NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027606

Metagenome / Metatranscriptome Family F027606

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027606
Family Type Metagenome / Metatranscriptome
Number of Sequences 194
Average Sequence Length 42 residues
Representative Sequence LLSNWITYDAPFAAKLRMAASNTFIKLRKRQACCGNNGQPGC
Number of Associated Samples 148
Number of Associated Scaffolds 194

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 39.18 %
% of genes near scaffold ends (potentially truncated) 41.24 %
% of genes from short scaffolds (< 2000 bps) 82.99 %
Associated GOLD sequencing projects 141
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.773 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.474 % of family members)
Environment Ontology (ENVO) Unclassified
(29.381 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.753 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.86%    β-sheet: 0.00%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 194 Family Scaffolds
PF00296Bac_luciferase 3.61
PF02567PhzC-PhzF 2.58
PF13302Acetyltransf_3 2.58
PF00248Aldo_ket_red 2.58
PF08240ADH_N 2.58
PF08223PaaX_C 2.06
PF13434Lys_Orn_oxgnase 2.06
PF00196GerE 1.55
PF00583Acetyltransf_1 1.55
PF13649Methyltransf_25 1.55
PF00753Lactamase_B 1.55
PF08241Methyltransf_11 1.55
PF07690MFS_1 1.55
PF13462Thioredoxin_4 1.03
PF02423OCD_Mu_crystall 1.03
PF00571CBS 1.03
PF04075F420H2_quin_red 1.03
PF00440TetR_N 1.03
PF07992Pyr_redox_2 1.03
PF00005ABC_tran 1.03
PF01699Na_Ca_ex 1.03
PF12697Abhydrolase_6 1.03
PF00724Oxidored_FMN 1.03
PF00920ILVD_EDD 1.03
PF07366SnoaL 1.03
PF01022HTH_5 0.52
PF00082Peptidase_S8 0.52
PF12681Glyoxalase_2 0.52
PF01526DDE_Tnp_Tn3 0.52
PF11716MDMPI_N 0.52
PF02738MoCoBD_1 0.52
PF00291PALP 0.52
PF01988VIT1 0.52
PF13539Peptidase_M15_4 0.52
PF13669Glyoxalase_4 0.52
PF00689Cation_ATPase_C 0.52
PF13538UvrD_C_2 0.52
PF04185Phosphoesterase 0.52
PF10604Polyketide_cyc2 0.52
PF03466LysR_substrate 0.52
PF13419HAD_2 0.52
PF00350Dynamin_N 0.52
PF02585PIG-L 0.52
PF01790LGT 0.52
PF13191AAA_16 0.52
PF07452CHRD 0.52
PF13847Methyltransf_31 0.52
PF00149Metallophos 0.52
PF01979Amidohydro_1 0.52
PF12802MarR_2 0.52
PF13474SnoaL_3 0.52
PF13489Methyltransf_23 0.52
PF00491Arginase 0.52
PF02922CBM_48 0.52
PF13472Lipase_GDSL_2 0.52
PF12647RNHCP 0.52
PF01243Putative_PNPOx 0.52
PF14246TetR_C_7 0.52
PF135322OG-FeII_Oxy_2 0.52
PF13565HTH_32 0.52
PF04226Transgly_assoc 0.52
PF08669GCV_T_C 0.52
PF02954HTH_8 0.52
PF09983DUF2220 0.52
PF03992ABM 0.52
PF07969Amidohydro_3 0.52
PF05988DUF899 0.52
PF12900Pyridox_ox_2 0.52
PF07876Dabb 0.52
PF04672Methyltransf_19 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 194 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 3.61
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 2.58
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 2.06
COG3327DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation)Transcription [K] 2.06
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 1.03
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 1.03
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 1.03
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 1.03
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 1.03
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.52
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.52
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.52
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.52
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.52
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.52
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.52
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.52
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.52
COG4644Transposase and inactivated derivatives, TnpA familyMobilome: prophages, transposons [X] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.77 %
UnclassifiedrootN/A24.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY01B5OR4Not Available521Open in IMG/M
2189573004|GZGWRS401CRLPRNot Available523Open in IMG/M
3300004152|Ga0062386_100223489All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300004281|Ga0066397_10013039All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300005332|Ga0066388_102978448All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005332|Ga0066388_108782122Not Available502Open in IMG/M
3300005434|Ga0070709_11455135All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005435|Ga0070714_101855056All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005436|Ga0070713_101092750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300005445|Ga0070708_100022543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales5341Open in IMG/M
3300005445|Ga0070708_100340397All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300005445|Ga0070708_100378047All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300005602|Ga0070762_11042744All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005764|Ga0066903_100117090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3684Open in IMG/M
3300005764|Ga0066903_100265961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2668Open in IMG/M
3300005764|Ga0066903_101346121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1337Open in IMG/M
3300006059|Ga0075017_100750170All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006173|Ga0070716_101124064All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300006176|Ga0070765_100314623All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300006176|Ga0070765_102267628Not Available506Open in IMG/M
3300006871|Ga0075434_101866585All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300006953|Ga0074063_13138768All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006954|Ga0079219_10965330Not Available701Open in IMG/M
3300007788|Ga0099795_10063729Not Available1375Open in IMG/M
3300009088|Ga0099830_10060045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2718Open in IMG/M
3300009089|Ga0099828_10081198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2768Open in IMG/M
3300009143|Ga0099792_10412643All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300009520|Ga0116214_1000484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia16497Open in IMG/M
3300009520|Ga0116214_1208797Not Available736Open in IMG/M
3300009683|Ga0116224_10228577Not Available889Open in IMG/M
3300010043|Ga0126380_10484485Not Available945Open in IMG/M
3300010043|Ga0126380_11620970All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300010047|Ga0126382_11833819Not Available571Open in IMG/M
3300010048|Ga0126373_10261197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1709Open in IMG/M
3300010048|Ga0126373_10397608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1402Open in IMG/M
3300010048|Ga0126373_10592425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1160Open in IMG/M
3300010048|Ga0126373_13217345Not Available508Open in IMG/M
3300010343|Ga0074044_10354127Not Available963Open in IMG/M
3300010359|Ga0126376_11569439All Organisms → cellular organisms → Bacteria → Terrabacteria group689Open in IMG/M
3300010360|Ga0126372_11359286All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300010361|Ga0126378_11793919Not Available698Open in IMG/M
3300010362|Ga0126377_13410918Not Available514Open in IMG/M
3300010366|Ga0126379_13634854Not Available517Open in IMG/M
3300010376|Ga0126381_101271521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1063Open in IMG/M
3300010376|Ga0126381_101879165All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300010379|Ga0136449_103656303All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300010396|Ga0134126_11538720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300010398|Ga0126383_11195471Not Available850Open in IMG/M
3300010876|Ga0126361_11077544Not Available970Open in IMG/M
3300012189|Ga0137388_10219008Not Available1722Open in IMG/M
3300012189|Ga0137388_10497802All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300012199|Ga0137383_10028021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3943Open in IMG/M
3300012199|Ga0137383_10199981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1465Open in IMG/M
3300012199|Ga0137383_10634918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7781Open in IMG/M
3300012206|Ga0137380_10307151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1420Open in IMG/M
3300012209|Ga0137379_11826426Not Available502Open in IMG/M
3300012356|Ga0137371_10604290Not Available842Open in IMG/M
3300012363|Ga0137390_11797946Not Available544Open in IMG/M
3300012685|Ga0137397_11107341Not Available576Open in IMG/M
3300012957|Ga0164303_10291331All Organisms → cellular organisms → Bacteria → Terrabacteria group957Open in IMG/M
3300012971|Ga0126369_10773595All Organisms → cellular organisms → Bacteria → Terrabacteria group1041Open in IMG/M
3300013296|Ga0157374_11362173All Organisms → cellular organisms → Bacteria → Terrabacteria group732Open in IMG/M
3300013308|Ga0157375_11489025Not Available799Open in IMG/M
3300015371|Ga0132258_10542824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2913Open in IMG/M
3300015373|Ga0132257_100974915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1066Open in IMG/M
3300016270|Ga0182036_10225864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1388Open in IMG/M
3300016294|Ga0182041_11879389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300016319|Ga0182033_10282142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1363Open in IMG/M
3300016319|Ga0182033_10310061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1306Open in IMG/M
3300016319|Ga0182033_10496239All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300016341|Ga0182035_10548122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300016404|Ga0182037_10735858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii846Open in IMG/M
3300017821|Ga0187812_1041832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1556Open in IMG/M
3300017821|Ga0187812_1084732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1042Open in IMG/M
3300017822|Ga0187802_10062922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1369Open in IMG/M
3300017926|Ga0187807_1027868All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300017928|Ga0187806_1213002Not Available658Open in IMG/M
3300017959|Ga0187779_10458920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium838Open in IMG/M
3300017973|Ga0187780_10293390All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300017975|Ga0187782_10109198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2039Open in IMG/M
3300018007|Ga0187805_10045778All Organisms → cellular organisms → Bacteria1965Open in IMG/M
3300018060|Ga0187765_10598743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300020140|Ga0179590_1021108All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300020579|Ga0210407_10098706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2217Open in IMG/M
3300020580|Ga0210403_10802496Not Available748Open in IMG/M
3300020581|Ga0210399_10343715All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300020581|Ga0210399_11340829All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300020582|Ga0210395_10104587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2095Open in IMG/M
3300020583|Ga0210401_10837859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia779Open in IMG/M
3300021171|Ga0210405_10396646Not Available1087Open in IMG/M
3300021178|Ga0210408_10460886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300021362|Ga0213882_10086588All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300021374|Ga0213881_10000020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria170293Open in IMG/M
3300021374|Ga0213881_10002253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae8551Open in IMG/M
3300021374|Ga0213881_10025241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2476Open in IMG/M
3300021374|Ga0213881_10377529Not Available637Open in IMG/M
3300021377|Ga0213874_10032030All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300021403|Ga0210397_10059756All Organisms → cellular organisms → Bacteria2468Open in IMG/M
3300021403|Ga0210397_10440840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria979Open in IMG/M
3300021407|Ga0210383_10100147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus2438Open in IMG/M
3300021407|Ga0210383_10487353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1064Open in IMG/M
3300021559|Ga0210409_10051071All Organisms → cellular organisms → Bacteria3889Open in IMG/M
3300021560|Ga0126371_10015872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6892Open in IMG/M
3300021560|Ga0126371_10080118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3201Open in IMG/M
3300021560|Ga0126371_10324335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1671Open in IMG/M
3300022715|Ga0242678_1054125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300022726|Ga0242654_10025857All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300025464|Ga0208076_1004660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2209Open in IMG/M
3300025900|Ga0207710_10399237All Organisms → cellular organisms → Bacteria → Terrabacteria group705Open in IMG/M
3300025910|Ga0207684_10067739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3034Open in IMG/M
3300025915|Ga0207693_11237779All Organisms → cellular organisms → Bacteria → Terrabacteria group561Open in IMG/M
3300025922|Ga0207646_10507594All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300025922|Ga0207646_11579319Not Available566Open in IMG/M
3300025928|Ga0207700_11021194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300026078|Ga0207702_11788233Not Available607Open in IMG/M
3300026377|Ga0257171_1052448All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300026489|Ga0257160_1005851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1587Open in IMG/M
3300027725|Ga0209178_1190337All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300027812|Ga0209656_10074056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1849Open in IMG/M
3300027862|Ga0209701_10139767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1486Open in IMG/M
3300027867|Ga0209167_10422927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300027874|Ga0209465_10637588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis rhizosphaerae526Open in IMG/M
3300027879|Ga0209169_10551238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300027911|Ga0209698_10696067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300027964|Ga0256864_1001569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6371Open in IMG/M
3300028536|Ga0137415_10950638Not Available670Open in IMG/M
3300031231|Ga0170824_100741476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia769Open in IMG/M
3300031231|Ga0170824_110113616All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300031474|Ga0170818_106658200Not Available545Open in IMG/M
3300031543|Ga0318516_10160539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1292Open in IMG/M
3300031543|Ga0318516_10264410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides994Open in IMG/M
3300031544|Ga0318534_10032527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2855Open in IMG/M
3300031544|Ga0318534_10104243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM902241625Open in IMG/M
3300031544|Ga0318534_10224103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1085Open in IMG/M
3300031544|Ga0318534_10247327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1029Open in IMG/M
3300031544|Ga0318534_10538904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia665Open in IMG/M
3300031549|Ga0318571_10236915Not Available666Open in IMG/M
3300031572|Ga0318515_10027874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2732Open in IMG/M
3300031572|Ga0318515_10552383Not Available613Open in IMG/M
3300031572|Ga0318515_10624436Not Available572Open in IMG/M
3300031681|Ga0318572_10283518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria977Open in IMG/M
3300031708|Ga0310686_107069747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3085Open in IMG/M
3300031713|Ga0318496_10023190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3089Open in IMG/M
3300031713|Ga0318496_10795270All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300031718|Ga0307474_11187041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis anabasis604Open in IMG/M
3300031723|Ga0318493_10165495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1152Open in IMG/M
3300031723|Ga0318493_10371226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300031748|Ga0318492_10173320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1095Open in IMG/M
3300031748|Ga0318492_10441145Not Available687Open in IMG/M
3300031751|Ga0318494_10523303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae692Open in IMG/M
3300031754|Ga0307475_11062120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300031765|Ga0318554_10335326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia860Open in IMG/M
3300031771|Ga0318546_10695960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii715Open in IMG/M
3300031771|Ga0318546_10975328Not Available596Open in IMG/M
3300031777|Ga0318543_10425845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300031779|Ga0318566_10414921Not Available662Open in IMG/M
3300031792|Ga0318529_10061930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1635Open in IMG/M
3300031792|Ga0318529_10480014All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300031793|Ga0318548_10262459All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300031794|Ga0318503_10283354All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300031798|Ga0318523_10454307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300031805|Ga0318497_10471437Not Available703Open in IMG/M
3300031805|Ga0318497_10754001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300031819|Ga0318568_10407590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium847Open in IMG/M
3300031832|Ga0318499_10055336All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300031833|Ga0310917_10122347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1695Open in IMG/M
3300031833|Ga0310917_10461721All Organisms → cellular organisms → Bacteria → Terrabacteria group864Open in IMG/M
3300031846|Ga0318512_10530877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK598Open in IMG/M
3300031860|Ga0318495_10235955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300031942|Ga0310916_11430662Not Available565Open in IMG/M
3300031954|Ga0306926_11749857All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300031959|Ga0318530_10254955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia723Open in IMG/M
3300032001|Ga0306922_10511728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1279Open in IMG/M
3300032008|Ga0318562_10606781Not Available632Open in IMG/M
3300032009|Ga0318563_10007953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4868Open in IMG/M
3300032035|Ga0310911_10235255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1047Open in IMG/M
3300032042|Ga0318545_10281653All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300032066|Ga0318514_10030809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella2511Open in IMG/M
3300032090|Ga0318518_10383158Not Available722Open in IMG/M
3300032205|Ga0307472_100430112Not Available1115Open in IMG/M
3300032261|Ga0306920_102158835Not Available776Open in IMG/M
3300032261|Ga0306920_104281746Not Available513Open in IMG/M
3300032770|Ga0335085_10039256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6512Open in IMG/M
3300032783|Ga0335079_10999505All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300032805|Ga0335078_10004771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia20077Open in IMG/M
3300032828|Ga0335080_10300831All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300032828|Ga0335080_10587496All Organisms → cellular organisms → Bacteria → Terrabacteria group1173Open in IMG/M
3300032892|Ga0335081_10086041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4736Open in IMG/M
3300032892|Ga0335081_11140823Not Available894Open in IMG/M
3300032896|Ga0335075_10037235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6934Open in IMG/M
3300032896|Ga0335075_10188860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2487Open in IMG/M
3300032954|Ga0335083_11532976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300033158|Ga0335077_11639946Not Available610Open in IMG/M
3300033289|Ga0310914_11781260Not Available520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.09%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock2.58%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.06%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.06%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.55%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.03%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.03%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.03%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.52%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.52%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.52%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.52%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.52%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.52%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.52%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025464Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027964Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeqEnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_011357202170459010Grass SoilMLSNWITYDAPFAVKLRMAASNTFIKLRKRQACCGNNGQ
FG2_029837402189573004Grass SoilLSNWIIYDAPFAAKLRMAASNTFIKLRKRQACCGNHGQPGC
Ga0062386_10022348933300004152Bog Forest SoilMFSNWTTYDAPFATKLRMAASNTFIKLRKRQGCCGNHGQPGC*
Ga0066397_1001303923300004281Tropical Forest SoilVSNWTTYDAPFVAKLRMAASNTFIKLRKRQACCGNHGQPGC*
Ga0066388_10297844833300005332Tropical Forest SoilMLSNWTSYQAPLAAKVRMAVSNSLVKLRGRQGCCGNHGQPGC*
Ga0066388_10878212213300005332Tropical Forest SoilMLSNWASYDAPMAAKLRMAASNTFIKLRHRQACCGHPGQPGC*
Ga0070709_1145513513300005434Corn, Switchgrass And Miscanthus RhizosphereSNWTTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0070714_10185505613300005435Agricultural SoilLSNWITYDAPFAVKLRMAASNTLIKLRKRQACCGNNGQPGC*
Ga0070713_10109275013300005436Corn, Switchgrass And Miscanthus RhizosphereSPGASLSNWITYDAPFAVKLRMAASNTLIKLRKRQACCGNNGQPGC*
Ga0070708_10002254383300005445Corn, Switchgrass And Miscanthus RhizosphereLFSNWVTYDASFADKVRMAAANTLIKLRNHQGCCGNHGQPGC*
Ga0070708_10034039713300005445Corn, Switchgrass And Miscanthus RhizosphereAMFANWITYDASFAAKLRMAASNTLLKLRYHQACCGNHGQPGC*
Ga0070708_10037804723300005445Corn, Switchgrass And Miscanthus RhizosphereMPFPNRAAALLSNWITCDAPFAAKLRMAASNTFIKLRKRQACCANNGQPGC*
Ga0070762_1104274413300005602SoilAFFANWASCDASFAAKARMAATNTLIKLRRHQSCCGNHGQPGC*
Ga0066903_10011709053300005764Tropical Forest SoilMASNWASYDASFAAKMRMAASNTLIKLRKHQACCGNHGQPGC*
Ga0066903_10026596133300005764Tropical Forest SoilMFANWSSYDAPFATKLRMAVSNTFIKLRHGQACCGNHGQPGC*
Ga0066903_10134612123300005764Tropical Forest SoilLLSNWATCDASFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC*
Ga0075017_10075017033300006059WatershedsTYDAPFATKLKMVVSNNLIKLRTRQGCCGNHGQPGC*
Ga0070716_10112406413300006173Corn, Switchgrass And Miscanthus RhizosphereCDASFAAKVRMAASNTLIKLRRHQGCCGNHGQPGC*
Ga0070765_10031462313300006176SoilLSNWTTYDASFTAKLLMAASNTFIKLRKHQACCGNNGQPGC*
Ga0070765_10226762823300006176SoilMTYDAPFAVKLRMAASNTLIKLRKRQACCGNNGQPGC*
Ga0075434_10186658513300006871Populus RhizosphereNWITYDASFAAKLRMAAANTLVKLRNHQGCCGNHGQPGC*
Ga0074063_1313876813300006953SoilSYDAPLATKLRMAVSNTMVKLRNHQGCCGNHGQPGC*
Ga0079219_1096533013300006954Agricultural SoilWITYDAPFAVKLRMAAYNTFIKLRKRQACCGNNGQPGC*
Ga0099795_1006372923300007788Vadose Zone SoilLWSNWITYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0099830_1006004533300009088Vadose Zone SoilLSNWTTYDASFAAKLRMAASNTFIKLRRHQACCGNNGQPGC*
Ga0099828_1008119813300009089Vadose Zone SoilLSNWTTYDASFAAKLRMAESSTFIKLRRHQACCGNNGQPGC*
Ga0099792_1041264313300009143Vadose Zone SoilTYDAPFAVKLRMAASNTFIKLRKHQACCGHHGQPGC*
Ga0116214_100048423300009520Peatlands SoilLLSNWITYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0116214_120879713300009520Peatlands SoilLLSNWITYDAPFAAKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0116224_1022857723300009683Peatlands SoilLLSNWITYDAPFAVKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0126380_1048448523300010043Tropical Forest SoilVSNWTTYDAPFVAKLRMAASNIFIKLRKRQACCGNHGQPGC*
Ga0126380_1162097023300010043Tropical Forest SoilMLSNWTSYDAPFTEKLRMAASNTFIKLRRRQACCGNNGQPGC*
Ga0126382_1183381913300010047Tropical Forest SoilMLSNWITYDAPLADKLRMAASNTLIKLRNHQGCCGHHGQPGC*
Ga0126373_1026119743300010048Tropical Forest SoilLFSNWATCDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC*
Ga0126373_1039760813300010048Tropical Forest SoilLLSNWITYDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC*
Ga0126373_1059242513300010048Tropical Forest SoilMASNWASYDASFAAKLRMAASNTLIKLRKHQACCGNHGQPGC*
Ga0126373_1321734513300010048Tropical Forest SoilMFSNWAACDASFAAKLRMAASNTLIKLRKHQGCCGNHGQPGC*
Ga0074044_1035412723300010343Bog Forest SoilVAFLSNWTTYDAPFAAKLRMAASNTFIKLRNRQACCGNNGQPGC*
Ga0126376_1156943923300010359Tropical Forest SoilMLSNWITYDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC*
Ga0126372_1135928623300010360Tropical Forest SoilMFSNWASYDAPFAVKLRMAASNTLVKLRGRQACCGNPGQPGC*
Ga0126378_1179391913300010361Tropical Forest SoilLSNWITHDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC*
Ga0126377_1341091823300010362Tropical Forest SoilMLSNWTSYDAPFTEKLRMAASNTFIKFRRRQACCGNNGQPGC*
Ga0126379_1363485423300010366Tropical Forest SoilMSAVIKLWAFFSNWATYDAPFAVKLRMAASNTLAKLRSGQACCGNPGQPGC*
Ga0126381_10127152123300010376Tropical Forest SoilLLSNWITHDAPFAAKLRMAASNTFIKLRRHQACCGNHGQ
Ga0126381_10187916513300010376Tropical Forest SoilMLSNWTSYDAPFDVKLREAASNTWLKLRNRQSCCGHHGHPGC*
Ga0136449_10365630313300010379Peatlands SoilLLSNWITYDAPLAAKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0134126_1153872023300010396Terrestrial SoilLLSNWVTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0126383_1119547123300010398Tropical Forest SoilMLSNWITYDAPLADKLRLAASNTLIKLRNHQGCCGHHGQPGC*
Ga0126361_1107754413300010876Boreal Forest SoilMLSNWITYDAPFTVKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0137388_1021900823300012189Vadose Zone SoilLSSWTTYDASFAAKLRMAASNTFIKLRRHQACCGNNGQPGC*
Ga0137388_1049780213300012189Vadose Zone SoilKSSPGAFFSNWTTYDASFAAKLRMAASNTLIKLRRHQACCGNHGQPGC*
Ga0137383_1002802143300012199Vadose Zone SoilMVSNWMTYDAPFAVKVRMAASNTLIKLRKRQACCGNNGQPGC*
Ga0137383_1019998133300012199Vadose Zone SoilMLSNWSSYDAAFAVKLRMAASNTLIKLRGRQGCCGNHGQPGC*
Ga0137383_1063491813300012199Vadose Zone SoilSPGAFWSNWTSYDAPFAAKLRMAVSNTLVKLRNHQGCCGNHGQPGC*
Ga0137380_1030715123300012206Vadose Zone SoilLSNWITYDAPFAIKLRMAASNTLIKLRKRQACCGNNGQPGC*
Ga0137379_1182642613300012209Vadose Zone SoilVAFLSNWTTYDAPFATKLRMAASNTFIKLRNRQACCGNNGQPGC*
Ga0137371_1060429023300012356Vadose Zone SoilMFSNWITYDAPFAAKLRMAASNTLLKLRSHRGCCGNHGQPGC*
Ga0137390_1179794623300012363Vadose Zone SoilSNWTTYDASFAAKLRMAASNTFIKLRHHQACCGNHGQPGC*
Ga0137397_1110734113300012685Vadose Zone SoilLSNWIIYDAPFAAKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0164303_1029133123300012957SoilLWSNWTTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC*
Ga0126369_1077359523300012971Tropical Forest SoilLVSNWVTCDASFPAKLRMAAANTLIKLRNHQGCCGHHGQPGC*
Ga0157374_1136217323300013296Miscanthus RhizosphereFFSNWATCDASFAAKVRMAASNTLIKLRRHQSCCGNHGQPGC*
Ga0157375_1148902513300013308Miscanthus RhizosphereLWSNWTTYDAPFATKLRMAASKTLIKLRKRQACCGNNGQPGC*
Ga0132258_1054282433300015371Arabidopsis RhizosphereMFSNWASYDAPLTAKLRMAASNTFIKLRHHQACCGNNGQPGC*
Ga0132257_10097491523300015373Arabidopsis RhizosphereMAVPDHPPRPSLRAAFSNWATYDAPFTTKLRMVATNNFIKLRKRQNCCGNH
Ga0182036_1022586423300016270SoilMFSNWTTYDASFAVKLRMAVSNTLIKLRTRQACCGNHGQPGC
Ga0182041_1187938913300016294SoilMAVFFSNWATYDASFAAKMRLAASNTLIKLRRHQSCCGNN
Ga0182033_1028214213300016319SoilLLSNWAACDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC
Ga0182033_1031006113300016319SoilTYDASFAVKLRMAVSNTFIKVRNRQACCGNHGQPGC
Ga0182033_1049623923300016319SoilMFSNWTTYDAPFAVKLRMAVSNTLIKLRTGQACCGNHGQAGG
Ga0182035_1054812213300016341SoilRPHPSRAAFFSNWATYDASFAAKMRMAASNTLIKLRRHQNCCGNNGQPGC
Ga0182037_1073585823300016404SoilMFSNWTTYDASFAVKLRMAVSNTLIKLRTGQACCGNHGQPGC
Ga0187812_104183223300017821Freshwater SedimentLSNWITYNAPFAAKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0187812_108473223300017821Freshwater SedimentLSNWVTYDAPFPAKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0187802_1006292223300017822Freshwater SedimentMFSNWSAYDAPFAVKLRMAISNTWIKLRHGQACCGNNGQPGC
Ga0187807_102786823300017926Freshwater SedimentLVANWTTYDAPFAVKLRMAVSNTFVKLRNRQACCGNNGQPGC
Ga0187806_121300213300017928Freshwater SedimentMVSNWAAYDAPFAVKLRMAVSNTVVKLRERPSCRGNHGWTGCGVS
Ga0187779_1045892023300017959Tropical PeatlandLSNWTTYDAPFAAKLRMAASNTLIKLRRHQACCGNNGQPGC
Ga0187780_1029339023300017973Tropical PeatlandLLSNWTTYDAPFAAKLRMAASNTLIKLRRHQACCGNNGQPGC
Ga0187782_1010919813300017975Tropical PeatlandSNWTTYDAPFAAKLRMATSNTFIKLRKRQGCCGNSGQPGC
Ga0187805_1004577813300018007Freshwater SedimentLLSNWVTYDAPFPAKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0187765_1059874323300018060Tropical PeatlandVAFLANWTTYDAPLATKLRMAASNTLIKLRRRQACCGNNGQPGC
Ga0179590_102110823300020140Vadose Zone SoilLWSNWITYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0210407_1009870613300020579SoilLLSDWITYDAPFTTKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0210403_1080249613300020580SoilLLSNWITYDAPFTTKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0210399_1034371523300020581SoilLLSNWITYDAPFTAKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0210399_1134082913300020581SoilLSNWVTCDASFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0210395_1010458723300020582SoilMFSNWATYDASFATKLRMAATNTFIKLRNHQGCCGNHGQPGC
Ga0210401_1083785913300020583SoilMFSNWADHDAPFGVKLREAVSNTLIKLRNRQGCCGHHGHPGC
Ga0210405_1039664623300021171SoilLSNWITYDAPFTTKLRMAASNTFIKLRKRQACCGNNGQP
Ga0210408_1046088613300021178SoilLLSNWITYDAPFAVKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0213882_1008658813300021362Exposed RockVTGQALGNFLSNWTTYNAPFAAKLRMAVSNTFIKVRHHHACCGNNGQPGC
Ga0213881_1000002013300021374Exposed RockLSNWTTYNAPFAAKLRMAVSNTFIKVRHHHACCGNNGQ
Ga0213881_1000225363300021374Exposed RockGTFLSNWTTYNAPFAAKLRMAVSNTFIKVRHHHACCGNNGQPGC
Ga0213881_1002524123300021374Exposed RockMFSNWTSYDADFASKLRMAASNTFIKLSRRQACCGNNGQPGC
Ga0213881_1037752913300021374Exposed RockWTGYDAPFATKLRMAASNTLIKLRRRQACCGNNGQPGC
Ga0213874_1003203023300021377Plant RootsMFSNWITYRAPFAVKMRTAASNTFIKLSRGQACCGNNGQPGC
Ga0210397_1005975643300021403SoilLSNWITYDAPFTVKLRMAASNTLIKLRKRQACCGNNGQPGC
Ga0210397_1044084023300021403SoilMSNWASYDAPFAVKLRMAVSNTLIKLRKRQGCCGNHGQPGC
Ga0210383_1010014723300021407SoilMFSNWATCDASFAAKLRMAASNTLIKLRNRQGCCGNHGQPGC
Ga0210383_1048735323300021407SoilFANWASCDASFAAKARMAATNTLIKLRRHQSCCGNHGQPGC
Ga0210409_1005107123300021559SoilLLSNWITYDAPFTTKLRMAASNSFIKLRKRQACCGNNGQPGC
Ga0126371_10015872103300021560Tropical Forest SoilMFSNWADYEAPFGVKLREAVSNTVIKLRGRQGCCGHHGHPGC
Ga0126371_1008011853300021560Tropical Forest SoilLASNWASYDASFAAKLRMAASNTLIKLRKHQACCGNHGQPGC
Ga0126371_1032433523300021560Tropical Forest SoilLVSNWVTCDASFPAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0242678_105412513300022715SoilLSNWITYDAPFAVKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0242654_1002585723300022726SoilLLSNWITYDAPFAVKVRMAASNTFIKLRKRQACCGNNGQPGC
Ga0208076_100466013300025464Arctic Peat SoilSPAAFLSNWATYDASFATKLRMATSNTFFKLRHRQACCGNNGQPGC
Ga0207710_1039923723300025900Switchgrass RhizosphereTCDASFAAKVRMAASNTLIKLRRHQGCCGNHGQPGC
Ga0207684_1006773913300025910Corn, Switchgrass And Miscanthus RhizosphereMSNWTTYDASFAAKLRMAVSNTFIKLRYHQACCGNHGQPGC
Ga0207693_1123777923300025915Corn, Switchgrass And Miscanthus RhizosphereAAFFSNWATCDASFAAKVRMAASNTLIKLRRHQSCCGNHGQPGC
Ga0207646_1050759413300025922Corn, Switchgrass And Miscanthus RhizosphereMPFPNRAAALLSNWITCDAPFAAKLRMAASNTFIKLRKRQACCANNGQPGC
Ga0207646_1157931913300025922Corn, Switchgrass And Miscanthus RhizosphereWTTYDASFAAKLRMAVSNTFIKLRYHQACCGNHGQPGC
Ga0207700_1102119423300025928Corn, Switchgrass And Miscanthus RhizosphereTYDAPFAVKLRMAASNTLIKLRKRQACCGNNGQPGC
Ga0207702_1178823323300026078Corn RhizosphereLLSNWTTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0257171_105244813300026377SoilIANWAVYDASFTAKLRMATANTWFKLRHGTACCGNHGQPGC
Ga0257160_100585133300026489SoilMLSNWMTYDAPFAVKLRMAASNTLIKLRKRQACCGNHGQPGC
Ga0209178_119033723300027725Agricultural SoilLLSNWVTYDAPFATKLRMAASNTLIKLRKRQACCGNNGQPGC
Ga0209656_1007405623300027812Bog Forest SoilMFSNWTTYDAPFATKLRMAASNTFIKLRKRQGCCGNHGQPGC
Ga0209701_1013976723300027862Vadose Zone SoilLSNWTTYDASFAAKLRMAASNTFIKLRRHQACCGNNGQPGC
Ga0209167_1042292713300027867Surface SoilAFLSNWTTYDAPFAVKLRMALTNTLIKARKQQACCGNNGQPGC
Ga0209465_1063758813300027874Tropical Forest SoilVVSNWVTCDASFPAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0209169_1055123823300027879SoilSNWSTYDAPFAVKLRMAVSNTLIKLRRRQACCINNGQPGC
Ga0209698_1069606733300027911WatershedsSTYDAPFATKLRMVVSNNLIKVRTRQDCCGNHGQPGC
Ga0256864_100156963300027964SoilMANVVRDFFDNWSTYEASTAKKLRLSLKNTGIKLRTGSACCGNHGEPGC
Ga0137415_1095063823300028536Vadose Zone SoilGALWSNWITYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0170824_10074147613300031231Forest SoilPGSGALFSNWATYDASFAAKLRMAASNTLVKLRKRQGCCGNHGQPGC
Ga0170824_11011361623300031231Forest SoilLLSNWITYDAPFTSKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0170818_10665820013300031474Forest SoilYDAPFAEKLRMAASNTLIKLRGRQACCGNHGQPGC
Ga0318516_1016053923300031543SoilLLSNWITYDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC
Ga0318516_1026441023300031543SoilMFSNWTTYDAPFAVKLRMAVSNTLIKLRTGQACCGNHGQPGC
Ga0318534_1003252743300031544SoilLLSNWVTCDASFTAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0318534_1010424333300031544SoilMFSNWTTYDASFAVKLRMAVSNTLIKLRNHQACCGNHGQPGC
Ga0318534_1022410323300031544SoilKPNPGAFLSNWTTYDAPFATKVRLAASNTFLKLRKRQACCGNNGEPGC
Ga0318534_1024732713300031544SoilLFSNWATCDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC
Ga0318534_1053890423300031544SoilRAFFANWTTYDAPFATKVRLATSNTFRKLRKGQACCGNNGEPGC
Ga0318571_1023691513300031549SoilGALVSNWVTCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0318515_1002787413300031572SoilSNWVTCDASFTAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0318515_1055238323300031572SoilNWTTYDAPFATKVRLATSNTFRKLRKRQACCGNNGEPGC
Ga0318515_1062443613300031572SoilMFSNWTTYDASFAVKLRMAVSNTFIKLRNHQACCGNHGQPGC
Ga0318572_1028351833300031681SoilNWTTYDAPFATKVRLAASNTFLKLRKRQACCGNNGEPGC
Ga0310686_10706974743300031708SoilLFSNWITYDAPFATKVRMAASNTFLKLRRRQACCGHHGQPGC
Ga0318496_1002319053300031713SoilCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0318496_1079527023300031713SoilMFSNWTTYDAPFAVKLRMAVSNTLIKLRTRQACCGNHGQPGC
Ga0307474_1118704113300031718Hardwood Forest SoilMFSNWTTYDAPFATKLRMAASNTFIKLRKRQACCGNNGQPGC
Ga0318493_1016549523300031723SoilTCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0318493_1037122613300031723SoilYDAPFATKVRLAASNTFLKLRKRQACCGNNGEPGC
Ga0318492_1017332023300031748SoilLLSNWATCDASFAAKLRMAAFNTLIKLRNHQGCCGNHGQPGC
Ga0318492_1044114523300031748SoilYDAPFATKVRLATSNTFRKLRKGQACCGNNGEPGC
Ga0318494_1052330333300031751SoilFANWTTYDAPFATKVRLATSNTFRKLRKGQACCGNNGEPGC
Ga0307475_1106212023300031754Hardwood Forest SoilSSPGAFFSNWATYDAPLAAKLRMAAANTVIKLRNHQGCCGNHGQPGC
Ga0318554_1033532623300031765SoilVTCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0318546_1069596023300031771SoilMFSNWTTYDASFAVKLRMAVSNTFIKLRNHQACCGNHGQ
Ga0318546_1097532823300031771SoilLANWTTYDAPFATKVRLATSNTFRKLRKRQACCGNNGEPGC
Ga0318543_1042584513300031777SoilWTTYDAPFATKVRLAASNTFLKLRKRQACCGNNGEPGC
Ga0318566_1041492123300031779SoilNWTSYDAPFADKLRMAVSNTFVKLRTRQACCGHPGQPGC
Ga0318529_1006193013300031792SoilLVSNWVTCDAPFAAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0318529_1048001413300031792SoilSFISNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC
Ga0318548_1026245913300031793SoilFISNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC
Ga0318503_1028335413300031794SoilNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC
Ga0318523_1045430723300031798SoilTTYDAPFAAKLRMAASNTLLKLRRRQACCGNNGQPGC
Ga0318497_1047143713300031805SoilMLSNWTSYDAPFADKLRMAVSNTFVKLRTRQACCGHPGQPGC
Ga0318497_1075400123300031805SoilLLSNWTTYDAPFAAKLRMAASNTLLKLRRRQACCGNNGQPGC
Ga0318568_1040759013300031819SoilLFSNWAACDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC
Ga0318499_1005533633300031832SoilSLSAAFSNWSTYDAPFATKLRMVVSNNLSKLRNRSDCCGNHGQPGC
Ga0310917_1012234713300031833SoilSPRAMFSNWTTYDAPFAVKLRMAVSNTLIKLRTGQACCGNHGQPGC
Ga0310917_1046172113300031833SoilSPGALLSNWATCDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC
Ga0318512_1053087723300031846SoilPRALLSNWTSYDAPFAAKLRMAVSNTYIKLRRRQACCGNNGQPGC
Ga0318495_1023595533300031860SoilMAVFFSNWATYDASFAAKMRLAASNTLIKLRRHQSC
Ga0310916_1143066213300031942SoilLSNWITYDAPFAAKLRMAASNTFIKLRRHQACCGNHGQPGC
Ga0306926_1174985723300031954SoilSPASFISNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC
Ga0318530_1025495513300031959SoilLLSNWATCDASFAAKLRMAASNTLIKLRNHQGCCGNHGQPGC
Ga0306922_1051172833300032001SoilMLSNWTSYDAPFADKLRMAVSNTFVKLRTRQACCGNPGQPGC
Ga0318562_1060678113300032008SoilYDAPFATKLRMVVSNNLSKLRNRSDCCGNHGQPGC
Ga0318563_1000795313300032009SoilVSNWVTCDASFPAKLRMAAANTLIKLRNHQGCCGHHGQPGC
Ga0310911_1023525513300032035SoilMFSNWTTYDAPFAVKLRMAVSNTFIKLRTGQACCGNHGQPGC
Ga0318545_1028165323300032042SoilKPSPAAFISNWTTYDAPFVTKLRMAASNTFIKLRKQQACCGHHGQPGC
Ga0318514_1003080913300032066SoilYDAPFAVKLRMAVSNTLIKLRTGQACCGNHGQPGC
Ga0318518_1038315813300032090SoilSAAFSNWSTYDAPFATKLRMVVSNNLSKLRNRSDCCGNHGQPGC
Ga0307472_10043011223300032205Hardwood Forest SoilLVSNWTGYDAPFAVKLRMAASNTLIKLRKHQGCCGNHGRPGC
Ga0306920_10215883513300032261SoilAFSNWSTYDAPFATKLRMVVSNNLIKLRNRTDCCGNHGQPGC
Ga0306920_10428174613300032261SoilLLSNWTSYDAPFAAKLRMAVSNTYIKLRRRQACCGNNGQPGC
Ga0335085_1003925663300032770SoilMVSNWASYDAPWPAKLRMAASNTFIKLRHRQACCGHHGQPGC
Ga0335079_1099950523300032783SoilLLSNWITYDAPIAVKLRMAASNTFIKLRRHQACCGNNGQPGC
Ga0335078_1000477183300032805SoilLSNWITYDAPIAVKLRMAASNTFIKLRRHQACCGNNGQPGC
Ga0335080_1030083123300032828SoilLLSNWITYDAPFATKLQMAASNTLIKLRKRQACCGHPGQPGC
Ga0335080_1058749613300032828SoilMFSNWSSYDAPFAVKLRMAVSNTLTKVRTGQACCGNHGQPGC
Ga0335081_1008604143300032892SoilLLSNWTTYDAPLPVKLRMAASNTLLKLRKRQACCGNNGQPGC
Ga0335081_1114082313300032892SoilLLSNWTTYDAPFTVKLRMAASNTFLKLRKRQACCGNNGQPGC
Ga0335075_1003723513300032896SoilVSNWTSYDASFATKLRMAASNTLIKLRKRQACCGNNGQPGC
Ga0335075_1018886033300032896SoilLVSNWTSYDAPFATKLRMAVSNTLIKLRRHQACCGNNGQPGC
Ga0335083_1153297623300032954SoilDPRALLSNWITYDAPIAVKLRMAASNTFIKLRRHQACCGNNGQPGC
Ga0335077_1163994623300033158SoilPRPDPRAFVSNWTTYDAPFAAKLRMAASNTLIKLRRHQACCGNNGQPGC
Ga0310914_1178126023300033289SoilPRAFFANWTTYDAPFATKVRLATSNTFRKLRKGQACCGNNGEPGC


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.