Metagenome Family F027701

Basic Information
Family ID	F027701
Family Type	Metagenome
Number of Sequences	193
Average Sequence Length	38 residues
Representative Sequence	MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQ
Number of Associated Samples	65
Number of Associated Scaffolds	193

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	89.83 %
% of genes near scaffold ends (potentially truncated)	13.47 %
% of genes from short scaffolds (< 2000 bps)	91.71 %
Associated GOLD sequencing projects	65
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Unclassified (78.756 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (98.446 % of family members)
Environment Ontology (ENVO)	Unclassified (98.446 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (98.446 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 193 Family Scaffolds
PF04195	Transposase_28	2.07

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
All Organisms	root	All Organisms	21.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
cellular organisms	root	All Organisms → cellular organisms	21.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	21.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	19.69 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	19.69 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	19.69 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19.69 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	19.69 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	19.69 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	19.69 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19.69 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	19.69 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	19.69 %
Spirurina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	19.69 %
Spiruromorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	19.69 %
Filarioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	19.69 %
Setariidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.52 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300013296\|Ga0157374_12363970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	559	Open in IMG/M
3300013297\|Ga0157378_12637364	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	555	Open in IMG/M
3300013297\|Ga0157378_12830519	Not Available	538	Open in IMG/M
3300015267\|Ga0182122_1066536	Not Available	515	Open in IMG/M
3300015269\|Ga0182113_1063210	Not Available	575	Open in IMG/M
3300015269\|Ga0182113_1067213	Not Available	564	Open in IMG/M
3300015274\|Ga0182188_1053143	Not Available	525	Open in IMG/M
3300015275\|Ga0182172_1058552	Not Available	546	Open in IMG/M
3300015275\|Ga0182172_1069236	Not Available	519	Open in IMG/M
3300015275\|Ga0182172_1076218	Not Available	503	Open in IMG/M
3300015276\|Ga0182170_1023806	Not Available	703	Open in IMG/M
3300015276\|Ga0182170_1033622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	640	Open in IMG/M
3300015277\|Ga0182128_1058760	Not Available	550	Open in IMG/M
3300015277\|Ga0182128_1064683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	535	Open in IMG/M
3300015283\|Ga0182156_1027670	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	703	Open in IMG/M
3300015283\|Ga0182156_1087512	Not Available	503	Open in IMG/M
3300015285\|Ga0182186_1024156	Not Available	718	Open in IMG/M
3300015285\|Ga0182186_1074640	Not Available	520	Open in IMG/M
3300015286\|Ga0182176_1025824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	731	Open in IMG/M
3300015286\|Ga0182176_1047618	Not Available	606	Open in IMG/M
3300015286\|Ga0182176_1051387	Not Available	592	Open in IMG/M
3300015286\|Ga0182176_1080300	Not Available	513	Open in IMG/M
3300015287\|Ga0182171_1006750	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1024	Open in IMG/M
3300015287\|Ga0182171_1031280	Not Available	679	Open in IMG/M
3300015288\|Ga0182173_1061823	Not Available	556	Open in IMG/M
3300015289\|Ga0182138_1018408	Not Available	785	Open in IMG/M
3300015291\|Ga0182125_1044722	Not Available	629	Open in IMG/M
3300015291\|Ga0182125_1060496	Not Available	576	Open in IMG/M
3300015292\|Ga0182141_1020988	Not Available	773	Open in IMG/M
3300015292\|Ga0182141_1078841	Not Available	531	Open in IMG/M
3300015294\|Ga0182126_1027083	Not Available	727	Open in IMG/M
3300015294\|Ga0182126_1078652	Not Available	534	Open in IMG/M
3300015294\|Ga0182126_1084078	Not Available	524	Open in IMG/M
3300015295\|Ga0182175_1016561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	841	Open in IMG/M
3300015295\|Ga0182175_1038343	Not Available	666	Open in IMG/M
3300015295\|Ga0182175_1074778	Not Available	548	Open in IMG/M
3300015296\|Ga0182157_1058560	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	598	Open in IMG/M
3300015296\|Ga0182157_1079842	Not Available	544	Open in IMG/M
3300015298\|Ga0182106_1027624	Not Available	743	Open in IMG/M
3300015298\|Ga0182106_1029838	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	726	Open in IMG/M
3300015298\|Ga0182106_1030174	Not Available	724	Open in IMG/M
3300015298\|Ga0182106_1032669	Not Available	708	Open in IMG/M
3300015298\|Ga0182106_1065986	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	577	Open in IMG/M
3300015298\|Ga0182106_1084716	Not Available	534	Open in IMG/M
3300015299\|Ga0182107_1042614	Not Available	659	Open in IMG/M
3300015299\|Ga0182107_1048083	Not Available	637	Open in IMG/M
3300015300\|Ga0182108_1020089	Not Available	823	Open in IMG/M
3300015300\|Ga0182108_1022983	Not Available	792	Open in IMG/M
3300015300\|Ga0182108_1049521	Not Available	636	Open in IMG/M
3300015300\|Ga0182108_1080344	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	550	Open in IMG/M
3300015300\|Ga0182108_1081954	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	546	Open in IMG/M
3300015302\|Ga0182143_1083099	Not Available	540	Open in IMG/M
3300015302\|Ga0182143_1102831	Not Available	505	Open in IMG/M
3300015303\|Ga0182123_1021516	Not Available	773	Open in IMG/M
3300015303\|Ga0182123_1023957	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	751	Open in IMG/M
3300015303\|Ga0182123_1094539	Not Available	509	Open in IMG/M
3300015303\|Ga0182123_1095457	Not Available	508	Open in IMG/M
3300015304\|Ga0182112_1019164	Not Available	827	Open in IMG/M
3300015304\|Ga0182112_1069058	Not Available	574	Open in IMG/M
3300015305\|Ga0182158_1100361	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	509	Open in IMG/M
3300015305\|Ga0182158_1101119	Not Available	508	Open in IMG/M
3300015308\|Ga0182142_1050930	Not Available	646	Open in IMG/M
3300015308\|Ga0182142_1060635	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	614	Open in IMG/M
3300015308\|Ga0182142_1077761	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	569	Open in IMG/M
3300015308\|Ga0182142_1079412	Not Available	565	Open in IMG/M
3300015308\|Ga0182142_1090808	Not Available	542	Open in IMG/M
3300015314\|Ga0182140_1047821	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	660	Open in IMG/M
3300015314\|Ga0182140_1056280	Not Available	629	Open in IMG/M
3300015314\|Ga0182140_1081472	Not Available	562	Open in IMG/M
3300015321\|Ga0182127_1088714	Not Available	562	Open in IMG/M
3300015322\|Ga0182110_1076655	Not Available	587	Open in IMG/M
3300015322\|Ga0182110_1087855	Not Available	562	Open in IMG/M
3300015322\|Ga0182110_1089055	Not Available	560	Open in IMG/M
3300015322\|Ga0182110_1093082	Not Available	552	Open in IMG/M
3300015323\|Ga0182129_1031917	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	738	Open in IMG/M
3300015323\|Ga0182129_1117250	Not Available	501	Open in IMG/M
3300015341\|Ga0182187_1022331	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1061	Open in IMG/M
3300015341\|Ga0182187_1061218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	764	Open in IMG/M
3300015341\|Ga0182187_1089733	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	670	Open in IMG/M
3300015341\|Ga0182187_1151036	Not Available	558	Open in IMG/M
3300015341\|Ga0182187_1171016	Not Available	533	Open in IMG/M
3300015342\|Ga0182109_1147946	Not Available	589	Open in IMG/M
3300015342\|Ga0182109_1201842	Not Available	522	Open in IMG/M
3300015342\|Ga0182109_1203183	Not Available	521	Open in IMG/M
3300015342\|Ga0182109_1217953	Not Available	507	Open in IMG/M
3300015343\|Ga0182155_1053315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	839	Open in IMG/M
3300015343\|Ga0182155_1063659	Not Available	790	Open in IMG/M
3300015343\|Ga0182155_1101053	Not Available	674	Open in IMG/M
3300015343\|Ga0182155_1104386	Not Available	666	Open in IMG/M
3300015343\|Ga0182155_1135566	Not Available	607	Open in IMG/M
3300015343\|Ga0182155_1157114	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	575	Open in IMG/M
3300015343\|Ga0182155_1205159	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	520	Open in IMG/M
3300015344\|Ga0182189_1088855	Not Available	715	Open in IMG/M
3300015344\|Ga0182189_1127882	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	627	Open in IMG/M
3300015345\|Ga0182111_1117216	Not Available	668	Open in IMG/M
3300015345\|Ga0182111_1143391	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	619	Open in IMG/M
3300015345\|Ga0182111_1153655	Not Available	603	Open in IMG/M
3300015346\|Ga0182139_1016007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1322	Open in IMG/M
3300015346\|Ga0182139_1075186	Not Available	787	Open in IMG/M
3300015346\|Ga0182139_1090796	Not Available	735	Open in IMG/M
3300015346\|Ga0182139_1178370	Not Available	570	Open in IMG/M
3300015346\|Ga0182139_1192131	Not Available	553	Open in IMG/M
3300015347\|Ga0182177_1064607	Not Available	835	Open in IMG/M
3300015347\|Ga0182177_1095083	Not Available	725	Open in IMG/M
3300015347\|Ga0182177_1170238	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	583	Open in IMG/M
3300015347\|Ga0182177_1212558	Not Available	535	Open in IMG/M
3300015347\|Ga0182177_1212869	Not Available	534	Open in IMG/M
3300015347\|Ga0182177_1237936	Not Available	511	Open in IMG/M
3300015347\|Ga0182177_1238564	Not Available	511	Open in IMG/M
3300015347\|Ga0182177_1250025	Not Available	501	Open in IMG/M
3300015351\|Ga0182161_1146829	Not Available	639	Open in IMG/M
3300015351\|Ga0182161_1192869	Not Available	574	Open in IMG/M
3300015351\|Ga0182161_1237414	Not Available	527	Open in IMG/M
3300015355\|Ga0182159_1062643	Not Available	1032	Open in IMG/M
3300015355\|Ga0182159_1064969	Not Available	1017	Open in IMG/M
3300015355\|Ga0182159_1080038	Not Available	938	Open in IMG/M
3300015355\|Ga0182159_1179292	Not Available	673	Open in IMG/M
3300015355\|Ga0182159_1199027	Not Available	644	Open in IMG/M
3300015361\|Ga0182145_1030425	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	922	Open in IMG/M
3300015361\|Ga0182145_1163777	Not Available	533	Open in IMG/M
3300015361\|Ga0182145_1168303	Not Available	528	Open in IMG/M
3300015361\|Ga0182145_1187915	Not Available	508	Open in IMG/M
3300017404\|Ga0182203_1050011	Not Available	737	Open in IMG/M
3300017404\|Ga0182203_1125954	Not Available	549	Open in IMG/M
3300017407\|Ga0182220_1072056	Not Available	566	Open in IMG/M
3300017409\|Ga0182204_1030333	Not Available	758	Open in IMG/M
3300017409\|Ga0182204_1056450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	632	Open in IMG/M
3300017410\|Ga0182207_1032176	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	875	Open in IMG/M
3300017410\|Ga0182207_1038793	Not Available	826	Open in IMG/M
3300017410\|Ga0182207_1098555	Not Available	613	Open in IMG/M
3300017410\|Ga0182207_1111673	Not Available	588	Open in IMG/M
3300017410\|Ga0182207_1160169	Not Available	519	Open in IMG/M
3300017410\|Ga0182207_1171968	Not Available	507	Open in IMG/M
3300017411\|Ga0182208_1106208	Not Available	536	Open in IMG/M
3300017411\|Ga0182208_1128377	Not Available	503	Open in IMG/M
3300017413\|Ga0182222_1060359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	586	Open in IMG/M
3300017413\|Ga0182222_1068299	Not Available	568	Open in IMG/M
3300017415\|Ga0182202_1025190	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	855	Open in IMG/M
3300017415\|Ga0182202_1028720	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	821	Open in IMG/M
3300017415\|Ga0182202_1095815	Not Available	568	Open in IMG/M
3300017420\|Ga0182228_1074304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	615	Open in IMG/M
3300017420\|Ga0182228_1130975	Not Available	500	Open in IMG/M
3300017424\|Ga0182219_1032842	Not Available	789	Open in IMG/M
3300017424\|Ga0182219_1050722	Not Available	689	Open in IMG/M
3300017425\|Ga0182224_1033056	Not Available	830	Open in IMG/M
3300017425\|Ga0182224_1052342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	723	Open in IMG/M
3300017425\|Ga0182224_1063956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	680	Open in IMG/M
3300017425\|Ga0182224_1084160	Not Available	625	Open in IMG/M
3300017425\|Ga0182224_1091984	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	608	Open in IMG/M
3300017425\|Ga0182224_1125551	Not Available	551	Open in IMG/M
3300017427\|Ga0182190_1055035	Not Available	730	Open in IMG/M
3300017427\|Ga0182190_1111364	Not Available	576	Open in IMG/M
3300017427\|Ga0182190_1137527	Not Available	535	Open in IMG/M
3300017430\|Ga0182192_1150608	Not Available	528	Open in IMG/M
3300017430\|Ga0182192_1174370	Not Available	501	Open in IMG/M
3300017433\|Ga0182206_1094657	Not Available	594	Open in IMG/M
3300017433\|Ga0182206_1137862	Not Available	527	Open in IMG/M
3300017436\|Ga0182209_1167847	Not Available	508	Open in IMG/M
3300017438\|Ga0182191_1078567	Not Available	668	Open in IMG/M
3300017442\|Ga0182221_1087824	Not Available	618	Open in IMG/M
3300017442\|Ga0182221_1118501	Not Available	564	Open in IMG/M
3300017442\|Ga0182221_1142176	Not Available	532	Open in IMG/M
3300017443\|Ga0182193_1135455	Not Available	573	Open in IMG/M
3300017443\|Ga0182193_1174626	Not Available	524	Open in IMG/M
3300017443\|Ga0182193_1185324	Not Available	513	Open in IMG/M
3300017680\|Ga0182233_1093843	Not Available	551	Open in IMG/M
3300017683\|Ga0182218_1069751	Not Available	642	Open in IMG/M
3300017683\|Ga0182218_1144962	Not Available	512	Open in IMG/M
3300017684\|Ga0182225_1084189	Not Available	595	Open in IMG/M
3300017684\|Ga0182225_1117896	Not Available	536	Open in IMG/M
3300017685\|Ga0182227_1061532	Not Available	681	Open in IMG/M
3300017686\|Ga0182205_1080013	Not Available	650	Open in IMG/M
3300017686\|Ga0182205_1125624	Not Available	559	Open in IMG/M
3300017686\|Ga0182205_1155171	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	520	Open in IMG/M
3300017690\|Ga0182223_1016853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	865	Open in IMG/M
3300017690\|Ga0182223_1068916	Not Available	593	Open in IMG/M
3300017690\|Ga0182223_1074572	Not Available	580	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	98.45%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.55%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	98.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.55%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	98.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.55%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	98.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.55%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0157374_123639702	3300013296	Miscanthus Rhizosphere	MDHLAPLPRDSSMRVMNHAEGEQLRRAKEDKRKKK*
Ga0157378_126373641	3300013297	Miscanthus Rhizosphere	MDHLAPLPRDSTVRTANRTEGERLRKAKEDKRKKK*
Ga0157378_128305192	3300013297	Miscanthus Rhizosphere	MDHPAPLSRDSAVRTANHAEGEWLRKAKEDKKRKKQWKL*
Ga0182122_10665362	3300015267	Miscanthus Phyllosphere	MDHPTLLPRDSAVRMANHVEGERLRKAKEDKNRKKQQKL*
Ga0182113_10632101	3300015269	Miscanthus Phyllosphere	MDHPVPLPRDSSMRAANRAKGERLRKAKEDKKRNRQWKL*
Ga0182113_10672131	3300015269	Miscanthus Phyllosphere	MDPPTPLLRDSAMRMANCAKGERLRKAKEDRKRKK*
Ga0182188_10531431	3300015274	Miscanthus Phyllosphere	FTDHLAPLPRDSSVRALNHAEGERLRKAKEGKRKKK*
Ga0182172_10585522	3300015275	Miscanthus Phyllosphere	MDHPAPLSRDLTVRVANCAEGERLRKAKEGKKRKK*
Ga0182172_10692362	3300015275	Miscanthus Phyllosphere	MDHPASLPRDLAMRAVNRVEGERLRKVKEDKKRKKQ*
Ga0182172_10762181	3300015275	Miscanthus Phyllosphere	MLLLRDSSMRAANHVEGERLRKAKEDMRKKRQQKLLA*
Ga0182170_10238061	3300015276	Miscanthus Phyllosphere	MDHPAPLSRDSAVRTTNRAEGERLRKVKEDKKRKK*
Ga0182170_10336222	3300015276	Miscanthus Phyllosphere	MDHLAPLSRDLAVRVANRAGGKWLWKAKEDKKRKK*
Ga0182128_10587602	3300015277	Miscanthus Phyllosphere	MDHLALLPKDLSMRAMNHAEGERLRKKEDKKRKKQ*
Ga0182128_10646832	3300015277	Miscanthus Phyllosphere	MDHPTPLPRDSAVRTANHTEGEWLRKAKEDKKRKKQ
Ga0182160_10662951	3300015281	Miscanthus Phyllosphere	HMDHPALLPRGLAMRAVNHTDGERLKKAKEDKKRKK*
Ga0182156_10276702	3300015283	Miscanthus Phyllosphere	MDHSAPLPRDSSVRVVNHAEGERLRKAKEDKKRKR*
Ga0182156_10875122	3300015283	Miscanthus Phyllosphere	PRDLIIMDHQAPLLRDSAMRATNHVEVERLRKAKEDKKRKK*
Ga0182186_10241562	3300015285	Miscanthus Phyllosphere	MDHPVPLPRDSAMRVVNRTKGERLRKAKEDKKRKK*
Ga0182186_10746401	3300015285	Miscanthus Phyllosphere	MDHLASLPRDSSVRAANHAEGERLRKAKEDKRKKKH*
Ga0182176_10258242	3300015286	Miscanthus Phyllosphere	MDHLAPLPRDSAMRIANHAEGERLRKAKEDRKRKKQ*
Ga0182176_10476182	3300015286	Miscanthus Phyllosphere	MDHLALLPRDLAMRAANRAESERLRKVKEDKKRKK*
Ga0182176_10513872	3300015286	Miscanthus Phyllosphere	MDHPMPLPRDSDMRVANRAKGERLRKAKEDKKRKK*
Ga0182176_10803001	3300015286	Miscanthus Phyllosphere	MDHPVPLLRDLAMRVANHTKGEWLREAKEDKKRKKQRKLQAWE*
Ga0182171_10067504	3300015287	Miscanthus Phyllosphere	MDHSAPLPRDSSVRAVNHAEGEQLRKEKEDKKRKR
Ga0182171_10137693	3300015287	Miscanthus Phyllosphere	MDHPTPLPRDSSMRAMNYALGKWLRKAKEDKKRKR*
Ga0182171_10312801	3300015287	Miscanthus Phyllosphere	MDDLAPLPRDSTMRAANHAEGKWLRKEKEGKRKKKQ
Ga0182173_10331711	3300015288	Miscanthus Phyllosphere	MDDLALLPRDSSVRVANRAEGERLRKAKEDKRRKRQ*
Ga0182173_10618232	3300015288	Miscanthus Phyllosphere	MDHLAPLPRDSAVRTMNRAEGERLRKAKKDRKRKRQWKL*
Ga0182138_10184081	3300015289	Miscanthus Phyllosphere	MDHIAPLPRDSSVRVANHVEGEQLRKAKEDKKRKKQWKLRVRE*
Ga0182125_10161442	3300015291	Miscanthus Phyllosphere	MDHPALLPRGLAMRAVNHTDGERLKKAKEDKKRKK*
Ga0182125_10309782	3300015291	Miscanthus Phyllosphere	MDHPSSLPRDSSVRVANHAEGERLRKAKEDKRKKRQRKLQAQE*
Ga0182125_10447221	3300015291	Miscanthus Phyllosphere	MDHPAPLPRDSAMRTANHTEGERPRKVKEDKKRKKQWKL*
Ga0182125_10604961	3300015291	Miscanthus Phyllosphere	VVPLPRDLAVRTANHAEGERLRRAKEDRKRKKKWKL*
Ga0182141_10209882	3300015292	Miscanthus Phyllosphere	MDHPAPLSRDSAMRAANHAEGERLWKAKEDKKRKK*
Ga0182141_10788411	3300015292	Miscanthus Phyllosphere	MDHPAPLPRDSSMRAASHAEGKWLRKAKEDKKRKQQQKL*
Ga0182126_10270831	3300015294	Miscanthus Phyllosphere	MDHLAPLLRDSTVRTVNRAEGEWLRKVNEDRKRKK*
Ga0182126_10786521	3300015294	Miscanthus Phyllosphere	MDHPAPLPRDSSMRVVNHVEGEWLRKVKEDKRKKKQRRL*
Ga0182126_10840782	3300015294	Miscanthus Phyllosphere	MEHPALLPRDSATRMMNCAEGEWLRKAKEDRKRKKQQKLQA*
Ga0182175_10165611	3300015295	Miscanthus Phyllosphere	MDHPTLLPRDSAMRLANYAKAEWLKKAKEDKMRKRQQKLRA
Ga0182175_10383431	3300015295	Miscanthus Phyllosphere	MDHLAPLPRDLSVRAVNHAEGERLKKAKEDKRKKRQWKL*
Ga0182175_10747782	3300015295	Miscanthus Phyllosphere	MDHPAPLPRDLAMRVANRAEGERLRKAKDDKKRKKQWKL*
Ga0182157_10585601	3300015296	Miscanthus Phyllosphere	MNHSAPLPRDSFVRAANHAEGERLRKAKVDKKRKRQRKLQAQE*
Ga0182157_10798421	3300015296	Miscanthus Phyllosphere	MDHPAPLPRDLAVRAVNRAEGEWLRKAKEDKKREKQ*
Ga0182106_10276241	3300015298	Miscanthus Phyllosphere	MDHPASLPRDLSMRAANHVKGERLRKTKEDKRKKKQ*
Ga0182106_10298381	3300015298	Miscanthus Phyllosphere	MDHPAPLPRDSAVRVANRAKGEWLRKAKEDKKRKKQWKLRVRE*
Ga0182106_10301741	3300015298	Miscanthus Phyllosphere	MDHPTPLPRDSAMRMANHAKGEWLRKAKEDKKRNNQQKLLA*
Ga0182106_10326692	3300015298	Miscanthus Phyllosphere	MDLIFMDHPAPLPRDSSVRVANHAEGEWLRKAKEDKRKKKHQKL*
Ga0182106_10659862	3300015298	Miscanthus Phyllosphere	MRDLIFMDHPAPLPRDSSMRVVNHAKGERLRKAKEDKKRKR*
Ga0182106_10847161	3300015298	Miscanthus Phyllosphere	MDHPASLPRDSSMRAANRAEGERLRKAKEDKRKKK*
Ga0182107_10426142	3300015299	Miscanthus Phyllosphere	MDHPTPLPRDLAMRLVNHAEGEWLRKAKDDKKRKKQWKL*
Ga0182107_10480831	3300015299	Miscanthus Phyllosphere	MDHPMPLLRDSSVRAVNRAKGEWLRKAKEDKRKKK*
Ga0182107_10955551	3300015299	Miscanthus Phyllosphere	PRELVFTDHPALLPRDSSMRAANRAEGERLRKAKEDKRKKKQ*
Ga0182108_10200892	3300015300	Miscanthus Phyllosphere	LPRDSFVRATNHVEGERLRKAKEDKKRNRQWKLQAWK*
Ga0182108_10229831	3300015300	Miscanthus Phyllosphere	MPPTDLILMDHPAPLLRDSTVRVANHTEGEQLRKAKEDKKRKK*
Ga0182108_10495211	3300015300	Miscanthus Phyllosphere	MDHPVALPRDSSMRAANRAEGERVRKAKEDKKRKK*
Ga0182108_10803442	3300015300	Miscanthus Phyllosphere	MDHPAPLPRDSAVRAANRAEGKRLRKVKEDWKRKKQRKLQVQER
Ga0182108_10819541	3300015300	Miscanthus Phyllosphere	MDHPMPLLRDLAMRMVNHAEGERLRKAKEDKKRKK*
Ga0182143_10830992	3300015302	Miscanthus Phyllosphere	MDHPVPLPRDSCVRAVNRAEGERLRKAKEDKKRKRQQKL*
Ga0182143_11028311	3300015302	Miscanthus Phyllosphere	MDHPTPLPRDSVVRTANRAEGERLRKAKEDKKRKKQQ
Ga0182123_10215162	3300015303	Miscanthus Phyllosphere	MDHSVSLPRDSAMRMANRIEGEWLRKAKEDKKRKRQRKL*
Ga0182123_10239572	3300015303	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKMKKE*
Ga0182123_10945391	3300015303	Miscanthus Phyllosphere	MDHPVPLPRDSAVRVVNRAEGERLRKVKEDKKRKKMWKLWS*
Ga0182123_10954572	3300015303	Miscanthus Phyllosphere	MDHLAPLPRELAMRVANRAEGEWLRKAKEGKKRKKKWKLRA*
Ga0182112_10191642	3300015304	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQWKL*
Ga0182112_10690582	3300015304	Miscanthus Phyllosphere	MDHPVPLLRDSDVRVANRAEGERLRKAKDDKKRKRQQKL*
Ga0182158_11003612	3300015305	Miscanthus Phyllosphere	MDHLVPLPRDSTMRVANSAEGKRLRKAKEDKKRKK
Ga0182158_11011192	3300015305	Miscanthus Phyllosphere	MDHLAPLLRDSSMRAVNHVVGKGLRKAKEDKRKKKQWKL*
Ga0182142_10509301	3300015308	Miscanthus Phyllosphere	MDHPVLLLRDSAMRTMNHAEGERLRKAKEDRKRKKQRKLQVQE*
Ga0182142_10606352	3300015308	Miscanthus Phyllosphere	MDHPAPLPRDLAVRAVNRAEGEWLRKAKEDKKRKKQ*
Ga0182142_10777612	3300015308	Miscanthus Phyllosphere	MDPPTSLPRDSTVRMANHTEGERLRKAKEDKKGKKQWKL*
Ga0182142_10794122	3300015308	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNHIEGEMLRKAKEDEERKKQRKL*
Ga0182142_10908081	3300015308	Miscanthus Phyllosphere	MDHPAPLLRDSSMRVVNCVEGERLRKAKEDKRKKQQQKL*
Ga0182140_10478212	3300015314	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQ*
Ga0182140_10562801	3300015314	Miscanthus Phyllosphere	FMDYLAPLPWDSSMRAANHAEGKRLRKAKEDKKRKR*
Ga0182140_10814722	3300015314	Miscanthus Phyllosphere	MDHLASLSRDLAVSAANRAEGEQLRKAKEDKKRKK*
Ga0182127_10887141	3300015321	Miscanthus Phyllosphere	MDHPAPLPRDSSMRVVNHVEGEWLRKVKEDKRKKKQWKLQA*
Ga0182110_10766552	3300015322	Miscanthus Phyllosphere	MDHLVPLLRDSTMNTVNHAEGEPLRKAKDDKKRTKQRKL*
Ga0182110_10878551	3300015322	Miscanthus Phyllosphere	MDHPVPLLRDSSVRAANHTEGERLRKAKEDKRKNKQ*
Ga0182110_10890551	3300015322	Miscanthus Phyllosphere	LILTDHLAPLPRDSSMRVANRAEGERLRKAKEDKRKKK*
Ga0182110_10930822	3300015322	Miscanthus Phyllosphere	MDHPTPLSRDSTMRTANHTKGEWLRKAKEDRKRKKQ*
Ga0182129_10319171	3300015323	Miscanthus Phyllosphere	MDHPTLLPRDSFVRAANHAEGEWLRKAKEDKRKKKQPKLQARE*
Ga0182129_10594012	3300015323	Miscanthus Phyllosphere	LRDLIFLDHPAPLPRDSSMRAVNDAKGMRLRKAKEDKKRKRQWKL*
Ga0182129_11172502	3300015323	Miscanthus Phyllosphere	MDHPVSLPRDSFMRAVNHAEGERLRKAKEDKKRKK*
Ga0182187_10223312	3300015341	Miscanthus Phyllosphere	MDHPTLLLRDLAMRVANSAKGERLGKAKLDKKRKKQRKLWA*
Ga0182187_10612182	3300015341	Miscanthus Phyllosphere	MDHPAPLPRDSTMRVANLAKGEWLRKAKEDKKRKKQ*
Ga0182187_10897332	3300015341	Miscanthus Phyllosphere	MDHPTLLPRDSTMRATNRTEGERLRKAKEDKKRKRQ*
Ga0182187_11273712	3300015341	Miscanthus Phyllosphere	MDHLDLLPRDSSVRVVNRAKGERMRKAKDDKRRKR*
Ga0182187_11510361	3300015341	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKKRKKQWKLQVRE*
Ga0182187_11710161	3300015341	Miscanthus Phyllosphere	MDHPASLLRDSSVRVANHVEGEWLRKAKEDKRKKKQWKL*
Ga0182109_11259172	3300015342	Miscanthus Phyllosphere	MDHPALLPRDSSVRAANRAEGERLRKAEEDKRKKKQQKL*
Ga0182109_11479461	3300015342	Miscanthus Phyllosphere	MDHPALLPRDLAMRAANCAEGEWLRKAKEDKKRKK*
Ga0182109_12018422	3300015342	Miscanthus Phyllosphere	MDHPMPLLRDSSVRAVNRAKGEWLRKAKEDKMRKKQWKLRA*
Ga0182109_12031831	3300015342	Miscanthus Phyllosphere	MDHLAPLPRDSFMRVANHVEGKRLRKAKEDKKRKR
Ga0182109_12179531	3300015342	Miscanthus Phyllosphere	MDHPTPLPRVSSMRVVNHAEGEQLRMVKEDKKKKK*
Ga0182155_10533151	3300015343	Miscanthus Phyllosphere	MDHPAPLPRDSGVRVVNHIEGEWLSKAKEDKKRKKQWKL*
Ga0182155_10636591	3300015343	Miscanthus Phyllosphere	LTDHPMPLLRDSAMRTVNRAEGEWLRKAKEDRKRKK*
Ga0182155_11010532	3300015343	Miscanthus Phyllosphere	MDHPAPLPRDSVVRVANHAKGERLRKAKEDKKRKK*
Ga0182155_11043861	3300015343	Miscanthus Phyllosphere	MDHPVPLPRDSSMRAANHAKCEWLRKTKEDNKRKRQRKL*
Ga0182155_11355661	3300015343	Miscanthus Phyllosphere	MDHPAPLLRDSSMRAVNRAEGERLRKAKEDKKRKRQRKL*
Ga0182155_11571142	3300015343	Miscanthus Phyllosphere	MDHMTLLLRDLAMRVVNHAEGERLRKTKEDKKRKKQWKL*
Ga0182155_12051591	3300015343	Miscanthus Phyllosphere	MDHPVPLLRYSSVRVANHARGKQLRKAKEDKKRKKQW
Ga0182189_10888552	3300015344	Miscanthus Phyllosphere	MDHLAPLPRDSAVWAANHAQGERLRKVKEDKRKKKQWKL*
Ga0182189_11278822	3300015344	Miscanthus Phyllosphere	MDHPAPLPRDSAVRAANHAEGERLRKVKEDKKGKKQRKLQAWE*
Ga0182111_11172162	3300015345	Miscanthus Phyllosphere	MDHPMPLPRDSIVRTANHAEGEQLRKAKDDKKRKKQ*
Ga0182111_11433912	3300015345	Miscanthus Phyllosphere	MDHPAPLPRDSSVRAANHDEGERLRKAKEDKKRKRQRKL*
Ga0182111_11536551	3300015345	Miscanthus Phyllosphere	MDHLTPLPRDLAVRVVNHAEGERLRKVKEDEKRKK*
Ga0182111_12139121	3300015345	Miscanthus Phyllosphere	MDHPAPLLRDLAMRAGNRTEGERLRKANEDKRKKRWWKLLA*
Ga0182139_10160071	3300015346	Miscanthus Phyllosphere	MDHLAPLPRDSVMRAANHIEGEWLRKAKEDKKKKK*
Ga0182139_10751862	3300015346	Miscanthus Phyllosphere	MDHSALLPRDLAMRAMNRAEGERLRKAKEDKKRKKQ*
Ga0182139_10907961	3300015346	Miscanthus Phyllosphere	MDHLPPWLRDSSMRAVNRAEGERLRKAKEDKRKKKQWKL*
Ga0182139_11783701	3300015346	Miscanthus Phyllosphere	MDHPAPLLRDSSMRVVNCAEGERLRKVKEDKRKKKQWKL*
Ga0182139_11921311	3300015346	Miscanthus Phyllosphere	MDHPVLLPRDLAMRTVNHAEGKRLRKEKEDRKRKKQ*
Ga0182139_12423842	3300015346	Miscanthus Phyllosphere	MDHLALLPRDSSVRAANRAEGKRLRKAMEDKRKKRPQKL*
Ga0182177_10646072	3300015347	Miscanthus Phyllosphere	MDHPVSLPRDSTVRAANRAEGKRLRKAKEDKKRKKQ*
Ga0182177_10950832	3300015347	Miscanthus Phyllosphere	MDHPMPLLRDSAVRMANHAEDERPRKAKEDKNRKKQQKL*
Ga0182177_11702382	3300015347	Miscanthus Phyllosphere	MDHPTPLLRDSAVRMANRTEGERLRKAKEDKKRKKQQGLWAWE*
Ga0182177_12125581	3300015347	Miscanthus Phyllosphere	MDHPAPLPRDSSMRAANRAVCERLRKAEEDKRKKKQQKL*
Ga0182177_12128691	3300015347	Miscanthus Phyllosphere	MDHLAPLLRDSSIRAVNHIEGERLRKEKEDKRKKQQKLQT*
Ga0182177_12379362	3300015347	Miscanthus Phyllosphere	MDHPVPLSRDSTVRAANRAKGEQLRKAKEDKKRKL*
Ga0182177_12385642	3300015347	Miscanthus Phyllosphere	MDHLAPLPRDSTVRVVNHAEGERLRKVKEDEGKKRQRKL*
Ga0182177_12500252	3300015347	Miscanthus Phyllosphere	MDHPTPLSRDLVVRMANHAEGEWLRKVKEDKKRKK*
Ga0182161_11468291	3300015351	Miscanthus Phyllosphere	MDHSTPLLRDSSVRATNRAKGERLRKAKEDKKRKRQ*
Ga0182161_11928693	3300015351	Miscanthus Phyllosphere	MDHPAPLPRDSFVRAVNHAEGERLRKAKEDKKRKRQ*
Ga0182161_12374142	3300015351	Miscanthus Phyllosphere	MDHPTPLLRDSAMRAANHAEDERLRKVKEDKKKKR*
Ga0182159_10626433	3300015355	Miscanthus Phyllosphere	MDHLVPLPRDSTVRVANHAKGEQLRKAKEDNKTKKQRKLRARE*
Ga0182159_10649692	3300015355	Miscanthus Phyllosphere	MDHPVPLPRDSAVRTVNHTEGERLRKAKEDKKRKK*
Ga0182159_10800382	3300015355	Miscanthus Phyllosphere	MDHPAPLLRDSSMRVVNHAEGEWLRKAKEDKKRKR*
Ga0182159_11792921	3300015355	Miscanthus Phyllosphere	MDHLAPLLRDSAMRTVNHVKGEWLRKAKEDKKRKKQW*
Ga0182159_11990272	3300015355	Miscanthus Phyllosphere	MDHSALLLRDSAMRMVNHAMGERLRKAKEDRKRKKQ*
Ga0182145_10304251	3300015361	Miscanthus Phyllosphere	MDHPVPLPRDLSVRAANHAEGERLRKAKEDKGKKRQ*
Ga0182145_11637771	3300015361	Miscanthus Phyllosphere	MDHLAPLLRDSSMRAVNHAEGEWLRKAKEDKKRKRQ*
Ga0182145_11683031	3300015361	Miscanthus Phyllosphere	MDHPVPLPRDSSMRAANHAEGERLRKAKADKNRKRQRKLQARE*
Ga0182145_11879151	3300015361	Miscanthus Phyllosphere	MDHLAPLPRDSSVRVANHAEGEQLRKAKEDKKRKK*
Ga0182203_10500112	3300017404	Miscanthus Phyllosphere	MDHPALLPRDSVVREANRAEGEQLRKAKEDKKRKK
Ga0182203_11160642	3300017404	Miscanthus Phyllosphere	MDHPALLPRDSSMRAMNHVEGERLMKAKEDRRKKR
Ga0182203_11259541	3300017404	Miscanthus Phyllosphere	MDHPAPLPRDSAGRTVNRAEGKRLRKAKEDKERKKQ
Ga0182220_10720561	3300017407	Miscanthus Phyllosphere	MDHLAPLPRDPAVRMVNRAKGERLRKVKEDKKRKKH
Ga0182204_10303332	3300017409	Miscanthus Phyllosphere	MDHSAPLPRDSTVRMANRAEGERLRKVKEDKKRKKMWKLWS
Ga0182204_10564502	3300017409	Miscanthus Phyllosphere	MDHLVPLPRDSTVRVANHAKGEQLRKAKEDNKTKKQRKLRARE
Ga0182207_10321761	3300017410	Miscanthus Phyllosphere	MDHPVPLLRDSAMMMMNRVEGKRLRKAKEDKKSKKQWKL
Ga0182207_10387933	3300017410	Miscanthus Phyllosphere	MDHLMLLLRDSAMRAANHAEGERLRKAKEDKKKKKQ
Ga0182207_10985551	3300017410	Miscanthus Phyllosphere	DLILMDHPALLLRDSSMRVTNHAEGERLRKVKEDKRKKR
Ga0182207_11116732	3300017410	Miscanthus Phyllosphere	MDYTASLLRDSSMRVVNRAEGERLRKTKEDKKRKRQ
Ga0182207_11601692	3300017410	Miscanthus Phyllosphere	MDHPVPLPRDLAVRMANRAGGERLRKAKEDKKRKKQWKL
Ga0182207_11719681	3300017410	Miscanthus Phyllosphere	MDHPTPLSRDSTMRTANHAKGERLRKAKEDRKRKKQ
Ga0182208_10457221	3300017411	Miscanthus Phyllosphere	LMRDLIFMDHLAPLPRDSSMRALNHAKGERLRKAKEDKRKKKQ
Ga0182208_11062081	3300017411	Miscanthus Phyllosphere	MDHLAPLPRDSSMRVMNHAEGEQLRRAKEDKRKKK
Ga0182208_11283773	3300017411	Miscanthus Phyllosphere	MDHSAPLPRDSTVRAANHAEGEWLRKAKEDKKRKKQ
Ga0182222_10603591	3300017413	Miscanthus Phyllosphere	MDHPALLPRDLTVRTVNHADGERLRRVTEDKKRKKRWKL
Ga0182222_10682992	3300017413	Miscanthus Phyllosphere	MDHPAPLPRDSSVRATNHAEGERLRKAKEDKRRKRQ
Ga0182202_10251902	3300017415	Miscanthus Phyllosphere	MDHPALLLRDSSMRTANHVEGKRLRKAKEDKNRKKQWKL
Ga0182202_10287202	3300017415	Miscanthus Phyllosphere	MDHPALLPRDLAMRAANHAEGERSRNAKEDKKRKKQQKL
Ga0182202_10958152	3300017415	Miscanthus Phyllosphere	MDHPVPLLRDSSVMVANHVEGERLRKVKEDKRKKKQWKL
Ga0182228_10743042	3300017420	Miscanthus Phyllosphere	MDDPVLLPRDLAMRTANRAEGEQLRKTKEDKKRKK
Ga0182228_11309752	3300017420	Miscanthus Phyllosphere	MDHPAPLPRDSVMRAANRAEGERLRKAKEDKKRKK
Ga0182219_10328421	3300017424	Miscanthus Phyllosphere	MDHPAPLPRDSSMRVVNSTEGEWLRKAKEDQKRKW
Ga0182219_10507222	3300017424	Miscanthus Phyllosphere	MDHPVLLLRDSAMRTMNHAEGERLRKAKEDKKRKKQWKL
Ga0182219_10849481	3300017424	Miscanthus Phyllosphere	MDHPTPLPRDLFVRAANHDEGERLRKEKEDKRKNKQWKL
Ga0182219_11197301	3300017424	Miscanthus Phyllosphere	MDHPAPLLRDLAVRTANHLEGEQLRKAKDKKRKKE
Ga0182224_10330561	3300017425	Miscanthus Phyllosphere	RDLILMDHPMPLPRDSTMRTANHTEGELLRKAKEDKKRKK
Ga0182224_10523421	3300017425	Miscanthus Phyllosphere	MDHLALLPRDSAMRTVNHAKGERLRKAKEDKRKKRQ
Ga0182224_10639562	3300017425	Miscanthus Phyllosphere	MDHPASLPRDSAVRTANHAEGEWLRKAKEDKKRKKQWKL
Ga0182224_10841601	3300017425	Miscanthus Phyllosphere	MDHPVSLPRDSSMRATNCAEGERLRKAKGDKKRKKQQNL
Ga0182224_10919841	3300017425	Miscanthus Phyllosphere	MDHPTLLPRDSFVRAANHAEGEWLRKAKEDKRKKKQPKLQARE
Ga0182224_11255512	3300017425	Miscanthus Phyllosphere	MDHPTPLPRDSAVRVANRVKGERLRKAEVDKKRKKQ
Ga0182190_10550352	3300017427	Miscanthus Phyllosphere	MDHLAPLPRDSTVRTANRTEGERLRKAKEDKKRKKQ
Ga0182190_11113642	3300017427	Miscanthus Phyllosphere	MDHPTLLLRDSVMRMMNHAKGERLRKAKEDKKRKK
Ga0182190_11375272	3300017427	Miscanthus Phyllosphere	MDHSAPLPRESAMRAANRVEGERLSKAKENKKRKKQ
Ga0182192_11506081	3300017430	Miscanthus Phyllosphere	MDLILMDHSAPLSRDLAVRMANRAEGEQLRKAKEDQKRKKQ
Ga0182192_11743702	3300017430	Miscanthus Phyllosphere	MDHLTPLLRDSTMRAVNRAEGERLRKAKEDKKRKK
Ga0182206_10946571	3300017433	Miscanthus Phyllosphere	MDHLAPLPRDSSVRAVNHAEGEQLRKAKEDKKRKRQRKL
Ga0182206_11378621	3300017433	Miscanthus Phyllosphere	MDHLAPLPRDSAVRMANRTEGERLRKAKEDKKRKKQWKLQAWGMRGGH
Ga0182209_11678472	3300017436	Miscanthus Phyllosphere	MDHPAPLLRDSAMRTANHAEGEWPMKAKEDKRRKRQRKL
Ga0182191_10785672	3300017438	Miscanthus Phyllosphere	MDHLALLPRDSAMRTANGIEGEQLRKAKEDKERKK
Ga0182221_10878242	3300017442	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNHIEGEMLRKAKEDEERKKQRKL
Ga0182221_11185012	3300017442	Miscanthus Phyllosphere	MDHPMPLLRDSAVRVVNRAEGERLRKAKEDKKRKK
Ga0182221_11421763	3300017442	Miscanthus Phyllosphere	DHPALLPRDSSMRAANRTKGEQLRKAKEDKRKKRQ
Ga0182193_11354552	3300017443	Miscanthus Phyllosphere	MDHLASLPRDSAVRTVNRAEGEWLRKAREDKKRKKQLKL
Ga0182193_11746262	3300017443	Miscanthus Phyllosphere	MDHLAPLLRDSSMRVAIRTEGERLRKEKEDNRRKR
Ga0182193_11853241	3300017443	Miscanthus Phyllosphere	MDHPAPLLRDSTVRTVNRAKGEWLRKVNEDRKRKK
Ga0182233_10938432	3300017680	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKKRKKQWKLQARE
Ga0182218_10697512	3300017683	Miscanthus Phyllosphere	MDHLAPLPREPSGREANHAKAEQLRKAKEDKKRKK
Ga0182218_11449622	3300017683	Miscanthus Phyllosphere	MDHPAPLLRDSSMRVVNHAEGEWLRKAKEDKKRKR
Ga0182225_10841891	3300017684	Miscanthus Phyllosphere	TDQPMPLPWDLAVRTMNHAEDERLRRAKEDKKRKKQQKLQAWE
Ga0182225_11178961	3300017684	Miscanthus Phyllosphere	LMDHLAPLPRDSSMRTVNHAEGERMRKAKEDKRKKQQQKL
Ga0182227_10615321	3300017685	Miscanthus Phyllosphere	MDHPTPLPRYSAVRTANRAEGERLSKAKKDMKRKRQ
Ga0182227_11245931	3300017685	Miscanthus Phyllosphere	MDHLAPLLRDSSVRAANRAKGERLRKVKEDKRRKRQQKLQVHE
Ga0182205_10800131	3300017686	Miscanthus Phyllosphere	LMDHPTPLSRDSTMRTANHAKGERLRKAKEDRKRKK
Ga0182205_11256241	3300017686	Miscanthus Phyllosphere	MDHPALLLRDSSVRVANHVEGERLRKTKEDKKRKRQ
Ga0182205_11551711	3300017686	Miscanthus Phyllosphere	MDLILMDHPAPLLRDSSMRAVNHAKGEQLWKAKEDKRNKR
Ga0182223_10168531	3300017690	Miscanthus Phyllosphere	MDHLTPLLRDSAMRAANHAEGERLRKAKEDKKAKK
Ga0182223_10689161	3300017690	Miscanthus Phyllosphere	PRDLIFTDHPTLLPRDSSVRVANCAEGEWLRQVKEDKKRKRQRKL
Ga0182223_10745721	3300017690	Miscanthus Phyllosphere	MDHPTPLSRDSAVRVANRAKGERLRKAMEDKKRKRRRKL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F027701

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign