308_103307081 | 3300010040 | Serpentine Soil | MSSDKDPGNAARGSLRLAPTTSEVEVEKARLPRQFVNFTFYHARPEWRLLSAADKQ |
Ga0126308_110612361 | 3300010040 | Serpentine Soil | MSSDKDPGNVRGSLRLAPASSEIEIEKAKLPRQFVNFTFYKAR |
Ga0126312_110911072 | 3300010041 | Serpentine Soil | MSSDKDPGNVPRGSLRLAPAYAEVEVERGKLPRQFVNFTFYH |
Ga0126310_104674921 | 3300010044 | Serpentine Soil | MSSDNDPGRGSLRLAPTCSEVEIEKARLPRQFVNFTFY |
Ga0126311_101679143 | 3300010045 | Serpentine Soil | MSSDNDPGNATRSSLRLAPAYAEVEVEKAKLPRQFVNFTFYHARPEWRLLSD |
Ga0126377_133123731 | 3300010362 | Tropical Forest Soil | MSTEKDQGSATRGSLRLAPSCAELEELKAKLPRQFVNFTFYRARPEWRL |
Ga0134128_125204451 | 3300010373 | Terrestrial Soil | MSSDKESNSATRGSLRLAPAYAEMEREKAKLPRQFV |
Ga0134124_108623882 | 3300010397 | Terrestrial Soil | MSSDKEQANNTRGALRLAPTNSEVEEQKAKLPRQFVNFTFYKTRP |
Ga0134124_125366411 | 3300010397 | Terrestrial Soil | MSSDNESNSATRGSLRLAPAYAEVEREKAKLPRQFVNFTFY |
Ga0134127_120874691 | 3300010399 | Terrestrial Soil | MTTDNEPGTGPRGSLRLAPNCIELEEHKAKLPRQFVNFTFYH |
Ga0134122_125811861 | 3300010400 | Terrestrial Soil | MSSDNDLVNASRGSLRLAPTSSEVEEQKAKLPRQFVNFTFYRARPEWRLL |
Ga0134121_122487721 | 3300010401 | Terrestrial Soil | MSSDKDPGNAARGSLRLAPTSAEVEVEKAKLPRQFVNFTFYRARPEWRLLSNMD |
Ga0134121_132878571 | 3300010401 | Terrestrial Soil | MSNDKEPAGNNRGALRLATNCSEVEEQKAKLPRQFVNFTFYRARPEWR |
Ga0134123_131676151 | 3300010403 | Terrestrial Soil | MSSSDEQVPNTRGALRLAHTCSEVEEQKAKLPRQFVNFTF |
Ga0105246_110026842 | 3300011119 | Miscanthus Rhizosphere | MGSDKDPGNSTRGSLRLAPAAAEVEIEKAKLPRQFVNFTFYHARPEW |
Ga0137392_113390012 | 3300011269 | Vadose Zone Soil | MSSDKDQTNPPRGSLRLAPTCSEVEEQKAKLTRKFVNFTFYSA |
Ga0137463_10188893 | 3300011444 | Soil | MSTDKEPGNVARGSLRLAPNCDEVEEQKAKLPRQFVNFTFYHARPEWRTIAEDD |
Ga0136631_104011531 | 3300012043 | Polar Desert Sand | MTTDKEGNATRGSLRLAPNSVELEVEKAKLPRQFVNFTFYH |
Ga0137364_107758022 | 3300012198 | Vadose Zone Soil | MGTDKDQGNATRGSLRLAPSCSELEELKAKLPRQFVNFTF |
Ga0137364_110218392 | 3300012198 | Vadose Zone Soil | MSTDKEPGNATRGALRLAPNCDEIEEQKAKLPRQFVNFTFYH |
Ga0137383_108256172 | 3300012199 | Vadose Zone Soil | MSSDKDQTNPPRGSLRLAPTCSEIEEQKARLPRQFVNFTF |
Ga0137386_104774151 | 3300012351 | Vadose Zone Soil | MSSEKENSSALRGPLRLAPDCTELEEEKAKLPRQFVNF |
Ga0137368_101001203 | 3300012358 | Vadose Zone Soil | MSTDKEPNATRGSLRLAPNCIELEEQKAKLPRQFVNFTFYHARPEWR |
Ga0137361_114365731 | 3300012362 | Vadose Zone Soil | MSSDKDQTNPPRGSLRLAPTCSEIEEQKAKLPRQFVNFTFYRARPEWRLLSGA |
Ga0137358_109029852 | 3300012582 | Vadose Zone Soil | MGTDKDQGNATRGSLRLAPSCAELEELKAKLPRQFVNFTFYRARPEWRLLE |
Ga0137396_105376573 | 3300012918 | Vadose Zone Soil | MSTEKEQGTATRGSLRLAPGCTELEEQKAKLPRQFVNFTFY |
Ga0137404_105337131 | 3300012929 | Vadose Zone Soil | MATDKDQGGATRGSLRLAPNCIELEEQKAKLPRQFVNFTFYHARPEWHTLADGDKKRCKQ |
Ga0137410_101977491 | 3300012944 | Vadose Zone Soil | MSTDKEPGNATRGSLRLAPNCVELDEHKAKLPRQFVN |
Ga0137410_112318712 | 3300012944 | Vadose Zone Soil | MSTDKDQGNAPRSSLRLAPTCSEVEEQKATLPRQFVNFTFYRARPEW |
Ga0164299_106549491 | 3300012958 | Soil | MSSDKEEQVNNTRGSLRLAPTCSEVEEQKAKLPRQFVNFTFYHARPEWRLLSN |
Ga0164299_107906882 | 3300012958 | Soil | MSSDKEQASNNRGALRLATNCSEMEEQKSKLPRQFVNFTFYRAR |
Ga0164304_118898772 | 3300012986 | Soil | MSSDNDSNSAARGSLRLAPAYEEVEKEKAKLSRQFVNFTFY |
Ga0164305_101633565 | 3300012989 | Soil | MSTDKETGNAARGALRLAPNCDEIEEQKAKLPRQFVNFTFYHARPEWRTLAE |
Ga0163162_113326471 | 3300013306 | Switchgrass Rhizosphere | MSSDKDPNNAARGSLRLAPNVAEVEVQKAKLPRQFVTFTFYKA |
Ga0163162_125902481 | 3300013306 | Switchgrass Rhizosphere | MSSDKDPANSTRGSLRLAPTAADVEIEKAKLPRQFVN |
Ga0157372_129071661 | 3300013307 | Corn Rhizosphere | MISDKDPGNAARGSLRLAPTNAEVEVEKAKLPRQFVNFTFYKARPEWRLLSDGDKQRCRE |
Ga0157375_115202121 | 3300013308 | Miscanthus Rhizosphere | MSSSDKEQAGNTRGALRLAPTCSEVEEQKAKLPRQFVNFTFYHARPE |
Ga0182000_104531211 | 3300014487 | Soil | MSSDKDSVNATRGSLRLAPSHDEVETEKAKLPRQFVNFTFY |
Ga0157377_115463311 | 3300014745 | Miscanthus Rhizosphere | MSTDKEPGIATRGALRLAPNCDEVEEQKAKLPRQFVNFTFYHARPEWRSLTEADKQRTKE |
Ga0167655_10466601 | 3300015086 | Glacier Forefield Soil | MSSDKEQGGATRGSLRLAPNCVELEEQKAKLPRQFVNFTFY |
Ga0173480_110848322 | 3300015200 | Soil | MSSDKEEQVNNTRGSLRLAPTCSEVEEQKAKLPRQFVNFTFYHARPE |
Ga0182007_101243683 | 3300015262 | Rhizosphere | MSSDKDQGNAARGSLRLAPAHAAVELEKAKLPRQFVNF |
Ga0132256_1011783322 | 3300015372 | Arabidopsis Rhizosphere | MSSDKDPNNAARGSLRLAPACADVEIEKARLPRQFVNFTFYHARPEWRLLSAADK |
Ga0132256_1015246781 | 3300015372 | Arabidopsis Rhizosphere | MSSDKEQVPNTRGALRLAPTCSEVEEQKAKLPRQFVN |
Ga0132255_1059763372 | 3300015374 | Arabidopsis Rhizosphere | MSNDKEPAGNNRGALRLATNCSEVEEQKAKLPRQFV |
Ga0184610_11486352 | 3300017997 | Groundwater Sediment | MSTDKEPGTATRGALRLAPNCDEVEEQKAKLPRQFVNFTFY |
Ga0184632_102110403 | 3300018075 | Groundwater Sediment | MSTDKEPGIATRGALRLAPNCDEVEEQKAKLPRQFVNFTFYHARPEWR |
Ga0190272_103749573 | 3300018429 | Soil | MGTENDQGAATRGPLRLAPNCVELEEQKAKLPRQFVNFTFYHARPEWRMLDD |
Ga0190272_107372761 | 3300018429 | Soil | MSSDKDSGNAIRGSLRLAPNCIELDEQKPKLPRQFVN |
Ga0190272_122630381 | 3300018429 | Soil | MGTDKDQGAATRGPLRLAPNCVELEEQKAKLPRQFVNFTFYHARPEWRMLDD |
Ga0190272_125821921 | 3300018429 | Soil | MSSDTDSGNAIRGSLRLAPNCVELDEQKPKLPRQFVNFTFYRSRPEWRLLSDGDKQHSIA |
Ga0190272_132948031 | 3300018429 | Soil | MSTDKDPGNALRGSLRLAPTCEEVEEQKTKLPRQFVNFTFYGALPAWRLL |
Ga0190272_133273671 | 3300018429 | Soil | MSSDKDQGTAPKSPLRLAPNCVEFEEQKAKLPRQFVNFTFYHARPEWRLLDD |
Ga0190274_132696932 | 3300018476 | Soil | MTTDNEAGTGPRGSLRLAPNCIELEEHKAKLPRQFVNFTFYHARPEWRTIATRDKQRH |
Ga0190264_113196061 | 3300019377 | Soil | MSTEKDSGNAVRKSLRLAPTCGEVEELKAKLPRQFVNFTFY |
Ga0193722_10343535 | 3300019877 | Soil | MSTDKETGNAARGALRLAPNCDEIEEQKAKLPRQFVNFTFSHARPEWRTLAD |
Ga0193696_11655741 | 3300020016 | Soil | MTTDKEGTATRGSLRLAPNCVELEVEKAKLPRQFVNFTFYHALPQWRMLDDGEQQRC |
Ga0210379_103261302 | 3300021081 | Groundwater Sediment | MSTDKEPGIATRGALRLAPNCDEVEEQKAKLPRQFV |
Ga0182009_103629441 | 3300021445 | Soil | MSSDKESGNVPRGSLRLAPAYAEVEKEKAKLPRQFVTFTFYHARPDWRLLSND |
Ga0182009_105533081 | 3300021445 | Soil | MSSDKESGNAPRGSLRLAPAYAEVEKEKAKLPRQFVTFTFYHARPDWRLLL |
Ga0222623_102040802 | 3300022694 | Groundwater Sediment | MSTDKDPGSAVRSSLRLAPNCVELEEQKAKLPRQFVNFTFYRARPEWR |
Ga0207645_109568072 | 3300025907 | Miscanthus Rhizosphere | MSTDKDTANALRGSLRLAPTCDEVEEQKSKLPRQFVNFTFYG |
Ga0207643_106314701 | 3300025908 | Miscanthus Rhizosphere | MSSDKDPGNAPRGSLRLAPAYAEVEVEKAKLPRQYVTFTFYKARPEWRLLADGDKQ |
Ga0207654_104476773 | 3300025911 | Corn Rhizosphere | MSSDKESNSATRGSLRLAPAYAEMEREKAKLPRQFVNFTFYHARSDWRL |
Ga0207654_113713762 | 3300025911 | Corn Rhizosphere | MSSDKDPQNVRGSLRLAPASSALEVEKAKLPRQFVNFT |
Ga0207681_117098662 | 3300025923 | Switchgrass Rhizosphere | MTTDNEPGTGPRGSLRLAPNCIELEEHKAKLPRQFVN |
Ga0207694_114199171 | 3300025924 | Corn Rhizosphere | MSSDKDQGNATRGSLRLAPAYAEVEEIDKAKLPRQFVNFTFYH |
Ga0207644_111651051 | 3300025931 | Switchgrass Rhizosphere | MSSDKDQNNATRGSLRLAPAYAEVEEIEKAKLPRQFVNFTFYHARP |
Ga0207706_109891301 | 3300025933 | Corn Rhizosphere | MSSSDEQVPNTRGALRLAPTCSEVEEQKAKLPRQFVNFTFYHARPEWR |
Ga0207709_106188961 | 3300025935 | Miscanthus Rhizosphere | MSSDKDPGSATRGSLRLAPAQAEVEFEKAKLPRQFVNFTFYHARTE |
Ga0207670_114655061 | 3300025936 | Switchgrass Rhizosphere | MVSDKEQVNPRGSLRLAPTSQEVEEQKAKLPRQFVNFTFYHARPDWRLL |
Ga0207670_116601151 | 3300025936 | Switchgrass Rhizosphere | MSTDKDTANALRGSLRLAPTCDEVEEQKSKLPRQFVNFTFYGAQPAWRQLS |
Ga0207679_106034561 | 3300025945 | Corn Rhizosphere | MSSDKDPNSAARGSLRLAPAHAEVEVERGKLPRQFVNFTFYHARPDWR |
Ga0207651_106813733 | 3300025960 | Switchgrass Rhizosphere | MSSDKESNGATRGSLRLAPAVEEVERAKAKLPRQFVNFTFYHARSD |
Ga0207651_115811432 | 3300025960 | Switchgrass Rhizosphere | MSSDNDPGSAARGSLRLAPAYAEVEVEKAKLPRQFVNF |
Ga0207640_101679035 | 3300025981 | Corn Rhizosphere | MSADKEQANNTRGALRLAPTHSEVEEQKAKLPRQFVNFTFYKTRPEWRLLEANDKQR |
Ga0207640_114258461 | 3300025981 | Corn Rhizosphere | MSSDKDPNSAARGSLRLAPAHAEVEVERGKLPRQFVNFTFYHAR |
Ga0207640_121908731 | 3300025981 | Corn Rhizosphere | MSSDKDPANPTRGSLRLAPTAADVEIEKAKLPRQFVNFTFYR |
Ga0207677_117754502 | 3300026023 | Miscanthus Rhizosphere | MSADKEQANNTRGALRLAPTHSEVEEQKAKLPRQFVNFTFYKTRPEWRLLAANDKQR |
Ga0207677_120779031 | 3300026023 | Miscanthus Rhizosphere | MSSDKESNSATRGSLRLAPAYAEMEREKAKLPRQFVNFTFYHARSD |
Ga0207703_106688561 | 3300026035 | Switchgrass Rhizosphere | MSSDKDPGNAARGSLRLAPTSAEVEVEKAKLPRQFVNFTFY |
Ga0207703_118782161 | 3300026035 | Switchgrass Rhizosphere | MSSDNDPGNAPRGSLRLAPAYAEVEVEKAKLPRQYVTFTFYKARPEWR |
Ga0207641_107623312 | 3300026088 | Switchgrass Rhizosphere | MSSSDEQVPNTRGALRLAPTCSEVEEQKAKLPRQFVNFTFYHARPEW |
Ga0207641_121844412 | 3300026088 | Switchgrass Rhizosphere | MISDKDPGNATRGSLRLAPTNAEVEVEKAKLPRQFVNFTFYHARPEWRLLSDADK |
Ga0207676_106145891 | 3300026095 | Switchgrass Rhizosphere | MSSDKDPNSAARGSLRLAPAHAEVEVERGKLPRQFVNFTF |
Ga0207676_117435781 | 3300026095 | Switchgrass Rhizosphere | MSSDKEQAGNNRGALRLATNCSEVEEQKAKLPRQFVNFTFYRAR |
Ga0209234_10997213 | 3300026295 | Grasslands Soil | MSTEKEQGTATRGSLRLAPSCTELEEQKAKLPRQFVNFTFYHARPGWLMLDDGDKQRCKE |
Ga0208475_10219632 | 3300027018 | Soil | MSSDNEQVNNARGALRLAPTCSEVEEQKAKLPRQFVNFTFYRARPEWRLLSNEDKQRCRDGF |
Ga0209818_11374951 | 3300027637 | Agricultural Soil | MSSENESGNATRGSLRLAPNCIELDEQKAKLPRQFVNFTFYRARPEWRLLPADDKQRHITEFVKT |
Ga0209464_100174641 | 3300027778 | Wetland Sediment | MSTDKEPGVVARGSLRLAPNCDEIEEQKAKLPRQFVNFTFYRARPEWRTLAQAEKQK |
Ga0209705_104717913 | 3300027979 | Freshwater Sediment | MSNDKENNVRGSLRLAPNCVEMENQKSKLPRQFVNFTFYRARPEWRLL |
Ga0247682_10785961 | 3300028146 | Soil | MSSDKDPISARGSLRLAPASSELEVEKAKLPRQFVNFTFYKARP |
Ga0268265_110096062 | 3300028380 | Switchgrass Rhizosphere | MSSDKDPNNATRGSLRLAPNVAEVEVQKAKLPRQFVTFTFYKARPEWRLLSN |
Ga0268265_121565941 | 3300028380 | Switchgrass Rhizosphere | MSSDKDPNSATRGSLRLAPAYEEVEVEKAKLPRQYVTFTFYKARPEWRQLADGDKE |
Ga0268264_108478701 | 3300028381 | Switchgrass Rhizosphere | MSSDNDPGNAPRGSLRLAPAYAEVEVEKAKLPRQYVTFTFYKARPEWRLLADGDKQRCRDGFNKT |
Ga0268264_115771232 | 3300028381 | Switchgrass Rhizosphere | MSSDKDPGSAVRGSLRLAPSNAEVEVEKAKLPRQFV |
Ga0307408_1019252912 | 3300031548 | Rhizosphere | MSSDKDQSNAARGSLRLAPTNAEVEVEKAKLPRQFVNFTFYHT |
Ga0307468_1012090362 | 3300031740 | Hardwood Forest Soil | MISDKDQGTAARGSLRLAPACDEVEEQKAKLPRQFVNFTFYRARPE |
Ga0307468_1015116342 | 3300031740 | Hardwood Forest Soil | MSTTTNEPGVPARGSLRLAPNCDEIEEQKAKLPRQF |
Ga0307468_1025273761 | 3300031740 | Hardwood Forest Soil | MSTDKEPGNATRGSLRLAPNCIELEEQKAKLPRQFVNFTFY |
Ga0310900_109375013 | 3300031908 | Soil | MSADKEQANNTRGALRLAPTHSEVEEQKAKLPRQFVNFTFYKTRPEWRLLAAND |
Ga0307471_1005224661 | 3300032180 | Hardwood Forest Soil | MSTDKEPGIATRGALRLAPNCDEVEEQKAKLPRQFVNFTF |
⦗Top⦘ |