Basic Information | |
---|---|
Family ID | F027606 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 194 |
Average Sequence Length | 42 residues |
Representative Sequence | LLSNWITYDAPFAAKLRMAASNTFIKLRKRQACCGNNGQPGC |
Number of Associated Samples | 148 |
Number of Associated Scaffolds | 194 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 39.18 % |
% of genes near scaffold ends (potentially truncated) | 41.24 % |
% of genes from short scaffolds (< 2000 bps) | 82.99 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.773 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.474 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.381 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.753 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 194 Family Scaffolds |
---|---|---|
PF00296 | Bac_luciferase | 3.61 |
PF02567 | PhzC-PhzF | 2.58 |
PF13302 | Acetyltransf_3 | 2.58 |
PF00248 | Aldo_ket_red | 2.58 |
PF08240 | ADH_N | 2.58 |
PF08223 | PaaX_C | 2.06 |
PF13434 | Lys_Orn_oxgnase | 2.06 |
PF00196 | GerE | 1.55 |
PF00583 | Acetyltransf_1 | 1.55 |
PF13649 | Methyltransf_25 | 1.55 |
PF00753 | Lactamase_B | 1.55 |
PF08241 | Methyltransf_11 | 1.55 |
PF07690 | MFS_1 | 1.55 |
PF13462 | Thioredoxin_4 | 1.03 |
PF02423 | OCD_Mu_crystall | 1.03 |
PF00571 | CBS | 1.03 |
PF04075 | F420H2_quin_red | 1.03 |
PF00440 | TetR_N | 1.03 |
PF07992 | Pyr_redox_2 | 1.03 |
PF00005 | ABC_tran | 1.03 |
PF01699 | Na_Ca_ex | 1.03 |
PF12697 | Abhydrolase_6 | 1.03 |
PF00724 | Oxidored_FMN | 1.03 |
PF00920 | ILVD_EDD | 1.03 |
PF07366 | SnoaL | 1.03 |
PF01022 | HTH_5 | 0.52 |
PF00082 | Peptidase_S8 | 0.52 |
PF12681 | Glyoxalase_2 | 0.52 |
PF01526 | DDE_Tnp_Tn3 | 0.52 |
PF11716 | MDMPI_N | 0.52 |
PF02738 | MoCoBD_1 | 0.52 |
PF00291 | PALP | 0.52 |
PF01988 | VIT1 | 0.52 |
PF13539 | Peptidase_M15_4 | 0.52 |
PF13669 | Glyoxalase_4 | 0.52 |
PF00689 | Cation_ATPase_C | 0.52 |
PF13538 | UvrD_C_2 | 0.52 |
PF04185 | Phosphoesterase | 0.52 |
PF10604 | Polyketide_cyc2 | 0.52 |
PF03466 | LysR_substrate | 0.52 |
PF13419 | HAD_2 | 0.52 |
PF00350 | Dynamin_N | 0.52 |
PF02585 | PIG-L | 0.52 |
PF01790 | LGT | 0.52 |
PF13191 | AAA_16 | 0.52 |
PF07452 | CHRD | 0.52 |
PF13847 | Methyltransf_31 | 0.52 |
PF00149 | Metallophos | 0.52 |
PF01979 | Amidohydro_1 | 0.52 |
PF12802 | MarR_2 | 0.52 |
PF13474 | SnoaL_3 | 0.52 |
PF13489 | Methyltransf_23 | 0.52 |
PF00491 | Arginase | 0.52 |
PF02922 | CBM_48 | 0.52 |
PF13472 | Lipase_GDSL_2 | 0.52 |
PF12647 | RNHCP | 0.52 |
PF01243 | Putative_PNPOx | 0.52 |
PF14246 | TetR_C_7 | 0.52 |
PF13532 | 2OG-FeII_Oxy_2 | 0.52 |
PF13565 | HTH_32 | 0.52 |
PF04226 | Transgly_assoc | 0.52 |
PF08669 | GCV_T_C | 0.52 |
PF02954 | HTH_8 | 0.52 |
PF09983 | DUF2220 | 0.52 |
PF03992 | ABM | 0.52 |
PF07969 | Amidohydro_3 | 0.52 |
PF05988 | DUF899 | 0.52 |
PF12900 | Pyridox_ox_2 | 0.52 |
PF07876 | Dabb | 0.52 |
PF04672 | Methyltransf_19 | 0.52 |
COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 3.61 |
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 2.58 |
COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 2.06 |
COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 2.06 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.03 |
COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 1.03 |
COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 1.03 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 1.03 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 1.03 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.52 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.52 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.52 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.52 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.52 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.52 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.52 |
COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.77 % |
Unclassified | root | N/A | 24.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY01B5OR4 | Not Available | 521 | Open in IMG/M |
2189573004|GZGWRS401CRLPR | Not Available | 523 | Open in IMG/M |
3300004152|Ga0062386_100223489 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300004281|Ga0066397_10013039 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300005332|Ga0066388_102978448 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300005332|Ga0066388_108782122 | Not Available | 502 | Open in IMG/M |
3300005434|Ga0070709_11455135 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005435|Ga0070714_101855056 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005436|Ga0070713_101092750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
3300005445|Ga0070708_100022543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 5341 | Open in IMG/M |
3300005445|Ga0070708_100340397 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300005445|Ga0070708_100378047 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300005602|Ga0070762_11042744 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005764|Ga0066903_100117090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3684 | Open in IMG/M |
3300005764|Ga0066903_100265961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2668 | Open in IMG/M |
3300005764|Ga0066903_101346121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1337 | Open in IMG/M |
3300006059|Ga0075017_100750170 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300006173|Ga0070716_101124064 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300006176|Ga0070765_100314623 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300006176|Ga0070765_102267628 | Not Available | 506 | Open in IMG/M |
3300006871|Ga0075434_101866585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300006953|Ga0074063_13138768 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006954|Ga0079219_10965330 | Not Available | 701 | Open in IMG/M |
3300007788|Ga0099795_10063729 | Not Available | 1375 | Open in IMG/M |
3300009088|Ga0099830_10060045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2718 | Open in IMG/M |
3300009089|Ga0099828_10081198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2768 | Open in IMG/M |
3300009143|Ga0099792_10412643 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300009520|Ga0116214_1000484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 16497 | Open in IMG/M |
3300009520|Ga0116214_1208797 | Not Available | 736 | Open in IMG/M |
3300009683|Ga0116224_10228577 | Not Available | 889 | Open in IMG/M |
3300010043|Ga0126380_10484485 | Not Available | 945 | Open in IMG/M |
3300010043|Ga0126380_11620970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
3300010047|Ga0126382_11833819 | Not Available | 571 | Open in IMG/M |
3300010048|Ga0126373_10261197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1709 | Open in IMG/M |
3300010048|Ga0126373_10397608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1402 | Open in IMG/M |
3300010048|Ga0126373_10592425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1160 | Open in IMG/M |
3300010048|Ga0126373_13217345 | Not Available | 508 | Open in IMG/M |
3300010343|Ga0074044_10354127 | Not Available | 963 | Open in IMG/M |
3300010359|Ga0126376_11569439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
3300010360|Ga0126372_11359286 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300010361|Ga0126378_11793919 | Not Available | 698 | Open in IMG/M |
3300010362|Ga0126377_13410918 | Not Available | 514 | Open in IMG/M |
3300010366|Ga0126379_13634854 | Not Available | 517 | Open in IMG/M |
3300010376|Ga0126381_101271521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
3300010376|Ga0126381_101879165 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300010379|Ga0136449_103656303 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300010396|Ga0134126_11538720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
3300010398|Ga0126383_11195471 | Not Available | 850 | Open in IMG/M |
3300010876|Ga0126361_11077544 | Not Available | 970 | Open in IMG/M |
3300012189|Ga0137388_10219008 | Not Available | 1722 | Open in IMG/M |
3300012189|Ga0137388_10497802 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300012199|Ga0137383_10028021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3943 | Open in IMG/M |
3300012199|Ga0137383_10199981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1465 | Open in IMG/M |
3300012199|Ga0137383_10634918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 781 | Open in IMG/M |
3300012206|Ga0137380_10307151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1420 | Open in IMG/M |
3300012209|Ga0137379_11826426 | Not Available | 502 | Open in IMG/M |
3300012356|Ga0137371_10604290 | Not Available | 842 | Open in IMG/M |
3300012363|Ga0137390_11797946 | Not Available | 544 | Open in IMG/M |
3300012685|Ga0137397_11107341 | Not Available | 576 | Open in IMG/M |
3300012957|Ga0164303_10291331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 957 | Open in IMG/M |
3300012971|Ga0126369_10773595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1041 | Open in IMG/M |
3300013296|Ga0157374_11362173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 732 | Open in IMG/M |
3300013308|Ga0157375_11489025 | Not Available | 799 | Open in IMG/M |
3300015371|Ga0132258_10542824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2913 | Open in IMG/M |
3300015373|Ga0132257_100974915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1066 | Open in IMG/M |
3300016270|Ga0182036_10225864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1388 | Open in IMG/M |
3300016294|Ga0182041_11879389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
3300016319|Ga0182033_10282142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1363 | Open in IMG/M |
3300016319|Ga0182033_10310061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1306 | Open in IMG/M |
3300016319|Ga0182033_10496239 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300016341|Ga0182035_10548122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
3300016404|Ga0182037_10735858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 846 | Open in IMG/M |
3300017821|Ga0187812_1041832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1556 | Open in IMG/M |
3300017821|Ga0187812_1084732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1042 | Open in IMG/M |
3300017822|Ga0187802_10062922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1369 | Open in IMG/M |
3300017926|Ga0187807_1027868 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
3300017928|Ga0187806_1213002 | Not Available | 658 | Open in IMG/M |
3300017959|Ga0187779_10458920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 838 | Open in IMG/M |
3300017973|Ga0187780_10293390 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300017975|Ga0187782_10109198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2039 | Open in IMG/M |
3300018007|Ga0187805_10045778 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
3300018060|Ga0187765_10598743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
3300020140|Ga0179590_1021108 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
3300020579|Ga0210407_10098706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2217 | Open in IMG/M |
3300020580|Ga0210403_10802496 | Not Available | 748 | Open in IMG/M |
3300020581|Ga0210399_10343715 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300020581|Ga0210399_11340829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
3300020582|Ga0210395_10104587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2095 | Open in IMG/M |
3300020583|Ga0210401_10837859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
3300021171|Ga0210405_10396646 | Not Available | 1087 | Open in IMG/M |
3300021178|Ga0210408_10460886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
3300021362|Ga0213882_10086588 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300021374|Ga0213881_10000020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 170293 | Open in IMG/M |
3300021374|Ga0213881_10002253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 8551 | Open in IMG/M |
3300021374|Ga0213881_10025241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2476 | Open in IMG/M |
3300021374|Ga0213881_10377529 | Not Available | 637 | Open in IMG/M |
3300021377|Ga0213874_10032030 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
3300021403|Ga0210397_10059756 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
3300021403|Ga0210397_10440840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
3300021407|Ga0210383_10100147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus | 2438 | Open in IMG/M |
3300021407|Ga0210383_10487353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1064 | Open in IMG/M |
3300021559|Ga0210409_10051071 | All Organisms → cellular organisms → Bacteria | 3889 | Open in IMG/M |
3300021560|Ga0126371_10015872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6892 | Open in IMG/M |
3300021560|Ga0126371_10080118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3201 | Open in IMG/M |
3300021560|Ga0126371_10324335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1671 | Open in IMG/M |
3300022715|Ga0242678_1054125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300022726|Ga0242654_10025857 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300025464|Ga0208076_1004660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2209 | Open in IMG/M |
3300025900|Ga0207710_10399237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
3300025910|Ga0207684_10067739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3034 | Open in IMG/M |
3300025915|Ga0207693_11237779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
3300025922|Ga0207646_10507594 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300025922|Ga0207646_11579319 | Not Available | 566 | Open in IMG/M |
3300025928|Ga0207700_11021194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
3300026078|Ga0207702_11788233 | Not Available | 607 | Open in IMG/M |
3300026377|Ga0257171_1052448 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300026489|Ga0257160_1005851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1587 | Open in IMG/M |
3300027725|Ga0209178_1190337 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300027812|Ga0209656_10074056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1849 | Open in IMG/M |
3300027862|Ga0209701_10139767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1486 | Open in IMG/M |
3300027867|Ga0209167_10422927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
3300027874|Ga0209465_10637588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis rhizosphaerae | 526 | Open in IMG/M |
3300027879|Ga0209169_10551238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
3300027911|Ga0209698_10696067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
3300027964|Ga0256864_1001569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6371 | Open in IMG/M |
3300028536|Ga0137415_10950638 | Not Available | 670 | Open in IMG/M |
3300031231|Ga0170824_100741476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
3300031231|Ga0170824_110113616 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300031474|Ga0170818_106658200 | Not Available | 545 | Open in IMG/M |
3300031543|Ga0318516_10160539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
3300031543|Ga0318516_10264410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 994 | Open in IMG/M |
3300031544|Ga0318534_10032527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2855 | Open in IMG/M |
3300031544|Ga0318534_10104243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 1625 | Open in IMG/M |
3300031544|Ga0318534_10224103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1085 | Open in IMG/M |
3300031544|Ga0318534_10247327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1029 | Open in IMG/M |
3300031544|Ga0318534_10538904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
3300031549|Ga0318571_10236915 | Not Available | 666 | Open in IMG/M |
3300031572|Ga0318515_10027874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2732 | Open in IMG/M |
3300031572|Ga0318515_10552383 | Not Available | 613 | Open in IMG/M |
3300031572|Ga0318515_10624436 | Not Available | 572 | Open in IMG/M |
3300031681|Ga0318572_10283518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
3300031708|Ga0310686_107069747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3085 | Open in IMG/M |
3300031713|Ga0318496_10023190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3089 | Open in IMG/M |
3300031713|Ga0318496_10795270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
3300031718|Ga0307474_11187041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis anabasis | 604 | Open in IMG/M |
3300031723|Ga0318493_10165495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1152 | Open in IMG/M |
3300031723|Ga0318493_10371226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
3300031748|Ga0318492_10173320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
3300031748|Ga0318492_10441145 | Not Available | 687 | Open in IMG/M |
3300031751|Ga0318494_10523303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 692 | Open in IMG/M |
3300031754|Ga0307475_11062120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
3300031765|Ga0318554_10335326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
3300031771|Ga0318546_10695960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 715 | Open in IMG/M |
3300031771|Ga0318546_10975328 | Not Available | 596 | Open in IMG/M |
3300031777|Ga0318543_10425845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
3300031779|Ga0318566_10414921 | Not Available | 662 | Open in IMG/M |
3300031792|Ga0318529_10061930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1635 | Open in IMG/M |
3300031792|Ga0318529_10480014 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031793|Ga0318548_10262459 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300031794|Ga0318503_10283354 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300031798|Ga0318523_10454307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
3300031805|Ga0318497_10471437 | Not Available | 703 | Open in IMG/M |
3300031805|Ga0318497_10754001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
3300031819|Ga0318568_10407590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
3300031832|Ga0318499_10055336 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300031833|Ga0310917_10122347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1695 | Open in IMG/M |
3300031833|Ga0310917_10461721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 864 | Open in IMG/M |
3300031846|Ga0318512_10530877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 598 | Open in IMG/M |
3300031860|Ga0318495_10235955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
3300031942|Ga0310916_11430662 | Not Available | 565 | Open in IMG/M |
3300031954|Ga0306926_11749857 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300031959|Ga0318530_10254955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
3300032001|Ga0306922_10511728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1279 | Open in IMG/M |
3300032008|Ga0318562_10606781 | Not Available | 632 | Open in IMG/M |
3300032009|Ga0318563_10007953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4868 | Open in IMG/M |
3300032035|Ga0310911_10235255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1047 | Open in IMG/M |
3300032042|Ga0318545_10281653 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300032066|Ga0318514_10030809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella | 2511 | Open in IMG/M |
3300032090|Ga0318518_10383158 | Not Available | 722 | Open in IMG/M |
3300032205|Ga0307472_100430112 | Not Available | 1115 | Open in IMG/M |
3300032261|Ga0306920_102158835 | Not Available | 776 | Open in IMG/M |
3300032261|Ga0306920_104281746 | Not Available | 513 | Open in IMG/M |
3300032770|Ga0335085_10039256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6512 | Open in IMG/M |
3300032783|Ga0335079_10999505 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300032805|Ga0335078_10004771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 20077 | Open in IMG/M |
3300032828|Ga0335080_10300831 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
3300032828|Ga0335080_10587496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1173 | Open in IMG/M |
3300032892|Ga0335081_10086041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4736 | Open in IMG/M |
3300032892|Ga0335081_11140823 | Not Available | 894 | Open in IMG/M |
3300032896|Ga0335075_10037235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6934 | Open in IMG/M |
3300032896|Ga0335075_10188860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2487 | Open in IMG/M |
3300032954|Ga0335083_11532976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300033158|Ga0335077_11639946 | Not Available | 610 | Open in IMG/M |
3300033289|Ga0310914_11781260 | Not Available | 520 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.79% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.61% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.09% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 2.58% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.06% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.06% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.03% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.03% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.03% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.03% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.52% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.52% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.52% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_01135720 | 2170459010 | Grass Soil | MLSNWITYDAPFAVKLRMAASNTFIKLRKRQACCGNNGQ |
FG2_02983740 | 2189573004 | Grass Soil | LSNWIIYDAPFAAKLRMAASNTFIKLRKRQACCGNHGQPGC |
Ga0062386_1002234893 | 3300004152 | Bog Forest Soil | MFSNWTTYDAPFATKLRMAASNTFIKLRKRQGCCGNHGQPGC* |
Ga0066397_100130392 | 3300004281 | Tropical Forest Soil | VSNWTTYDAPFVAKLRMAASNTFIKLRKRQACCGNHGQPGC* |
Ga0066388_1029784483 | 3300005332 | Tropical Forest Soil | MLSNWTSYQAPLAAKVRMAVSNSLVKLRGRQGCCGNHGQPGC* |
Ga0066388_1087821221 | 3300005332 | Tropical Forest Soil | MLSNWASYDAPMAAKLRMAASNTFIKLRHRQACCGHPGQPGC* |
Ga0070709_114551351 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SNWTTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0070714_1018550561 | 3300005435 | Agricultural Soil | LSNWITYDAPFAVKLRMAASNTLIKLRKRQACCGNNGQPGC* |
Ga0070713_1010927501 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SPGASLSNWITYDAPFAVKLRMAASNTLIKLRKRQACCGNNGQPGC* |
Ga0070708_1000225438 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LFSNWVTYDASFADKVRMAAANTLIKLRNHQGCCGNHGQPGC* |
Ga0070708_1003403971 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AMFANWITYDASFAAKLRMAASNTLLKLRYHQACCGNHGQPGC* |
Ga0070708_1003780472 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFPNRAAALLSNWITCDAPFAAKLRMAASNTFIKLRKRQACCANNGQPGC* |
Ga0070762_110427441 | 3300005602 | Soil | AFFANWASCDASFAAKARMAATNTLIKLRRHQSCCGNHGQPGC* |
Ga0066903_1001170905 | 3300005764 | Tropical Forest Soil | MASNWASYDASFAAKMRMAASNTLIKLRKHQACCGNHGQPGC* |
Ga0066903_1002659613 | 3300005764 | Tropical Forest Soil | MFANWSSYDAPFATKLRMAVSNTFIKLRHGQACCGNHGQPGC* |
Ga0066903_1013461212 | 3300005764 | Tropical Forest Soil | LLSNWATCDASFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC* |
Ga0075017_1007501703 | 3300006059 | Watersheds | TYDAPFATKLKMVVSNNLIKLRTRQGCCGNHGQPGC* |
Ga0070716_1011240641 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | CDASFAAKVRMAASNTLIKLRRHQGCCGNHGQPGC* |
Ga0070765_1003146231 | 3300006176 | Soil | LSNWTTYDASFTAKLLMAASNTFIKLRKHQACCGNNGQPGC* |
Ga0070765_1022676282 | 3300006176 | Soil | MTYDAPFAVKLRMAASNTLIKLRKRQACCGNNGQPGC* |
Ga0075434_1018665851 | 3300006871 | Populus Rhizosphere | NWITYDASFAAKLRMAAANTLVKLRNHQGCCGNHGQPGC* |
Ga0074063_131387681 | 3300006953 | Soil | SYDAPLATKLRMAVSNTMVKLRNHQGCCGNHGQPGC* |
Ga0079219_109653301 | 3300006954 | Agricultural Soil | WITYDAPFAVKLRMAAYNTFIKLRKRQACCGNNGQPGC* |
Ga0099795_100637292 | 3300007788 | Vadose Zone Soil | LWSNWITYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0099830_100600453 | 3300009088 | Vadose Zone Soil | LSNWTTYDASFAAKLRMAASNTFIKLRRHQACCGNNGQPGC* |
Ga0099828_100811981 | 3300009089 | Vadose Zone Soil | LSNWTTYDASFAAKLRMAESSTFIKLRRHQACCGNNGQPGC* |
Ga0099792_104126431 | 3300009143 | Vadose Zone Soil | TYDAPFAVKLRMAASNTFIKLRKHQACCGHHGQPGC* |
Ga0116214_10004842 | 3300009520 | Peatlands Soil | LLSNWITYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0116214_12087971 | 3300009520 | Peatlands Soil | LLSNWITYDAPFAAKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0116224_102285772 | 3300009683 | Peatlands Soil | LLSNWITYDAPFAVKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0126380_104844852 | 3300010043 | Tropical Forest Soil | VSNWTTYDAPFVAKLRMAASNIFIKLRKRQACCGNHGQPGC* |
Ga0126380_116209702 | 3300010043 | Tropical Forest Soil | MLSNWTSYDAPFTEKLRMAASNTFIKLRRRQACCGNNGQPGC* |
Ga0126382_118338191 | 3300010047 | Tropical Forest Soil | MLSNWITYDAPLADKLRMAASNTLIKLRNHQGCCGHHGQPGC* |
Ga0126373_102611974 | 3300010048 | Tropical Forest Soil | LFSNWATCDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC* |
Ga0126373_103976081 | 3300010048 | Tropical Forest Soil | LLSNWITYDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC* |
Ga0126373_105924251 | 3300010048 | Tropical Forest Soil | MASNWASYDASFAAKLRMAASNTLIKLRKHQACCGNHGQPGC* |
Ga0126373_132173451 | 3300010048 | Tropical Forest Soil | MFSNWAACDASFAAKLRMAASNTLIKLRKHQGCCGNHGQPGC* |
Ga0074044_103541272 | 3300010343 | Bog Forest Soil | VAFLSNWTTYDAPFAAKLRMAASNTFIKLRNRQACCGNNGQPGC* |
Ga0126376_115694392 | 3300010359 | Tropical Forest Soil | MLSNWITYDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC* |
Ga0126372_113592862 | 3300010360 | Tropical Forest Soil | MFSNWASYDAPFAVKLRMAASNTLVKLRGRQACCGNPGQPGC* |
Ga0126378_117939191 | 3300010361 | Tropical Forest Soil | LSNWITHDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC* |
Ga0126377_134109182 | 3300010362 | Tropical Forest Soil | MLSNWTSYDAPFTEKLRMAASNTFIKFRRRQACCGNNGQPGC* |
Ga0126379_136348542 | 3300010366 | Tropical Forest Soil | MSAVIKLWAFFSNWATYDAPFAVKLRMAASNTLAKLRSGQACCGNPGQPGC* |
Ga0126381_1012715212 | 3300010376 | Tropical Forest Soil | LLSNWITHDAPFAAKLRMAASNTFIKLRRHQACCGNHGQ |
Ga0126381_1018791651 | 3300010376 | Tropical Forest Soil | MLSNWTSYDAPFDVKLREAASNTWLKLRNRQSCCGHHGHPGC* |
Ga0136449_1036563031 | 3300010379 | Peatlands Soil | LLSNWITYDAPLAAKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0134126_115387202 | 3300010396 | Terrestrial Soil | LLSNWVTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0126383_111954712 | 3300010398 | Tropical Forest Soil | MLSNWITYDAPLADKLRLAASNTLIKLRNHQGCCGHHGQPGC* |
Ga0126361_110775441 | 3300010876 | Boreal Forest Soil | MLSNWITYDAPFTVKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0137388_102190082 | 3300012189 | Vadose Zone Soil | LSSWTTYDASFAAKLRMAASNTFIKLRRHQACCGNNGQPGC* |
Ga0137388_104978021 | 3300012189 | Vadose Zone Soil | KSSPGAFFSNWTTYDASFAAKLRMAASNTLIKLRRHQACCGNHGQPGC* |
Ga0137383_100280214 | 3300012199 | Vadose Zone Soil | MVSNWMTYDAPFAVKVRMAASNTLIKLRKRQACCGNNGQPGC* |
Ga0137383_101999813 | 3300012199 | Vadose Zone Soil | MLSNWSSYDAAFAVKLRMAASNTLIKLRGRQGCCGNHGQPGC* |
Ga0137383_106349181 | 3300012199 | Vadose Zone Soil | SPGAFWSNWTSYDAPFAAKLRMAVSNTLVKLRNHQGCCGNHGQPGC* |
Ga0137380_103071512 | 3300012206 | Vadose Zone Soil | LSNWITYDAPFAIKLRMAASNTLIKLRKRQACCGNNGQPGC* |
Ga0137379_118264261 | 3300012209 | Vadose Zone Soil | VAFLSNWTTYDAPFATKLRMAASNTFIKLRNRQACCGNNGQPGC* |
Ga0137371_106042902 | 3300012356 | Vadose Zone Soil | MFSNWITYDAPFAAKLRMAASNTLLKLRSHRGCCGNHGQPGC* |
Ga0137390_117979462 | 3300012363 | Vadose Zone Soil | SNWTTYDASFAAKLRMAASNTFIKLRHHQACCGNHGQPGC* |
Ga0137397_111073411 | 3300012685 | Vadose Zone Soil | LSNWIIYDAPFAAKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0164303_102913312 | 3300012957 | Soil | LWSNWTTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC* |
Ga0126369_107735952 | 3300012971 | Tropical Forest Soil | LVSNWVTCDASFPAKLRMAAANTLIKLRNHQGCCGHHGQPGC* |
Ga0157374_113621732 | 3300013296 | Miscanthus Rhizosphere | FFSNWATCDASFAAKVRMAASNTLIKLRRHQSCCGNHGQPGC* |
Ga0157375_114890251 | 3300013308 | Miscanthus Rhizosphere | LWSNWTTYDAPFATKLRMAASKTLIKLRKRQACCGNNGQPGC* |
Ga0132258_105428243 | 3300015371 | Arabidopsis Rhizosphere | MFSNWASYDAPLTAKLRMAASNTFIKLRHHQACCGNNGQPGC* |
Ga0132257_1009749152 | 3300015373 | Arabidopsis Rhizosphere | MAVPDHPPRPSLRAAFSNWATYDAPFTTKLRMVATNNFIKLRKRQNCCGNH |
Ga0182036_102258642 | 3300016270 | Soil | MFSNWTTYDASFAVKLRMAVSNTLIKLRTRQACCGNHGQPGC |
Ga0182041_118793891 | 3300016294 | Soil | MAVFFSNWATYDASFAAKMRLAASNTLIKLRRHQSCCGNN |
Ga0182033_102821421 | 3300016319 | Soil | LLSNWAACDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC |
Ga0182033_103100611 | 3300016319 | Soil | TYDASFAVKLRMAVSNTFIKVRNRQACCGNHGQPGC |
Ga0182033_104962392 | 3300016319 | Soil | MFSNWTTYDAPFAVKLRMAVSNTLIKLRTGQACCGNHGQAGG |
Ga0182035_105481221 | 3300016341 | Soil | RPHPSRAAFFSNWATYDASFAAKMRMAASNTLIKLRRHQNCCGNNGQPGC |
Ga0182037_107358582 | 3300016404 | Soil | MFSNWTTYDASFAVKLRMAVSNTLIKLRTGQACCGNHGQPGC |
Ga0187812_10418322 | 3300017821 | Freshwater Sediment | LSNWITYNAPFAAKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0187812_10847322 | 3300017821 | Freshwater Sediment | LSNWVTYDAPFPAKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0187802_100629222 | 3300017822 | Freshwater Sediment | MFSNWSAYDAPFAVKLRMAISNTWIKLRHGQACCGNNGQPGC |
Ga0187807_10278682 | 3300017926 | Freshwater Sediment | LVANWTTYDAPFAVKLRMAVSNTFVKLRNRQACCGNNGQPGC |
Ga0187806_12130021 | 3300017928 | Freshwater Sediment | MVSNWAAYDAPFAVKLRMAVSNTVVKLRERPSCRGNHGWTGCGVS |
Ga0187779_104589202 | 3300017959 | Tropical Peatland | LSNWTTYDAPFAAKLRMAASNTLIKLRRHQACCGNNGQPGC |
Ga0187780_102933902 | 3300017973 | Tropical Peatland | LLSNWTTYDAPFAAKLRMAASNTLIKLRRHQACCGNNGQPGC |
Ga0187782_101091981 | 3300017975 | Tropical Peatland | SNWTTYDAPFAAKLRMATSNTFIKLRKRQGCCGNSGQPGC |
Ga0187805_100457781 | 3300018007 | Freshwater Sediment | LLSNWVTYDAPFPAKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0187765_105987432 | 3300018060 | Tropical Peatland | VAFLANWTTYDAPLATKLRMAASNTLIKLRRRQACCGNNGQPGC |
Ga0179590_10211082 | 3300020140 | Vadose Zone Soil | LWSNWITYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0210407_100987061 | 3300020579 | Soil | LLSDWITYDAPFTTKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0210403_108024961 | 3300020580 | Soil | LLSNWITYDAPFTTKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0210399_103437152 | 3300020581 | Soil | LLSNWITYDAPFTAKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0210399_113408291 | 3300020581 | Soil | LSNWVTCDASFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0210395_101045872 | 3300020582 | Soil | MFSNWATYDASFATKLRMAATNTFIKLRNHQGCCGNHGQPGC |
Ga0210401_108378591 | 3300020583 | Soil | MFSNWADHDAPFGVKLREAVSNTLIKLRNRQGCCGHHGHPGC |
Ga0210405_103966462 | 3300021171 | Soil | LSNWITYDAPFTTKLRMAASNTFIKLRKRQACCGNNGQP |
Ga0210408_104608861 | 3300021178 | Soil | LLSNWITYDAPFAVKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0213882_100865881 | 3300021362 | Exposed Rock | VTGQALGNFLSNWTTYNAPFAAKLRMAVSNTFIKVRHHHACCGNNGQPGC |
Ga0213881_100000201 | 3300021374 | Exposed Rock | LSNWTTYNAPFAAKLRMAVSNTFIKVRHHHACCGNNGQ |
Ga0213881_100022536 | 3300021374 | Exposed Rock | GTFLSNWTTYNAPFAAKLRMAVSNTFIKVRHHHACCGNNGQPGC |
Ga0213881_100252412 | 3300021374 | Exposed Rock | MFSNWTSYDADFASKLRMAASNTFIKLSRRQACCGNNGQPGC |
Ga0213881_103775291 | 3300021374 | Exposed Rock | WTGYDAPFATKLRMAASNTLIKLRRRQACCGNNGQPGC |
Ga0213874_100320302 | 3300021377 | Plant Roots | MFSNWITYRAPFAVKMRTAASNTFIKLSRGQACCGNNGQPGC |
Ga0210397_100597564 | 3300021403 | Soil | LSNWITYDAPFTVKLRMAASNTLIKLRKRQACCGNNGQPGC |
Ga0210397_104408402 | 3300021403 | Soil | MSNWASYDAPFAVKLRMAVSNTLIKLRKRQGCCGNHGQPGC |
Ga0210383_101001472 | 3300021407 | Soil | MFSNWATCDASFAAKLRMAASNTLIKLRNRQGCCGNHGQPGC |
Ga0210383_104873532 | 3300021407 | Soil | FANWASCDASFAAKARMAATNTLIKLRRHQSCCGNHGQPGC |
Ga0210409_100510712 | 3300021559 | Soil | LLSNWITYDAPFTTKLRMAASNSFIKLRKRQACCGNNGQPGC |
Ga0126371_1001587210 | 3300021560 | Tropical Forest Soil | MFSNWADYEAPFGVKLREAVSNTVIKLRGRQGCCGHHGHPGC |
Ga0126371_100801185 | 3300021560 | Tropical Forest Soil | LASNWASYDASFAAKLRMAASNTLIKLRKHQACCGNHGQPGC |
Ga0126371_103243352 | 3300021560 | Tropical Forest Soil | LVSNWVTCDASFPAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0242678_10541251 | 3300022715 | Soil | LSNWITYDAPFAVKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0242654_100258572 | 3300022726 | Soil | LLSNWITYDAPFAVKVRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0208076_10046601 | 3300025464 | Arctic Peat Soil | SPAAFLSNWATYDASFATKLRMATSNTFFKLRHRQACCGNNGQPGC |
Ga0207710_103992372 | 3300025900 | Switchgrass Rhizosphere | TCDASFAAKVRMAASNTLIKLRRHQGCCGNHGQPGC |
Ga0207684_100677391 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNWTTYDASFAAKLRMAVSNTFIKLRYHQACCGNHGQPGC |
Ga0207693_112377792 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AAFFSNWATCDASFAAKVRMAASNTLIKLRRHQSCCGNHGQPGC |
Ga0207646_105075941 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFPNRAAALLSNWITCDAPFAAKLRMAASNTFIKLRKRQACCANNGQPGC |
Ga0207646_115793191 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | WTTYDASFAAKLRMAVSNTFIKLRYHQACCGNHGQPGC |
Ga0207700_110211942 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TYDAPFAVKLRMAASNTLIKLRKRQACCGNNGQPGC |
Ga0207702_117882332 | 3300026078 | Corn Rhizosphere | LLSNWTTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0257171_10524481 | 3300026377 | Soil | IANWAVYDASFTAKLRMATANTWFKLRHGTACCGNHGQPGC |
Ga0257160_10058513 | 3300026489 | Soil | MLSNWMTYDAPFAVKLRMAASNTLIKLRKRQACCGNHGQPGC |
Ga0209178_11903372 | 3300027725 | Agricultural Soil | LLSNWVTYDAPFATKLRMAASNTLIKLRKRQACCGNNGQPGC |
Ga0209656_100740562 | 3300027812 | Bog Forest Soil | MFSNWTTYDAPFATKLRMAASNTFIKLRKRQGCCGNHGQPGC |
Ga0209701_101397672 | 3300027862 | Vadose Zone Soil | LSNWTTYDASFAAKLRMAASNTFIKLRRHQACCGNNGQPGC |
Ga0209167_104229271 | 3300027867 | Surface Soil | AFLSNWTTYDAPFAVKLRMALTNTLIKARKQQACCGNNGQPGC |
Ga0209465_106375881 | 3300027874 | Tropical Forest Soil | VVSNWVTCDASFPAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0209169_105512382 | 3300027879 | Soil | SNWSTYDAPFAVKLRMAVSNTLIKLRRRQACCINNGQPGC |
Ga0209698_106960673 | 3300027911 | Watersheds | STYDAPFATKLRMVVSNNLIKVRTRQDCCGNHGQPGC |
Ga0256864_10015696 | 3300027964 | Soil | MANVVRDFFDNWSTYEASTAKKLRLSLKNTGIKLRTGSACCGNHGEPGC |
Ga0137415_109506382 | 3300028536 | Vadose Zone Soil | GALWSNWITYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0170824_1007414761 | 3300031231 | Forest Soil | PGSGALFSNWATYDASFAAKLRMAASNTLVKLRKRQGCCGNHGQPGC |
Ga0170824_1101136162 | 3300031231 | Forest Soil | LLSNWITYDAPFTSKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0170818_1066582001 | 3300031474 | Forest Soil | YDAPFAEKLRMAASNTLIKLRGRQACCGNHGQPGC |
Ga0318516_101605392 | 3300031543 | Soil | LLSNWITYDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC |
Ga0318516_102644102 | 3300031543 | Soil | MFSNWTTYDAPFAVKLRMAVSNTLIKLRTGQACCGNHGQPGC |
Ga0318534_100325274 | 3300031544 | Soil | LLSNWVTCDASFTAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0318534_101042433 | 3300031544 | Soil | MFSNWTTYDASFAVKLRMAVSNTLIKLRNHQACCGNHGQPGC |
Ga0318534_102241032 | 3300031544 | Soil | KPNPGAFLSNWTTYDAPFATKVRLAASNTFLKLRKRQACCGNNGEPGC |
Ga0318534_102473271 | 3300031544 | Soil | LFSNWATCDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC |
Ga0318534_105389042 | 3300031544 | Soil | RAFFANWTTYDAPFATKVRLATSNTFRKLRKGQACCGNNGEPGC |
Ga0318571_102369151 | 3300031549 | Soil | GALVSNWVTCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0318515_100278741 | 3300031572 | Soil | SNWVTCDASFTAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0318515_105523832 | 3300031572 | Soil | NWTTYDAPFATKVRLATSNTFRKLRKRQACCGNNGEPGC |
Ga0318515_106244361 | 3300031572 | Soil | MFSNWTTYDASFAVKLRMAVSNTFIKLRNHQACCGNHGQPGC |
Ga0318572_102835183 | 3300031681 | Soil | NWTTYDAPFATKVRLAASNTFLKLRKRQACCGNNGEPGC |
Ga0310686_1070697474 | 3300031708 | Soil | LFSNWITYDAPFATKVRMAASNTFLKLRRRQACCGHHGQPGC |
Ga0318496_100231905 | 3300031713 | Soil | CDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0318496_107952702 | 3300031713 | Soil | MFSNWTTYDAPFAVKLRMAVSNTLIKLRTRQACCGNHGQPGC |
Ga0307474_111870411 | 3300031718 | Hardwood Forest Soil | MFSNWTTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC |
Ga0318493_101654952 | 3300031723 | Soil | TCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0318493_103712261 | 3300031723 | Soil | YDAPFATKVRLAASNTFLKLRKRQACCGNNGEPGC |
Ga0318492_101733202 | 3300031748 | Soil | LLSNWATCDASFAAKLRMAAFNTLIKLRNHQGCCGNHGQPGC |
Ga0318492_104411452 | 3300031748 | Soil | YDAPFATKVRLATSNTFRKLRKGQACCGNNGEPGC |
Ga0318494_105233033 | 3300031751 | Soil | FANWTTYDAPFATKVRLATSNTFRKLRKGQACCGNNGEPGC |
Ga0307475_110621202 | 3300031754 | Hardwood Forest Soil | SSPGAFFSNWATYDAPLAAKLRMAAANTVIKLRNHQGCCGNHGQPGC |
Ga0318554_103353262 | 3300031765 | Soil | VTCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0318546_106959602 | 3300031771 | Soil | MFSNWTTYDASFAVKLRMAVSNTFIKLRNHQACCGNHGQ |
Ga0318546_109753282 | 3300031771 | Soil | LANWTTYDAPFATKVRLATSNTFRKLRKRQACCGNNGEPGC |
Ga0318543_104258451 | 3300031777 | Soil | WTTYDAPFATKVRLAASNTFLKLRKRQACCGNNGEPGC |
Ga0318566_104149212 | 3300031779 | Soil | NWTSYDAPFADKLRMAVSNTFVKLRTRQACCGHPGQPGC |
Ga0318529_100619301 | 3300031792 | Soil | LVSNWVTCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0318529_104800141 | 3300031792 | Soil | SFISNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC |
Ga0318548_102624591 | 3300031793 | Soil | FISNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC |
Ga0318503_102833541 | 3300031794 | Soil | NWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC |
Ga0318523_104543072 | 3300031798 | Soil | TTYDAPFAAKLRMAASNTLLKLRRRQACCGNNGQPGC |
Ga0318497_104714371 | 3300031805 | Soil | MLSNWTSYDAPFADKLRMAVSNTFVKLRTRQACCGHPGQPGC |
Ga0318497_107540012 | 3300031805 | Soil | LLSNWTTYDAPFAAKLRMAASNTLLKLRRRQACCGNNGQPGC |
Ga0318568_104075901 | 3300031819 | Soil | LFSNWAACDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC |
Ga0318499_100553363 | 3300031832 | Soil | SLSAAFSNWSTYDAPFATKLRMVVSNNLSKLRNRSDCCGNHGQPGC |
Ga0310917_101223471 | 3300031833 | Soil | SPRAMFSNWTTYDAPFAVKLRMAVSNTLIKLRTGQACCGNHGQPGC |
Ga0310917_104617211 | 3300031833 | Soil | SPGALLSNWATCDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC |
Ga0318512_105308772 | 3300031846 | Soil | PRALLSNWTSYDAPFAAKLRMAVSNTYIKLRRRQACCGNNGQPGC |
Ga0318495_102359553 | 3300031860 | Soil | MAVFFSNWATYDASFAAKMRLAASNTLIKLRRHQSC |
Ga0310916_114306621 | 3300031942 | Soil | LSNWITYDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC |
Ga0306926_117498572 | 3300031954 | Soil | SPASFISNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC |
Ga0318530_102549551 | 3300031959 | Soil | LLSNWATCDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC |
Ga0306922_105117283 | 3300032001 | Soil | MLSNWTSYDAPFADKLRMAVSNTFVKLRTRQACCGNPGQPGC |
Ga0318562_106067811 | 3300032008 | Soil | YDAPFATKLRMVVSNNLSKLRNRSDCCGNHGQPGC |
Ga0318563_100079531 | 3300032009 | Soil | VSNWVTCDASFPAKLRMAAANTLIKLRNHQGCCGHHGQPGC |
Ga0310911_102352551 | 3300032035 | Soil | MFSNWTTYDAPFAVKLRMAVSNTFIKLRTGQACCGNHGQPGC |
Ga0318545_102816532 | 3300032042 | Soil | KPSPAAFISNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC |
Ga0318514_100308091 | 3300032066 | Soil | YDAPFAVKLRMAVSNTLIKLRTGQACCGNHGQPGC |
Ga0318518_103831581 | 3300032090 | Soil | SAAFSNWSTYDAPFATKLRMVVSNNLSKLRNRSDCCGNHGQPGC |
Ga0307472_1004301122 | 3300032205 | Hardwood Forest Soil | LVSNWTGYDAPFAVKLRMAASNTLIKLRKHQGCCGNHGRPGC |
Ga0306920_1021588351 | 3300032261 | Soil | AFSNWSTYDAPFATKLRMVVSNNLIKLRNRTDCCGNHGQPGC |
Ga0306920_1042817461 | 3300032261 | Soil | LLSNWTSYDAPFAAKLRMAVSNTYIKLRRRQACCGNNGQPGC |
Ga0335085_100392566 | 3300032770 | Soil | MVSNWASYDAPWPAKLRMAASNTFIKLRHRQACCGHHGQPGC |
Ga0335079_109995052 | 3300032783 | Soil | LLSNWITYDAPIAVKLRMAASNTFIKLRRHQACCGNNGQPGC |
Ga0335078_100047718 | 3300032805 | Soil | LSNWITYDAPIAVKLRMAASNTFIKLRRHQACCGNNGQPGC |
Ga0335080_103008312 | 3300032828 | Soil | LLSNWITYDAPFATKLQMAASNTLIKLRKRQACCGHPGQPGC |
Ga0335080_105874961 | 3300032828 | Soil | MFSNWSSYDAPFAVKLRMAVSNTLTKVRTGQACCGNHGQPGC |
Ga0335081_100860414 | 3300032892 | Soil | LLSNWTTYDAPLPVKLRMAASNTLLKLRKRQACCGNNGQPGC |
Ga0335081_111408231 | 3300032892 | Soil | LLSNWTTYDAPFTVKLRMAASNTFLKLRKRQACCGNNGQPGC |
Ga0335075_100372351 | 3300032896 | Soil | VSNWTSYDASFATKLRMAASNTLIKLRKRQACCGNNGQPGC |
Ga0335075_101888603 | 3300032896 | Soil | LVSNWTSYDAPFATKLRMAVSNTLIKLRRHQACCGNNGQPGC |
Ga0335083_115329762 | 3300032954 | Soil | DPRALLSNWITYDAPIAVKLRMAASNTFIKLRRHQACCGNNGQPGC |
Ga0335077_116399462 | 3300033158 | Soil | PRPDPRAFVSNWTTYDAPFAAKLRMAASNTLIKLRRHQACCGNNGQPGC |
Ga0310914_117812602 | 3300033289 | Soil | PRAFFANWTTYDAPFATKVRLATSNTFRKLRKGQACCGNNGEPGC |
⦗Top⦘ |