Basic Information | |
---|---|
Family ID | F027590 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 194 |
Average Sequence Length | 44 residues |
Representative Sequence | MADAATAELTEETAVTGPADDLASDLADDVLVEEVSIDGMCGVY |
Number of Associated Samples | 136 |
Number of Associated Scaffolds | 194 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.41 % |
% of genes near scaffold ends (potentially truncated) | 31.96 % |
% of genes from short scaffolds (< 2000 bps) | 82.47 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.876 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.052 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.052 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.155 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.11% β-sheet: 0.00% Coil/Unstructured: 88.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 194 Family Scaffolds |
---|---|---|
PF00440 | TetR_N | 35.05 |
PF04055 | Radical_SAM | 28.87 |
PF01070 | FMN_dh | 9.79 |
PF13186 | SPASM | 1.55 |
PF01925 | TauE | 0.52 |
PF00664 | ABC_membrane | 0.52 |
PF00106 | adh_short | 0.52 |
PF00535 | Glycos_transf_2 | 0.52 |
PF12697 | Abhydrolase_6 | 0.52 |
PF10011 | DUF2254 | 0.52 |
PF13561 | adh_short_C2 | 0.52 |
PF07728 | AAA_5 | 0.52 |
PF13560 | HTH_31 | 0.52 |
PF04185 | Phosphoesterase | 0.52 |
PF06974 | WS_DGAT_C | 0.52 |
PF02518 | HATPase_c | 0.52 |
COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
---|---|---|---|
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 9.79 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 9.79 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.52 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.88 % |
Unclassified | root | N/A | 4.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_114986822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
3300004268|Ga0066398_10060590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 792 | Open in IMG/M |
3300004633|Ga0066395_10184854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1081 | Open in IMG/M |
3300004633|Ga0066395_10186935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1076 | Open in IMG/M |
3300004633|Ga0066395_10194126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1059 | Open in IMG/M |
3300004633|Ga0066395_10254692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
3300005045|Ga0071328_137576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2186 | Open in IMG/M |
3300005172|Ga0066683_10841088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
3300005176|Ga0066679_10603226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 716 | Open in IMG/M |
3300005332|Ga0066388_100524666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1817 | Open in IMG/M |
3300005332|Ga0066388_100799055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1536 | Open in IMG/M |
3300005332|Ga0066388_106017229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 613 | Open in IMG/M |
3300005363|Ga0008090_15809916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
3300005434|Ga0070709_10001632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 12139 | Open in IMG/M |
3300005435|Ga0070714_100340520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1406 | Open in IMG/M |
3300005435|Ga0070714_100554095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1101 | Open in IMG/M |
3300005436|Ga0070713_100029475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4348 | Open in IMG/M |
3300005439|Ga0070711_100374294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
3300005467|Ga0070706_100015501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7040 | Open in IMG/M |
3300005468|Ga0070707_100000160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 64063 | Open in IMG/M |
3300005524|Ga0070737_10162097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 953 | Open in IMG/M |
3300005533|Ga0070734_10020045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 4443 | Open in IMG/M |
3300005541|Ga0070733_10252060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1161 | Open in IMG/M |
3300005555|Ga0066692_10347422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 941 | Open in IMG/M |
3300005713|Ga0066905_100765456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 834 | Open in IMG/M |
3300005764|Ga0066903_100275312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2631 | Open in IMG/M |
3300005764|Ga0066903_100643671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1851 | Open in IMG/M |
3300005764|Ga0066903_100798665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1687 | Open in IMG/M |
3300005764|Ga0066903_103110053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 898 | Open in IMG/M |
3300005764|Ga0066903_103165726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
3300005764|Ga0066903_103357419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 864 | Open in IMG/M |
3300005764|Ga0066903_103473163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
3300005764|Ga0066903_104645839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
3300005764|Ga0066903_104705563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
3300005764|Ga0066903_108102750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 538 | Open in IMG/M |
3300005921|Ga0070766_10199328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1251 | Open in IMG/M |
3300006028|Ga0070717_10752864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
3300006175|Ga0070712_100177576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1657 | Open in IMG/M |
3300006755|Ga0079222_10104372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1499 | Open in IMG/M |
3300006755|Ga0079222_11078081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
3300006804|Ga0079221_10925793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
3300006806|Ga0079220_11511746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
3300006893|Ga0073928_10554931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
3300007076|Ga0075435_100407535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1170 | Open in IMG/M |
3300009088|Ga0099830_10925344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 721 | Open in IMG/M |
3300009090|Ga0099827_10130015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2039 | Open in IMG/M |
3300009143|Ga0099792_10307257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
3300009700|Ga0116217_10041550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 3406 | Open in IMG/M |
3300010043|Ga0126380_10000088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 21709 | Open in IMG/M |
3300010043|Ga0126380_10011401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 4006 | Open in IMG/M |
3300010043|Ga0126380_10410066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1010 | Open in IMG/M |
3300010046|Ga0126384_10009069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 6141 | Open in IMG/M |
3300010046|Ga0126384_10221028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1513 | Open in IMG/M |
3300010046|Ga0126384_11539574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
3300010047|Ga0126382_10353427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1127 | Open in IMG/M |
3300010047|Ga0126382_10577338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
3300010048|Ga0126373_11126851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
3300010048|Ga0126373_13119624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300010358|Ga0126370_10446156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1077 | Open in IMG/M |
3300010358|Ga0126370_10700401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
3300010358|Ga0126370_10740205 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300010359|Ga0126376_10738493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
3300010360|Ga0126372_10009392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 5103 | Open in IMG/M |
3300010360|Ga0126372_11228525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300010361|Ga0126378_10260021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1832 | Open in IMG/M |
3300010361|Ga0126378_11554136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
3300010366|Ga0126379_10025005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4561 | Open in IMG/M |
3300010366|Ga0126379_12005753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
3300010376|Ga0126381_102931637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
3300010379|Ga0136449_102670733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
3300010398|Ga0126383_11371473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
3300010398|Ga0126383_12015091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300010398|Ga0126383_12435707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
3300010400|Ga0134122_12261455 | Not Available | 588 | Open in IMG/M |
3300010866|Ga0126344_1149987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300010876|Ga0126361_10309283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2038 | Open in IMG/M |
3300010937|Ga0137776_1219867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
3300011120|Ga0150983_13215099 | Not Available | 518 | Open in IMG/M |
3300011269|Ga0137392_10078534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2556 | Open in IMG/M |
3300011271|Ga0137393_10716419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 857 | Open in IMG/M |
3300012189|Ga0137388_10077711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2787 | Open in IMG/M |
3300012199|Ga0137383_10287281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
3300012201|Ga0137365_10139284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1824 | Open in IMG/M |
3300012206|Ga0137380_10014032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 7304 | Open in IMG/M |
3300012356|Ga0137371_10195736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1583 | Open in IMG/M |
3300012356|Ga0137371_10226797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1461 | Open in IMG/M |
3300012971|Ga0126369_10066381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3146 | Open in IMG/M |
3300012971|Ga0126369_10320047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1561 | Open in IMG/M |
3300016294|Ga0182041_11377655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300016387|Ga0182040_11413943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
3300016404|Ga0182037_10231529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1452 | Open in IMG/M |
3300018433|Ga0066667_11171039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 667 | Open in IMG/M |
3300020199|Ga0179592_10179789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
3300020579|Ga0210407_10351241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
3300021086|Ga0179596_10157699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
3300021171|Ga0210405_11007499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300021178|Ga0210408_10620327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
3300021401|Ga0210393_10267674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1387 | Open in IMG/M |
3300021402|Ga0210385_10176713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1542 | Open in IMG/M |
3300021403|Ga0210397_10851738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300021403|Ga0210397_11530792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300021420|Ga0210394_10483390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1090 | Open in IMG/M |
3300021432|Ga0210384_11046482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
3300021433|Ga0210391_10081075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2563 | Open in IMG/M |
3300021477|Ga0210398_10843341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
3300021478|Ga0210402_10568212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1052 | Open in IMG/M |
3300021560|Ga0126371_10426728 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300021560|Ga0126371_10600089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1250 | Open in IMG/M |
3300021560|Ga0126371_11124500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
3300021560|Ga0126371_11441975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
3300021560|Ga0126371_11600337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
3300021860|Ga0213851_1373411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300022711|Ga0242674_1067836 | Not Available | 518 | Open in IMG/M |
3300025910|Ga0207684_10013570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7043 | Open in IMG/M |
3300025910|Ga0207684_10370828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
3300025915|Ga0207693_11058983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
3300025922|Ga0207646_10000202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 80937 | Open in IMG/M |
3300025928|Ga0207700_10059432 | All Organisms → cellular organisms → Bacteria | 2891 | Open in IMG/M |
3300025949|Ga0207667_10401587 | Not Available | 1395 | Open in IMG/M |
3300027527|Ga0209684_1013526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1284 | Open in IMG/M |
3300027654|Ga0209799_1001723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4292 | Open in IMG/M |
3300027725|Ga0209178_1147657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
3300027826|Ga0209060_10189610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
3300027854|Ga0209517_10436410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
3300027874|Ga0209465_10098414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1434 | Open in IMG/M |
3300027874|Ga0209465_10299223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300027874|Ga0209465_10347755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
3300027874|Ga0209465_10445123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
3300027882|Ga0209590_10065739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2071 | Open in IMG/M |
3300028889|Ga0247827_11093631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
3300029636|Ga0222749_10739004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis japonica group → Amycolatopsis keratiniphila | 539 | Open in IMG/M |
3300029701|Ga0222748_1085623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300031543|Ga0318516_10018070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3553 | Open in IMG/M |
3300031543|Ga0318516_10066916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1985 | Open in IMG/M |
3300031543|Ga0318516_10125801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1463 | Open in IMG/M |
3300031543|Ga0318516_10270823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 982 | Open in IMG/M |
3300031543|Ga0318516_10505404 | Not Available | 693 | Open in IMG/M |
3300031544|Ga0318534_10080338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1853 | Open in IMG/M |
3300031544|Ga0318534_10203634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1142 | Open in IMG/M |
3300031544|Ga0318534_10305470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 916 | Open in IMG/M |
3300031546|Ga0318538_10021071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2908 | Open in IMG/M |
3300031546|Ga0318538_10139750 | Not Available | 1274 | Open in IMG/M |
3300031546|Ga0318538_10209404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
3300031549|Ga0318571_10048357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1259 | Open in IMG/M |
3300031561|Ga0318528_10157391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
3300031564|Ga0318573_10647155 | Not Available | 569 | Open in IMG/M |
3300031564|Ga0318573_10786120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300031572|Ga0318515_10035959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2441 | Open in IMG/M |
3300031573|Ga0310915_11245395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300031668|Ga0318542_10353721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300031670|Ga0307374_10006576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 18221 | Open in IMG/M |
3300031679|Ga0318561_10133331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1327 | Open in IMG/M |
3300031679|Ga0318561_10457110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
3300031681|Ga0318572_10522583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
3300031708|Ga0310686_108204213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
3300031708|Ga0310686_117892775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 979 | Open in IMG/M |
3300031719|Ga0306917_10021850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3962 | Open in IMG/M |
3300031723|Ga0318493_10423256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300031736|Ga0318501_10204063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
3300031770|Ga0318521_10333145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300031770|Ga0318521_10805561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia | 572 | Open in IMG/M |
3300031781|Ga0318547_10259394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
3300031781|Ga0318547_10390771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia | 853 | Open in IMG/M |
3300031782|Ga0318552_10243003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
3300031782|Ga0318552_10581809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
3300031792|Ga0318529_10375250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300031798|Ga0318523_10580399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300031799|Ga0318565_10013510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3446 | Open in IMG/M |
3300031805|Ga0318497_10264970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
3300031831|Ga0318564_10355173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300031832|Ga0318499_10188524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
3300031833|Ga0310917_10133830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1624 | Open in IMG/M |
3300031833|Ga0310917_11012111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300031846|Ga0318512_10581721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300031890|Ga0306925_10653739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1105 | Open in IMG/M |
3300031890|Ga0306925_11469084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300031893|Ga0318536_10049549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2025 | Open in IMG/M |
3300031894|Ga0318522_10276472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300031896|Ga0318551_10264478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
3300031910|Ga0306923_12500132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300031942|Ga0310916_11015922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
3300031945|Ga0310913_11007002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300031959|Ga0318530_10394246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
3300032009|Ga0318563_10012952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3957 | Open in IMG/M |
3300032009|Ga0318563_10137553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1307 | Open in IMG/M |
3300032025|Ga0318507_10229371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
3300032055|Ga0318575_10247994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
3300032059|Ga0318533_10713661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
3300032067|Ga0318524_10662701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300032076|Ga0306924_11690802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 664 | Open in IMG/M |
3300032089|Ga0318525_10034300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2486 | Open in IMG/M |
3300032089|Ga0318525_10504101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300032160|Ga0311301_11810497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300033289|Ga0310914_11704745 | Not Available | 534 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.05% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.89% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.12% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.58% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.06% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.03% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.03% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.03% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.52% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.52% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1149868223 | 3300000956 | Soil | ADNLTAERADDTVVTAPADEDVLAGDVLVEEVSIDGMCGVY* |
Ga0066398_100605902 | 3300004268 | Tropical Forest Soil | MTDNATVELADEAAVTDPGDDVAADGLADDVLVEEVSIDGMCGVY* |
Ga0066395_101848543 | 3300004633 | Tropical Forest Soil | MADSPTAELTDDTVAAAPADDDVLADDVLVEEVSIDGMCGVY* |
Ga0066395_101869353 | 3300004633 | Tropical Forest Soil | MADNLTAERTDEAVVAAPAGDPADDVLADDVLVEEVSIDGMCGVY* |
Ga0066395_101941261 | 3300004633 | Tropical Forest Soil | MADAATAELTEETAVTGSAGDLATDLADDVLVEEVSIDGMCGVY* |
Ga0066395_102546923 | 3300004633 | Tropical Forest Soil | MAGNLTAEPTGEMIVTAPADGLPADGPPADDALADDVLVEEVSIDGMCGVY* |
Ga0071328_1375762 | 3300005045 | Permafrost | MNTPAPTENTEVTASHVAEEALADDVLVEEVSIDGMCGVY* |
Ga0066683_108410882 | 3300005172 | Soil | MADVATAELAEETAVTGPADDIASDLADDVLVEEVSIDGMCGVY* |
Ga0066679_106032262 | 3300005176 | Soil | MADSLTAELTDETAVTTDDPATDLADDVLVEEVSIDGMCGVY* |
Ga0066388_1005246663 | 3300005332 | Tropical Forest Soil | MAENLTADLTDETAGTVTVDDDVLADDVLVEEVSIDGMCGVY* |
Ga0066388_1007990551 | 3300005332 | Tropical Forest Soil | MADAATAELTEETAVTGPAGDLASDLADDVLVEEVSIDGMCGVY* |
Ga0066388_1060172291 | 3300005332 | Tropical Forest Soil | MADNAIIDLIDETADTQPADDLADDVLVEEVSIDGMCGVY* |
Ga0008090_158099162 | 3300005363 | Tropical Rainforest Soil | MADSPTAELTDETVVAAPADDDVLADDVLVEEVSIDGMCGVY |
Ga0070709_100016325 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MADAATAELTEETAVTGPADDHASDLADDVLVEEVSIDGMCGVY* |
Ga0070714_1003405203 | 3300005435 | Agricultural Soil | MADAATAELTEETAVTGPADDIASDLADDVLVEEVSIDGMCGVY* |
Ga0070714_1005540951 | 3300005435 | Agricultural Soil | GASMADNLTAERTGETVVTAPAGDLADDVLADDVLADDVLVEEVSIDGMCGVY* |
Ga0070713_1000294754 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MADVATAPLTEETAVTGPADDPASDPASDLADDVLVEEVSIDGMCGVY* |
Ga0070711_1003742941 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MADSATAELTDEAAVTASGDDLASDLAEDVLVEEVSIDGMCGVY* |
Ga0070706_1000155013 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MADTSTAEPTEQTTVTTPVGDPASDLADDVLVEEVSIDGMCGVY* |
Ga0070707_10000016028 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MADTSTAEPTEQTTVTTPVGDPASDLGDDVLVEEVSIDGMCGVY* |
Ga0070737_101620972 | 3300005524 | Surface Soil | MDEPTTPATAEQADDTSTSAVAVEPVAAEVLVEEVSIDGMCGVY* |
Ga0070734_100200455 | 3300005533 | Surface Soil | MADAATAELTEETAVTGPADDLAGDLAEDVLVEEVSIDGMCGVY* |
Ga0070733_102520602 | 3300005541 | Surface Soil | MAESTTAELTDETAVTGDDLASDLAGEVLAGEVLVEEVSIDGMCGVY* |
Ga0066692_103474221 | 3300005555 | Soil | MPDAATAPLTEETAATGPADDLASDLADDVLVEEVSIDGMCGVY* |
Ga0066905_1007654562 | 3300005713 | Tropical Forest Soil | MADNATVELADEAAVTDPGDDVAADGLADDVLVEEVSIDGMCGVY* |
Ga0066903_1002753122 | 3300005764 | Tropical Forest Soil | MADSATAELTEETAVTDDDLATDLAEDVLVEEVSIDGMCGVY* |
Ga0066903_1006436713 | 3300005764 | Tropical Forest Soil | MADNATVELAGEAAVTDPGDDVAADGLADDVLVEEVSIDGMCGVY* |
Ga0066903_1007986653 | 3300005764 | Tropical Forest Soil | MADNLTAERADETVVTAPTGDFADDVLADDVLVEEVSIDGMCGVY* |
Ga0066903_1031100532 | 3300005764 | Tropical Forest Soil | MADAATAELTEETAVTCPAGDVASDLAGDVLVEEVSIDGMCGVY* |
Ga0066903_1031657261 | 3300005764 | Tropical Forest Soil | MADSPTAELTDETVAPAPADDDVLADDVLVEEVSIDGMCGVY* |
Ga0066903_1033574191 | 3300005764 | Tropical Forest Soil | MADSPTAELTDETVAAAPADNDVLADDVLVEEVSIDGMCGVY* |
Ga0066903_1034731631 | 3300005764 | Tropical Forest Soil | YRPKPRHKGATMADSPTAELTDEAARTGARDDAASDLADDVLVEEVSIDGMCGVY* |
Ga0066903_1046458393 | 3300005764 | Tropical Forest Soil | MADNLTAERADETVVTAPADDLADDALADDVLVEEVSIDGMCGVY* |
Ga0066903_1047055631 | 3300005764 | Tropical Forest Soil | MADAATAELTEETAVTGPAGDLASDLADDVLVEEVSIDG |
Ga0066903_1081027502 | 3300005764 | Tropical Forest Soil | MADAATAELTEETAVTGSAGDLASDLADDVLVEEVSIDGMCGVY* |
Ga0070766_101993282 | 3300005921 | Soil | MADSATAELTDEAAVTASGDDLASDLASDLAEDVLVEEVSIDGMCGVY* |
Ga0070717_107528642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MADTSTAELTEQATVTTPAGDPDSDLADDVLVEEVSIDGMCGVY* |
Ga0070712_1001775763 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MADNLTADRADETVVTAPGDLADDVLADDVLVEEVSIDGMCGVY* |
Ga0079222_101043723 | 3300006755 | Agricultural Soil | MADAATAELTEEAAVTGPADDIASDLADDVLVEEVSIDGMCGVY* |
Ga0079222_110780813 | 3300006755 | Agricultural Soil | MADAATAELTGETAVTGTADDLASDLADDVLVEEVSIDGMCGVY* |
Ga0079221_109257933 | 3300006804 | Agricultural Soil | MADAATVELTEETAVTGPADDLASDLADDVLVEEVSIDGMCGVY* |
Ga0079220_115117462 | 3300006806 | Agricultural Soil | MADNLTADRADETVGTAPGGLADDVLADDVLVEEVSIDGMCGVY* |
Ga0073928_105549311 | 3300006893 | Iron-Sulfur Acid Spring | DEYRPYPRREGATMAESTTAELTDETAVTGDDLASDQAGEVLAGEVLVEEVSIDGMCGVY |
Ga0075435_1004075353 | 3300007076 | Populus Rhizosphere | MADAATAPLTEETAVTGPADGLASDLAGDLAGDVLVEEVSIDGMCGVY* |
Ga0099830_109253441 | 3300009088 | Vadose Zone Soil | GGETAVTGPGGETAVAGPGGDLADDVLVEEVSIDGMCGVY* |
Ga0099827_101300152 | 3300009090 | Vadose Zone Soil | MADSLTAELTDETAVTADDLATDLADDVLVEEVSIDGMCGVY* |
Ga0099792_103072572 | 3300009143 | Vadose Zone Soil | MADSTTAELADEAAVTASGDDLASDLAEDVLVEEVSIDGMCGVY* |
Ga0116217_100415505 | 3300009700 | Peatlands Soil | MADSPAAADLADDATVTEPDDVLADDVLVEEVSIDGMCGVY* |
Ga0126380_1000008817 | 3300010043 | Tropical Forest Soil | MAENLTADLTDETAGTATVDDDVLADDVLVEEVSIDGMCGVY* |
Ga0126380_100114013 | 3300010043 | Tropical Forest Soil | MTDNATVELAYEAAVTDPGDDVAADGLADDVLVEEVSIDGMCGVY* |
Ga0126380_104100662 | 3300010043 | Tropical Forest Soil | MADNLTAERTDEAVVTAPAGDLADDVLADDVLVEEVSIDGMCGVY* |
Ga0126384_100090691 | 3300010046 | Tropical Forest Soil | MADNATVELASEAAVTDPGDDVAADGLADDVLVEEVSIDGMCGVY* |
Ga0126384_102210283 | 3300010046 | Tropical Forest Soil | MADNLTAERTDETAITAPADDDLLAGDVLVEEVSIDGMCGVY* |
Ga0126384_115395741 | 3300010046 | Tropical Forest Soil | TADLTDETAGTATVDDDVLADDVLVKEVSIDGMCGVY* |
Ga0126382_103534273 | 3300010047 | Tropical Forest Soil | MAENPTADLTDETAGTVTVDDDVLADDVLVEEVSIDGMCGVY* |
Ga0126382_105773383 | 3300010047 | Tropical Forest Soil | MADMPAADLAVEMAVTGPADAVAGDGLAGDGLAGDALAADVLVEEVSIDGMCGVY* |
Ga0126373_111268513 | 3300010048 | Tropical Forest Soil | MAGNLTAEPTGEMIVTAPADDALADDVLVEEVSIDGMCGVY* |
Ga0126373_131196242 | 3300010048 | Tropical Forest Soil | MADAATAELTEETAVTGPAGDVASDLADDVLVEEVSIDG |
Ga0126370_104461562 | 3300010358 | Tropical Forest Soil | MADAATVELTEETAVTGPAGDLASDLADDVLVEEVSIDGMCGVY* |
Ga0126370_107004012 | 3300010358 | Tropical Forest Soil | MAESPTAELTDDTVSAAPAGDDVLADDVLVEEVSIDGMCGVY* |
Ga0126370_107402051 | 3300010358 | Tropical Forest Soil | MADNLTAERADETVVTAPVDDLADDVLADDVLVEEVSIDGMCGVY* |
Ga0126376_107384933 | 3300010359 | Tropical Forest Soil | MADAATAELTEETAVTGLADDLASDLADDVLVEEVSIDGMCGVY* |
Ga0126372_100093925 | 3300010360 | Tropical Forest Soil | MADNATVELADEAAVTDPGDDVAGDGLADDVLVEEVSIDGMCGVY* |
Ga0126372_112285252 | 3300010360 | Tropical Forest Soil | MADAATAELTEETAVTGPADDLASDLADDVLVEEVSI |
Ga0126378_102600213 | 3300010361 | Tropical Forest Soil | MADNLTAERTDETAITAPADDDLLADDVLVEEVSIDGMCGVY* |
Ga0126378_115541361 | 3300010361 | Tropical Forest Soil | MADAATAELTEETAVTGPADDLASDLADDVLVEEVSIDGMCGVY* |
Ga0126379_100250055 | 3300010366 | Tropical Forest Soil | MTDNATVELAGEAAVTDPGDDVAADGLADDVLVEEVSIDGMCGVY* |
Ga0126379_120057532 | 3300010366 | Tropical Forest Soil | MADSPTAELTGDTVVAAPADDDVLADDVLVEEVSIDGMCGVY* |
Ga0126381_1029316371 | 3300010376 | Tropical Forest Soil | MADVATAELTEETAVTGPAGDVASDLADDVLVEEVSIDGMCGVY* |
Ga0136449_1026707332 | 3300010379 | Peatlands Soil | MADSTTAELTDETAVTGDDLAGDLADEVLVEEVSIDGMCGVY* |
Ga0126383_113714733 | 3300010398 | Tropical Forest Soil | SMADNLTAERTDEAVVTAPAGDLADDVLADDVLVEEVSIDGMCGVY* |
Ga0126383_120150911 | 3300010398 | Tropical Forest Soil | MADNLTAELTDETVVTAPADDLADDVLADDVLVEAVSIDGMCGVY* |
Ga0126383_124357072 | 3300010398 | Tropical Forest Soil | MADSPTAELTDDTVVAAPADDDVLADDVLVEEVSIDGMCGVY* |
Ga0134122_122614552 | 3300010400 | Terrestrial Soil | MAENLTVERTDETVVTAPACDLADDALADDVLVEEVS |
Ga0126344_11499873 | 3300010866 | Boreal Forest Soil | ADSATAELTEQAAVTASGDDLASDLAEDVLVEEVSIDGMCGVY* |
Ga0126361_103092833 | 3300010876 | Boreal Forest Soil | MADSATAELTEQAAVTASGDDLASDLAEDVLVEEVSIDGMCGVY* |
Ga0137776_12198672 | 3300010937 | Sediment | MADAATAELTEEPAVTGPADDIASDLADDVLVEEVSIDGMCGVY* |
Ga0150983_132150992 | 3300011120 | Forest Soil | EYRPYPRREGATMPDAATAELTEETAVTGPADDIASDLADDVLVEEVSIDGMCGVY* |
Ga0137392_100785343 | 3300011269 | Vadose Zone Soil | MADNAATMADTPTAELTDETAVTGPGGETAVAGPGGDLADDVLVEEVSIDGMCGVY* |
Ga0137393_107164192 | 3300011271 | Vadose Zone Soil | MADNAATMADTPTAELTDETAVTGPGGETAVTGPGGETAVAGPGGDLADDVLVEEVSIDGMCGVY* |
Ga0137388_100777111 | 3300012189 | Vadose Zone Soil | ELTDETAVTGPGGETAVAGPGGDLADDVLVEEVSIDGMCGVY* |
Ga0137383_102872813 | 3300012199 | Vadose Zone Soil | MADSATAELTDEAAVTASGDDLASDLADDVLVEEVSIDGMCGVY* |
Ga0137365_101392843 | 3300012201 | Vadose Zone Soil | MADSLTAELTDETAVTADDLAADLADDVLVEEVSIDGMCGVY* |
Ga0137380_100140323 | 3300012206 | Vadose Zone Soil | MADSLTAELTDDTAVTADDLATDLADDVLVEEVSIDGMCGVY* |
Ga0137371_101957363 | 3300012356 | Vadose Zone Soil | MADVATTELAEETAVTGPADDIASDLADDVLVEEVSIDGMCGVY* |
Ga0137371_102267973 | 3300012356 | Vadose Zone Soil | MADSLTAELTDDPAVTADDLAADLADDVLVEEVSIDGMCGVY* |
Ga0126369_100663815 | 3300012971 | Tropical Forest Soil | MADSATAELTEETAVTDDDLAADLAEDVLVEEVSIDGMCGVY* |
Ga0126369_103200473 | 3300012971 | Tropical Forest Soil | MTDNLTAERTDEAVVAAPAGDPADDVLADDVLVEEVSIDGMCGVY* |
Ga0182041_113776552 | 3300016294 | Soil | MADSATAELTEETAGTGPADDLASDLADDALVEEVSIDGMCGVY |
Ga0182040_114139431 | 3300016387 | Soil | EGAPMADNLTAERADKTVVTAPADDFADDALADDVLVEEVSIDGMCGVY |
Ga0182037_102315293 | 3300016404 | Soil | MADSPTAELTDDAARTGAGDDAAGDLADDVLVEEVFIDGMCGVY |
Ga0066667_111710392 | 3300018433 | Grasslands Soil | MADVATAELAEETAVTGPADDIASDLADDVLVEEVSIDGMCGVY |
Ga0179592_101797892 | 3300020199 | Vadose Zone Soil | MADSTTAELADEAAVTASGDGLASDLAEDVLVEEVSIDGMCGVY |
Ga0210407_103512411 | 3300020579 | Soil | YPRREGAIMADSATAELTDEAAVTASGDDLASDLAEDVLVEEVSIDGMCGVY |
Ga0179596_101576993 | 3300021086 | Vadose Zone Soil | LTDETAVTGPGGETAVTGPGGETAVAGPGGDLADDVLVEEVSIDGMCGVY |
Ga0210405_110074992 | 3300021171 | Soil | MAESTTAELTDETAVTRDDLASDPAGEVLAGEVLVEEVSIDGMCGVY |
Ga0210408_106203272 | 3300021178 | Soil | MADSLTAELTDETAVTADDPATDLAGDVLAGDVLVEEVSIDGMCGVY |
Ga0210393_102676741 | 3300021401 | Soil | MADSATAELTDEAAVTASGDDLASDLASDLAEDVLVEEVSIDGMCGVY |
Ga0210385_101767133 | 3300021402 | Soil | MADSTTAERTDEPAVAGDDLAGDLAGEVLAGEVLVEEVSIDGMCGVY |
Ga0210397_108517381 | 3300021403 | Soil | ATMADSATAELTDEAAVTASGDDLASDLAEDVLVEEVSIDGMCGVY |
Ga0210397_115307922 | 3300021403 | Soil | MAESTTAELTDETAVTGDDLADDQAGEVLAGEVLVEEVSIDGMCGVY |
Ga0210394_104833902 | 3300021420 | Soil | MAESTTAELTDETAVTGDDLASDLAGEVLAGEVLVEEVSIDGMCGVY |
Ga0210384_110464821 | 3300021432 | Soil | MSDSATAELTDEAAVTASGDDLASDLAEDVLVEEVSIDGMCGVY |
Ga0210391_100810752 | 3300021433 | Soil | MADSTTAELTGETAVAGDDPASDLADEVLVEEVSIDGMCGVY |
Ga0210398_108433411 | 3300021477 | Soil | ADSTTAELTGETAVAGDDPASDLADEVLVEEVSIDGMCGVY |
Ga0210402_105682121 | 3300021478 | Soil | MADAATVELTEETAVTGPADDHASDLADDVLVEEVSIDGMCGVY |
Ga0126371_104267282 | 3300021560 | Tropical Forest Soil | MAGNLTAEPTGEMIVTAPADGLPADGPPADDALADDVLVEEVSIDGMCGVY |
Ga0126371_106000893 | 3300021560 | Tropical Forest Soil | MADNLTAERTDEAVVAAPAGDPADDVLADDVLVEEVSIDGMCGVY |
Ga0126371_111245001 | 3300021560 | Tropical Forest Soil | MADAATAELTEETAVTGPAGDLASDLADDVLVEEVSIDGMCGVY |
Ga0126371_114419752 | 3300021560 | Tropical Forest Soil | MADNLTAERTEETVVAVPAGDLADDVLADDVLVEEVSIDGMCGVY |
Ga0126371_116003372 | 3300021560 | Tropical Forest Soil | MADAATAELTEETAVAGHADDLATDLAEDVLVEEVSIDGMCGVY |
Ga0213851_13734113 | 3300021860 | Watersheds | MADNLTAEPTDEMVVTAPAGDLADDVLADDVLVEEVSIDGMCGVY |
Ga0242674_10678362 | 3300022711 | Soil | EYRPYPRRKGATMADSTTAELTGETAVAGDDPASDLADEVLVEEVSIDGMCGVY |
Ga0207684_100135703 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MADTSTAEPTEQTTVTTPVGDPASDLADDVLVEEVSIDGMCGVY |
Ga0207684_103708283 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MADAATAELTEETAVTGPADDIASDLADDVLVEEVSIDGMCGVY |
Ga0207693_110589833 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MADNLTADRADETVVTAPGDLADDVLADDVLVEEVSIDGMCGVY |
Ga0207646_1000020239 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MADTSTAEPTEQTTVTTPVGDPASDLGDDVLVEEVSIDGMCGVY |
Ga0207700_100594323 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MADVATAPLTEETAVTGPADDPASDPASDLADDVLVEEVSIDGMCGVY |
Ga0207667_104015871 | 3300025949 | Corn Rhizosphere | MTPTATDAVVVEAQQDETTVDDVVVDDVLVEEVSIDGMCGVY |
Ga0209684_10135262 | 3300027527 | Tropical Forest Soil | MADNATVELADEAAVTDPGDDVAADGLADDVLVEEVSIDGMCGVY |
Ga0209799_10017235 | 3300027654 | Tropical Forest Soil | MTDNATVELADEAAVTDPGDDVAADGLADDVLVEEVSIDGMCGVY |
Ga0209178_11476571 | 3300027725 | Agricultural Soil | MADAATAELTEEAAVTGPADDIASDLADDVLVEEVSIDGMCGVY |
Ga0209060_101896103 | 3300027826 | Surface Soil | MADAATAELTEETAVTGPADDLAGDLAEDVLVEEVSIDGMCGVY |
Ga0209517_104364102 | 3300027854 | Peatlands Soil | MADSPAAADLADDATVTEPDDVLADDVLVEEVSIDGMCGVY |
Ga0209465_100984143 | 3300027874 | Tropical Forest Soil | MADNLTAERADETVVIAPADDLADDVLADDVLVEEVSIDGMCGVY |
Ga0209465_102992232 | 3300027874 | Tropical Forest Soil | MADSPTAELTDDTVAAAPADDDVLADDVLVEEVSIDGMCGVY |
Ga0209465_103477551 | 3300027874 | Tropical Forest Soil | MADAATAELTEETAVTGPAGDVASDLADDVLVEEVSIDGMCGVY |
Ga0209465_104451232 | 3300027874 | Tropical Forest Soil | MADNATVELASEAAVTDPGDEVAADGLADDVLVEEVSIDGMCGVY |
Ga0209590_100657393 | 3300027882 | Vadose Zone Soil | MADSLTAELTDETAVTADDLATDLADDVLVEEVSIDGMCGVY |
Ga0247827_110936312 | 3300028889 | Soil | MADPTTAPELETAPAAEAADDDVVVTEVLVEEVSIDGMCGVY |
Ga0222749_107390043 | 3300029636 | Soil | MPDAATAELTEETAVTGPADDIASDLADDVLVEEVSIDGMCGVY |
Ga0222748_10856233 | 3300029701 | Soil | MAESTTAELTDETADTRDDLASDPAGEVLAGEVLVEEVSIDGMCGVY |
Ga0318516_100180704 | 3300031543 | Soil | MADAAIAELTEETAVTGSAGDLATDLADDVLVEEVSIDGMCGVY |
Ga0318516_100669163 | 3300031543 | Soil | MADSPTAELTDETVPTGPEDDLAGDLAGDVLVEEVSIDGMCGVY |
Ga0318516_101258013 | 3300031543 | Soil | MADNLTAERADKTVVTAPADDFADDALADDVLVEEVSIDGMCGVY |
Ga0318516_102708232 | 3300031543 | Soil | MADSPTAELTDDAARTGAGDDAAGDLADDVLVEEVSIDGMCGVY |
Ga0318516_105054041 | 3300031543 | Soil | RREGALMADNLTAERADETVVTASADDLADDALADDVLVEEVSIDGMCGVY |
Ga0318534_100803383 | 3300031544 | Soil | MADSPTAELTDETVAAAPGDDDVLADDVLVEEVSIDGMCGVY |
Ga0318534_102036341 | 3300031544 | Soil | CDEYRPKPRHKGATMADSPTAELTDDAARTGAGDDAAGDLADDVLVEEVSIDGMCGVY |
Ga0318534_103054702 | 3300031544 | Soil | MADNLTAERADETVVTASADDLADDALADDVLVEEVSIDGMCGVY |
Ga0318538_100210715 | 3300031546 | Soil | MADSPTAELTDETVPTGPEDDLAGDLAGDVLVEEVS |
Ga0318538_101397502 | 3300031546 | Soil | MADNLTAERADETVVTASADDLADDALADDGLVEEVSIDGMCGVY |
Ga0318538_102094043 | 3300031546 | Soil | MADNLTTERADETVVTAPIGDLADDVLADDVLVEEVSIDGMCGVY |
Ga0318571_100483572 | 3300031549 | Soil | MADAAIAELTEETAITGSAGDLATDLADDVLVEEVSIDGMCGVY |
Ga0318528_101573913 | 3300031561 | Soil | MADNLTAERADETVVTASADDLADDALTDDVLVEEVSIDGMCGVY |
Ga0318573_106471551 | 3300031564 | Soil | HCDEYRPYPRREGALMADNLTAERADETVVTASADDLADDALADDVLVEEVSIDGMCGVY |
Ga0318573_107861202 | 3300031564 | Soil | MADNLTTERADETVVTAPIGDFADDVLTDDVLVEEVSID |
Ga0318515_100359594 | 3300031572 | Soil | MADSPTAELTDETVPTGPEDDVAGDLAGDVLVEEVSIDGMCGVY |
Ga0310915_112453953 | 3300031573 | Soil | LTEETADTGPADDLAGDLADDVLVEEVSIDGMCGVY |
Ga0318542_103537211 | 3300031668 | Soil | MADNLTAERADETVVTASADDLADDALTDDVLVEEVSIDG |
Ga0307374_100065769 | 3300031670 | Soil | MADDPAAGFTDGTSEAPPGDAVAEDVLAEDVLVEEVSIDGMCGVY |
Ga0318561_101333313 | 3300031679 | Soil | MADAAIAELTEETAIAGSAGDLATDLADDVLVEEVSIDGMCGVY |
Ga0318561_104571101 | 3300031679 | Soil | DSPTAELTDETVPTGPEDDVAGDLAGDVLVEEVSIDGMCGVY |
Ga0318572_105225831 | 3300031681 | Soil | DEYRPFPREGAIMADNRTAELTDEAVVTAPADDDVLADDVLVEEVSIDGMCGVY |
Ga0310686_1082042131 | 3300031708 | Soil | GRLLACLYSAHCDEYRPYLRRKGATMADSTADELTDETAVAGDDLASDLADEVLVEEVSIDGMCGVY |
Ga0310686_1178927751 | 3300031708 | Soil | MADSTTAELTGETAVAGDDPASDLADEVLVEEVSIDGM |
Ga0306917_100218503 | 3300031719 | Soil | MADSPTAELTDETVAAAPADDDALADDVLVEEVSIDGMCGVY |
Ga0318493_104232562 | 3300031723 | Soil | MADSPTAELTDETVVAAPAADDVLADDVLVEEVSIDGMCGVY |
Ga0318501_102040633 | 3300031736 | Soil | MADNLTAERADETVVTASADDLADDALADDALVEEVSIDGMCGVY |
Ga0318521_103331452 | 3300031770 | Soil | MAENLTAEPTDETVVTAPADDLAGDVLAGDVLVEE |
Ga0318521_108055612 | 3300031770 | Soil | MADNLTAERADETVVTASADDLADDALADDVLVEEVSIDGMC |
Ga0318547_102593943 | 3300031781 | Soil | MADNLTTERADETVVTAPIGDFADDVLTDAVLVEEVSIDGMCGVY |
Ga0318547_103907712 | 3300031781 | Soil | MADNLTAERADGTVVTASADDPADDALADDVLVEEVSIDGMCGVY |
Ga0318552_102430032 | 3300031782 | Soil | MADAATAELTEETAVTGPGEDVASDLADDVLVEEVSIDGMCGV |
Ga0318552_105818092 | 3300031782 | Soil | MADNLTTERADETVVTAPIGDFADDVLTDDVLVEEVSI |
Ga0318529_103752503 | 3300031792 | Soil | AERADETVVTASADDLADDALADDVLVEEVSIDGMCGVY |
Ga0318523_105803991 | 3300031798 | Soil | REGATMADSPTAELTDETVAAAPGDDDVLADDVLVEEVSIDGMCGVY |
Ga0318565_100135101 | 3300031799 | Soil | DSPTAELTDDTVAAAPADDDVLADDVLVEEVSIDGMCGVY |
Ga0318497_102649702 | 3300031805 | Soil | MADSPTAELTDDAARTGAGDDAAGDLADDVLVEEVSIDGM |
Ga0318564_103551732 | 3300031831 | Soil | MADAATATLTEETADTGPADDLAGDLADDVLVEEVSIDGMC |
Ga0318499_101885241 | 3300031832 | Soil | DEYRPKPRHKGATMADSPTAELTDDAARTGAGDDAAGDLADDVLVEEVSIDGMCGVY |
Ga0310917_101338303 | 3300031833 | Soil | RREGATMADSPTAELTDETVAAAPGDDDVLADDVLVEEVSIDGMCGVY |
Ga0310917_110121111 | 3300031833 | Soil | GAPMADNLTAERADETVVTASADDLADDALAADVLVEEVSIDGMCGVY |
Ga0318512_105817212 | 3300031846 | Soil | MTDSPTTELTDETVRTGPDDDAAGDLAGDVLVEEVSIDGMCGVY |
Ga0306925_106537393 | 3300031890 | Soil | MADAATATLTEETADTGPADDLAGDLADDVLVEEVSIDGMCGVY |
Ga0306925_114690841 | 3300031890 | Soil | MADNLTAERADKTVVTAPADDFADDALADDDLVEEVSIDGM |
Ga0318536_100495493 | 3300031893 | Soil | MADNLTTERADETVVTAPIGDFADDVLTDDVLVEEVSIDGMCGVY |
Ga0318522_102764722 | 3300031894 | Soil | MADSPTAELTDETVPTGPEDDLAGDLAGDVLVEEVSID |
Ga0318551_102644782 | 3300031896 | Soil | MADNRTAELTDEAVVTAPADDDVLADDVLVEEVSIDGMCGVY |
Ga0306923_125001321 | 3300031910 | Soil | MADAATAPLTEETADTGPADDLASDLADDVLVEEVSIDGMCGVY |
Ga0310916_110159221 | 3300031942 | Soil | MADSPTAELTDETVRTGPDDDDAGDLAGDVLVEEVSIDGMCGVY |
Ga0310913_110070021 | 3300031945 | Soil | DNLTAERADETVVTAPADDLADDALADDVLVEEVSIDGMCGVY |
Ga0318530_103942463 | 3300031959 | Soil | ELTDETVAAAPGDDDVLADDVLVEEVSIDGMCGVY |
Ga0318563_100129521 | 3300032009 | Soil | MADSPTAELTDDAARTGAGDDAAGDLADDVLVEEVSIDGMC |
Ga0318563_101375533 | 3300032009 | Soil | MADAATATLTEETADTGPADDLAGDLADDVLVEEVSIDG |
Ga0318507_102293711 | 3300032025 | Soil | KPRHKGAAMADSPTAELTDDAARTGAGDDAAGDLADDVLVEEVSDGMCGVY |
Ga0318575_102479942 | 3300032055 | Soil | MADSPTAELTDETVPTGPEDDLAGDLAGDVLVEEVSIDG |
Ga0318533_107136611 | 3300032059 | Soil | DRRREGATMADSPTAELTDETVAAAPGDDDVLADDVLVEEVSIDGMCGVY |
Ga0318524_106627011 | 3300032067 | Soil | MADNRTAELTDEAVVTAPADDDVLADDVLVEEVSIDGMC |
Ga0306924_116908021 | 3300032076 | Soil | SPTAELTDETVPTGPEDDLAGDLAGDVLVEEVSIDGMCGVY |
Ga0318525_100343004 | 3300032089 | Soil | AELTDETVAAAPGDDDVLADDVLVEEVSIDGMCGVY |
Ga0318525_105041012 | 3300032089 | Soil | MADSATAELTEETAGTGPADDLASDLADDALVEEVSIDGM |
Ga0311301_118104971 | 3300032160 | Peatlands Soil | MADSTTAELTDETAVTGDDLAGDLADEVLVEEVSIDGMCGVY |
Ga0310914_117047452 | 3300033289 | Soil | MADNLTAERADETVVTAPADDLADDALADDVLVEEVSIDGMCGVY |
⦗Top⦘ |