NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027782

Metagenome / Metatranscriptome Family F027782

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027782
Family Type Metagenome / Metatranscriptome
Number of Sequences 193
Average Sequence Length 45 residues
Representative Sequence MTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP
Number of Associated Samples 135
Number of Associated Scaffolds 193

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 48.70 %
% of genes near scaffold ends (potentially truncated) 99.48 %
% of genes from short scaffolds (< 2000 bps) 82.38 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (100.000 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(24.870 % of family members)
Environment Ontology (ENVO) Unclassified
(79.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(70.466 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.48%    β-sheet: 0.00%    Coil/Unstructured: 53.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 193 Family Scaffolds
PF09250Prim-Pol 9.33
PF12850Metallophos_2 2.59
PF03406Phage_fiber_2 1.55
PF03354TerL_ATPase 0.52
PF16778Phage_tail_APC 0.52
PF00145DNA_methylase 0.52
PF04586Peptidase_S78 0.52
PF05065Phage_capsid 0.52
PF09636XkdW 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 193 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.52
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 0.52
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 0.52
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002277|B570J29592_105399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300002294|B570J29584_1000401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4892Open in IMG/M
3300002296|B570J29587_1001526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2174Open in IMG/M
3300002408|B570J29032_109030615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300002408|B570J29032_109034203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300003488|JGI25919J51413_1014222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
3300004805|Ga0007792_10204612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300005517|Ga0070374_10082735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1673Open in IMG/M
3300005517|Ga0070374_10356359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300005517|Ga0070374_10678357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300005581|Ga0049081_10119533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage975Open in IMG/M
3300005582|Ga0049080_10063935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1264Open in IMG/M
3300005662|Ga0078894_10765852All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
3300006802|Ga0070749_10219867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1083Open in IMG/M
3300006805|Ga0075464_10198175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1192Open in IMG/M
3300006805|Ga0075464_10951949All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300007559|Ga0102828_1139304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300008114|Ga0114347_1195767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage677Open in IMG/M
3300008259|Ga0114841_1038826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6271Open in IMG/M
3300008263|Ga0114349_1029173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2759Open in IMG/M
3300008266|Ga0114363_1006474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6434Open in IMG/M
3300008266|Ga0114363_1105508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1475Open in IMG/M
3300008266|Ga0114363_1117319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage930Open in IMG/M
3300008266|Ga0114363_1126054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300008450|Ga0114880_1091072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1197Open in IMG/M
3300008450|Ga0114880_1095515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1159Open in IMG/M
3300008450|Ga0114880_1181627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300008450|Ga0114880_1274180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300009026|Ga0102829_1279590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300009068|Ga0114973_10439114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300009152|Ga0114980_10068881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2131Open in IMG/M
3300009152|Ga0114980_10096125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1773Open in IMG/M
3300009152|Ga0114980_10118761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1576Open in IMG/M
3300009154|Ga0114963_10038000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3141Open in IMG/M
3300009155|Ga0114968_10485069All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300009155|Ga0114968_10545387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300009155|Ga0114968_10564686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300009158|Ga0114977_10027968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3534Open in IMG/M
3300009158|Ga0114977_10393893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300009159|Ga0114978_10033756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3637Open in IMG/M
3300009159|Ga0114978_10081215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2169Open in IMG/M
3300009159|Ga0114978_10202028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1255Open in IMG/M
3300009159|Ga0114978_10501404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300009159|Ga0114978_10752127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300009163|Ga0114970_10463059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage696Open in IMG/M
3300009163|Ga0114970_10747178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300009164|Ga0114975_10541823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage624Open in IMG/M
3300009168|Ga0105104_10506805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300009180|Ga0114979_10144189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1459Open in IMG/M
3300009180|Ga0114979_10303437All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage948Open in IMG/M
3300009180|Ga0114979_10372416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300009181|Ga0114969_10715537All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300009183|Ga0114974_10048445All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2859Open in IMG/M
3300009183|Ga0114974_10449702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300009183|Ga0114974_10600979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300009184|Ga0114976_10179751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1173Open in IMG/M
3300010158|Ga0114960_10004832All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10000Open in IMG/M
3300010160|Ga0114967_10104602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1640Open in IMG/M
3300010354|Ga0129333_10167349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2011Open in IMG/M
3300010885|Ga0133913_11172605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1972Open in IMG/M
3300010885|Ga0133913_13107386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1102Open in IMG/M
3300010885|Ga0133913_13504233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1023Open in IMG/M
3300012725|Ga0157610_1211363All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300012772|Ga0138287_1298600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300013004|Ga0164293_10106167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2147Open in IMG/M
3300013005|Ga0164292_10994355All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300013014|Ga0164295_11307575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300013295|Ga0170791_15776310All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage654Open in IMG/M
3300013372|Ga0177922_10468965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage726Open in IMG/M
3300013372|Ga0177922_11308542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage739Open in IMG/M
3300015050|Ga0181338_1048820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage620Open in IMG/M
3300017701|Ga0181364_1026435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage945Open in IMG/M
3300017701|Ga0181364_1076768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300017716|Ga0181350_1026743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1599Open in IMG/M
3300017716|Ga0181350_1064898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage946Open in IMG/M
3300017722|Ga0181347_1132009All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300017723|Ga0181362_1048838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300017723|Ga0181362_1083745All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300017736|Ga0181365_1114176All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300017761|Ga0181356_1169762All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300017761|Ga0181356_1208406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300017774|Ga0181358_1098491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1050Open in IMG/M
3300017774|Ga0181358_1152401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage788Open in IMG/M
3300017777|Ga0181357_1214488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300017777|Ga0181357_1266840All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300017778|Ga0181349_1053399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1580Open in IMG/M
3300017780|Ga0181346_1296205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300017784|Ga0181348_1259064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300019784|Ga0181359_1041347All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1785Open in IMG/M
3300019784|Ga0181359_1088207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1153Open in IMG/M
3300019784|Ga0181359_1156215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300020159|Ga0211734_10677808All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300020161|Ga0211726_10164683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300020161|Ga0211726_10165384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2153Open in IMG/M
3300020183|Ga0194115_10362980All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300020501|Ga0208590_1017935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage833Open in IMG/M
3300020515|Ga0208234_1035072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300020537|Ga0208722_1050936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300020553|Ga0208855_1017327All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1092Open in IMG/M
3300020571|Ga0208723_1038657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300020573|Ga0208485_1016771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1549Open in IMG/M
3300021340|Ga0194041_10095593All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage926Open in IMG/M
3300021956|Ga0213922_1075247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300022179|Ga0181353_1081586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage816Open in IMG/M
3300022190|Ga0181354_1019826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2120Open in IMG/M
3300022190|Ga0181354_1038330All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1584Open in IMG/M
3300022190|Ga0181354_1067524All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1187Open in IMG/M
3300022190|Ga0181354_1182343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M
3300022407|Ga0181351_1073133All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1383Open in IMG/M
3300022407|Ga0181351_1108978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1057Open in IMG/M
3300022407|Ga0181351_1120482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage984Open in IMG/M
3300022407|Ga0181351_1259834All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300022752|Ga0214917_10350857All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300025646|Ga0208161_1076482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage981Open in IMG/M
3300025896|Ga0208916_10072774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1432Open in IMG/M
3300027135|Ga0255073_1037041All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage825Open in IMG/M
3300027138|Ga0255064_1037352All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300027139|Ga0255082_1033868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300027563|Ga0209552_1182608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300027581|Ga0209651_1024826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1869Open in IMG/M
3300027621|Ga0208951_1064606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1042Open in IMG/M
3300027644|Ga0209356_1070415All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1056Open in IMG/M
3300027659|Ga0208975_1049601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1292Open in IMG/M
3300027679|Ga0209769_1143983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage756Open in IMG/M
3300027733|Ga0209297_1016560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3539Open in IMG/M
3300027741|Ga0209085_1003419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8718Open in IMG/M
3300027746|Ga0209597_1124737All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1130Open in IMG/M
3300027759|Ga0209296_1004767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8817Open in IMG/M
3300027782|Ga0209500_10176512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage983Open in IMG/M
3300027785|Ga0209246_10214479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage750Open in IMG/M
3300027785|Ga0209246_10334126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300027797|Ga0209107_10115307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1417Open in IMG/M
3300027798|Ga0209353_10048037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1965Open in IMG/M
3300027798|Ga0209353_10072677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1564Open in IMG/M
3300027798|Ga0209353_10106036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1267Open in IMG/M
3300027798|Ga0209353_10457966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300027804|Ga0209358_10176008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1125Open in IMG/M
3300027808|Ga0209354_10027210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2283Open in IMG/M
3300027892|Ga0209550_10254983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1156Open in IMG/M
3300027971|Ga0209401_1050676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1884Open in IMG/M
3300027972|Ga0209079_10047615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1445Open in IMG/M
3300027974|Ga0209299_1016955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3345Open in IMG/M
(restricted) 3300027977|Ga0247834_1030600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3416Open in IMG/M
3300028025|Ga0247723_1050449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1193Open in IMG/M
3300028392|Ga0304729_1087113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1086Open in IMG/M
(restricted) 3300028559|Ga0247831_1286538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
(restricted) 3300029268|Ga0247842_10125540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1525Open in IMG/M
3300031707|Ga0315291_10601898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage997Open in IMG/M
3300031772|Ga0315288_10686734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage968Open in IMG/M
3300031787|Ga0315900_10009619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12223Open in IMG/M
3300031787|Ga0315900_10048602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4498Open in IMG/M
3300031857|Ga0315909_10007375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12285Open in IMG/M
3300031857|Ga0315909_10066942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3233Open in IMG/M
3300031857|Ga0315909_10140095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2011Open in IMG/M
3300031951|Ga0315904_10172754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2158Open in IMG/M
3300031951|Ga0315904_10187535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2045Open in IMG/M
3300031951|Ga0315904_10969239All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300031963|Ga0315901_10167423All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1939Open in IMG/M
3300032093|Ga0315902_10070421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3915Open in IMG/M
3300032116|Ga0315903_10522608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300033816|Ga0334980_0296231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300033981|Ga0334982_0132421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1285Open in IMG/M
3300033992|Ga0334992_0072538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1893Open in IMG/M
3300033993|Ga0334994_0587016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300033995|Ga0335003_0238020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage849Open in IMG/M
3300034021|Ga0335004_0635697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300034061|Ga0334987_0214619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1341Open in IMG/M
3300034061|Ga0334987_0335434All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage985Open in IMG/M
3300034062|Ga0334995_0668049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300034066|Ga0335019_0380753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage867Open in IMG/M
3300034072|Ga0310127_094247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1309Open in IMG/M
3300034082|Ga0335020_0081374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1664Open in IMG/M
3300034092|Ga0335010_0077059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2288Open in IMG/M
3300034092|Ga0335010_0108774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1829Open in IMG/M
3300034092|Ga0335010_0294215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage935Open in IMG/M
3300034095|Ga0335022_0369934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage785Open in IMG/M
3300034101|Ga0335027_0452034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage818Open in IMG/M
3300034101|Ga0335027_0549359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300034101|Ga0335027_0622801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300034104|Ga0335031_0842128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300034106|Ga0335036_0005470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10714Open in IMG/M
3300034106|Ga0335036_0125274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1857Open in IMG/M
3300034109|Ga0335051_0128998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1300Open in IMG/M
3300034111|Ga0335063_0457315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300034118|Ga0335053_0444629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300034120|Ga0335056_0169021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1284Open in IMG/M
3300034120|Ga0335056_0381099All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300034122|Ga0335060_0594939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300034166|Ga0335016_0377325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage837Open in IMG/M
3300034200|Ga0335065_0773287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300034283|Ga0335007_0698670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300034284|Ga0335013_0018045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5307Open in IMG/M
3300034356|Ga0335048_0055742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2528Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake24.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater20.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake20.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.63%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.59%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.59%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.07%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.04%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.04%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.04%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.52%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.52%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.52%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.52%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.52%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002277Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002294Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002296Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003488Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DNEnvironmentalOpen in IMG/M
3300004805Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6MEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012772Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020501Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020515Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020537Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020573Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021340Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027135Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300027138Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027139Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300029268 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19mEnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29592_10539913300002277FreshwaterMKSLIMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDF
B570J29584_100040113300002294FreshwaterMKSLTMTKTEQLLDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITP
B570J29587_100152613300002296FreshwaterMKSLTMTKTEQLLDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLD
B570J29032_10903061513300002408FreshwaterMTTTSEQLFDHVTETIHQRGAKYGHPYPQHKRIAELWS
B570J29032_10903420323300002408FreshwaterMKSLIMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP
JGI25919J51413_101422213300003488Freshwater LakeMSTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYL
Ga0007792_1020461213300004805FreshwaterMPTTTEKLFDEVVSTIQERGAVYGHPAINHKRIADLWSAYLDY
Ga0070374_1008273513300005517Freshwater LakeMSTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPNEAA
Ga0070374_1035635913300005517Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYP
Ga0070374_1067835733300005517Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQ
Ga0049081_1011953333300005581Freshwater LenticMTNTEKLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQP
Ga0049080_1006393513300005582Freshwater LenticMKFLIMTKTEQLFANVIDTIHSRGANYGHPIGNHKRIAELWSAYLGYPIQPN
Ga0078894_1076585233300005662Freshwater LakeMTTTTEKLFNDIASIIHERGAIYGHPYYNHKRISELWSAYL
Ga0070749_1021986733300006802AqueousMPTTTEQLLDNVVKTIHARGLNYGHPITNHKRIAELW
Ga0075464_1019817513300006805AqueousMPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWSAYLDYPIQPHQAALC
Ga0075464_1095194923300006805AqueousMPSEIKYLTMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAAL
Ga0102828_113930433300007559EstuarineMSTTTEKLFDNVIKTIHARGISYGHPITNHKRIAELWSAYIGYPIQPNE
Ga0114347_119576713300008114Freshwater, PlanktonMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPIT
Ga0114841_103882673300008259Freshwater, PlanktonMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA*
Ga0114349_102917313300008263Freshwater, PlanktonMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDFPIT
Ga0114363_100647413300008266Freshwater, PlanktonMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDYPI
Ga0114363_110550813300008266Freshwater, PlanktonMTKTEQLFANVIDTLHRRGANYGHPIANHKRIAELWS
Ga0114363_111731913300008266Freshwater, PlanktonMTKTEQLFDEAITTIQSRGVVYGHPYYNMERISKL
Ga0114363_112605413300008266Freshwater, PlanktonMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDYPITPHQAA
Ga0114880_109107233300008450Freshwater LakeMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLW
Ga0114880_109551543300008450Freshwater LakeMTKTEDLLNEVISTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA
Ga0114880_118162733300008450Freshwater LakeMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDYPIT
Ga0114880_127418013300008450Freshwater LakeMTTTSEQLFDHVTETIHQRGAKYGHPYPQHKRIAELWSAY
Ga0102829_127959013300009026EstuarineMTKTEQLFEEVIQILHSRGSQYGHPIGNHKRIAELWSAYLGYPIQPNEVAIL
Ga0114973_1043911433300009068Freshwater LakeMSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPN
Ga0114980_1006888113300009152Freshwater LakeMSTTTEKLFDNVIKTIHARGVSYGHPISQHKRIAELWSAYLGYP
Ga0114980_1009612513300009152Freshwater LakeMPTTTEKLFANVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVA
Ga0114980_1011876153300009152Freshwater LakeMSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVA
Ga0114963_1003800093300009154Freshwater LakeMPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWSAYL
Ga0114968_1048506913300009155Freshwater LakeMTTTTEQLFDNVIKTIHARGVSYGHPITNHKRIAE
Ga0114968_1054538713300009155Freshwater LakeMPTTTEKLFDNVIKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVAIC
Ga0114968_1056468633300009155Freshwater LakeMPTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNE
Ga0114977_1002796813300009158Freshwater LakeMTKTEQLFNEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA
Ga0114977_1039389333300009158Freshwater LakeMSTTTEKLFDNVIKTIHARGVRYGHPITNHKRIAELWSAYLGYPIQPN
Ga0114978_10033756103300009159Freshwater LakeMSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWS
Ga0114978_1008121513300009159Freshwater LakeMTRTEQLFAHVIETLHSRGAHYGHPIGNHKRIAELWSAYLGYPIQPNEVAICM
Ga0114978_1020202833300009159Freshwater LakeMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ
Ga0114978_1050140413300009159Freshwater LakeMTRTEKLFEQVIDTLHSRGADYGHPITNHKRIAELWSA
Ga0114978_1075212713300009159Freshwater LakeMPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEV
Ga0114970_1046305933300009163Freshwater LakeMSTTTEQLFDNVIKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVAIC
Ga0114970_1074717823300009163Freshwater LakeMPTTTEKLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVAIC
Ga0114975_1054182313300009164Freshwater LakeMPTSTEKLFANVIDTLHSRGADYGHPIGNHKRIAELWSAYL
Ga0105104_1050680533300009168Freshwater SedimentMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDY
Ga0114979_1014418913300009180Freshwater LakeMTKTEQLFNEVITTIQQRGSVYGHPYYNHKRIAGLWSAY
Ga0114979_1030343743300009180Freshwater LakeMPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQ
Ga0114979_1037241613300009180Freshwater LakeMPTTTEKLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPN
Ga0114969_1071553713300009181Freshwater LakeMPTTTEQLFSETVEILHSRGTQYGHPISNHKRIAELWSAYLGYPIQPN
Ga0114974_1004844513300009183Freshwater LakeMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWS
Ga0114974_1044970233300009183Freshwater LakeMSTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYP
Ga0114974_1060097913300009183Freshwater LakeMTKTEKLLADVVDLVHTRGSVYGHPYTNHKRISDLWSAYLDHPITPSQV
Ga0114976_1017975113300009184Freshwater LakeMPTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPN
Ga0114960_10004832223300010158Freshwater LakeMPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWS
Ga0114967_1010460253300010160Freshwater LakeMPTTTEKLFDEVIDILHSRGTQYGHPISNHKRIAELWSAYLGYPIQPN
Ga0129333_1016734963300010354Freshwater To Marine Saline GradientMTKTEQLFANVIDTLHRRGADYGHPIGNHKRIAELWSAYLGYPIQPNE
Ga0133913_1117260513300010885Freshwater LakeMPTNTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA
Ga0133913_1310738633300010885Freshwater LakeMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAAL
Ga0133913_1350423313300010885Freshwater LakeMTKTEQLLDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ
Ga0157610_121136313300012725FreshwaterMTKTEDLLNEVIATIQDRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ
Ga0138287_129860033300012772Freshwater LakeMPTNTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA
Ga0164293_1010616773300013004FreshwaterMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ
Ga0164292_1099435533300013005FreshwaterMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA
Ga0164295_1130757513300013014FreshwaterMSTTTEQLFNNVIKTIHERGISYGHPITNHKRIAELWSAYLG
Ga0170791_1577631013300013295FreshwaterMTKTETLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPIT
Ga0177922_1046896513300013372FreshwaterMSTTTEQLFDNVIKTIHERGISYGHPITNHKRIAELWSAYLGYPIQPNEV
Ga0177922_1130854213300013372FreshwaterMTKTEDLLNEVITTIQERGSVYGHPYYNHQRIAGLWSAYLDHPITAHQAALC
Ga0181338_104882013300015050Freshwater LakeMTKTEKLFDEVVKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPNQL
Ga0181364_102643543300017701Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAEFFS
Ga0181364_107676813300017701Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPNQ
Ga0181350_102674313300017716Freshwater LakeMANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYP
Ga0181350_106489843300017716Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYTGYPL
Ga0181347_113200913300017722Freshwater LakeMSTTTEKLFDNVVKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQ
Ga0181362_104883833300017723Freshwater LakeMRYLTMTKTEKLFDEVIKTIHSRGESYGHPYYNHK
Ga0181362_108374513300017723Freshwater LakeMANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYL
Ga0181365_111417633300017736Freshwater LakeMPTTTEKLFDEVVSILHSRGTQYGHPISNHKRIAELWSLQIG
Ga0181356_116976233300017761Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQP
Ga0181356_120840613300017761Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIG
Ga0181358_109849113300017774Freshwater LakeMTKTEQLFEEVIQILHSRGSQYGHPIGNHKRIAELWSAYLGYPIQ
Ga0181358_115240133300017774Freshwater LakeMSTTTEKLFDNVIKTIHARGVRYGHPITNHKRIAELWSAYLGYPI
Ga0181357_121448813300017777Freshwater LakeMTKTEKLFDEVVKTIHARGQTYGHPYYNHKRIAEL
Ga0181357_126684013300017777Freshwater LakeMSTTTEKLFNNVVKTIHARGVSYGHPITNHKRIAELWSAYLG
Ga0181349_105339913300017778Freshwater LakeMANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPNEVAIC
Ga0181346_129620533300017780Freshwater LakeMQKLNPMKYLIMTNTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWS
Ga0181348_125906413300017784Freshwater LakeMSTTTEQLFNNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPI
Ga0181359_104134713300019784Freshwater LakeMAKLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPND
Ga0181359_108820713300019784Freshwater LakeMANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPN
Ga0181359_115621513300019784Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPNQVA
Ga0211734_1067780813300020159FreshwaterMPSEIKYLIMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSA
Ga0211726_1016468313300020161FreshwaterMPSEIKYLIMTKTETLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSA
Ga0211726_1016538473300020161FreshwaterMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSA
Ga0194115_1036298023300020183Freshwater LakeMKYLIMTKTSKLFDDVTQLIHQRGTQYGHPISNHKRIAELWTAYLGFPIQPNEVAIC
Ga0208590_101793543300020501FreshwaterMTKTEKLFDEAITTIQSRGVVYGHPYYNMERISKLVSSY
Ga0208234_103507213300020515FreshwaterMTRTEKLFANVIETLHSRGAHYGHPIENHKRIAELWSAYLGYPIQPNEVAIC
Ga0208722_105093633300020537FreshwaterMTKTEQLFDEVIQILHSRGSQYGHPIGNHKRIAELWSAYLGYPIQPNE
Ga0208855_101732713300020553FreshwaterMTTTTEKLFDNVIKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQ
Ga0208723_103865713300020571FreshwaterMTKTEDLLNEVISTIQERGSVYGHPYYNHKRIAGL
Ga0208485_101677113300020573FreshwaterMTKTEQLLDDVITTIQQRGNVYGHPYYNHKRIAGLWSAYLDFPITPHQAALC
Ga0194041_1009559313300021340Anoxic Zone FreshwaterMPTTTEKLFDEVISTIHERGAIYGHPAINHKRIADLWSAYLDYPI
Ga0213922_107524713300021956FreshwaterMPTTTEKLFDEVVSIIHQRGENYGHPFSQHKRIAELWSAYL
Ga0181353_108158613300022179Freshwater LakeMKCLIMKSTTEALFDEVITTLQQRGSVYGHPFYNHKRIAGLWS
Ga0181354_101982673300022190Freshwater LakeMTKTEKLFDDVIKTIHARGESYGHPYYNHKRIAELWSA
Ga0181354_103833053300022190Freshwater LakeMSTTTEKLFDNVVKTIHARGVSYGHPITNHKRIAEL
Ga0181354_106752443300022190Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYTGYP
Ga0181354_118234323300022190Freshwater LakeMSTTTEKLFNNVVKTIHARGVSYGHPITNHKRIAELW
Ga0181351_107313313300022407Freshwater LakeMSTTTEKLFNNVVKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPN
Ga0181351_110897813300022407Freshwater LakeMTTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPNEAAICMA
Ga0181351_112048243300022407Freshwater LakeMANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPNEVAICM
Ga0181351_125983413300022407Freshwater LakeMSTTTEKLFDNVVKTIHARGVSYGHPITNHKRIAELWSAYLGYPIQPN
Ga0214917_1035085713300022752FreshwaterMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITP
Ga0208161_107648233300025646AqueousMTKTEDLLNEVISTIQQRGSVYGHPYYNHKRIAGLWS
Ga0208916_1007277453300025896AqueousMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP
Ga0255073_103704133300027135FreshwaterMTTTTEQLFDNVIKTIHERGVSYGHPITNHKRIAELWSAY
Ga0255064_103735233300027138FreshwaterMTRTEQLFANVIDTLHSRGSDYGHPIGNHKRIAELW
Ga0255082_103386813300027139FreshwaterMTTTTEQLFDNVIKTIHERGVSYGHPITNHKRIAELWSAYIGYPIQPN
Ga0209552_118260823300027563Freshwater LakeMTKTEKLFDEVVKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPN
Ga0209651_102482663300027581Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPL
Ga0208951_106460643300027621Freshwater LenticMANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLGY
Ga0209356_107041533300027644Freshwater LakeMTKTEKLFDEVVKTIHSRGESYGHPYYNHKRIAELWS
Ga0208975_104960113300027659Freshwater LenticMTNTEKLFDNVIKTIHERGVRYGHPITNHKRIAELWSAY
Ga0209769_114398333300027679Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAYIGYPLQPNQVAM
Ga0209297_101656013300027733Freshwater LakeMTKTEQLFNEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA
Ga0209085_100341913300027741Freshwater LakeMPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWSAYLD
Ga0209597_112473743300027746Freshwater LakeMPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNEVA
Ga0209296_1004767173300027759Freshwater LakeMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPH
Ga0209500_1017651213300027782Freshwater LakeMPSEIKYLIMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP
Ga0209246_1021447913300027785Freshwater LakeMPTTTEQLLDNVVKTIHARGLNYGHPITNHKRIAELWSAYLGYPIQ
Ga0209246_1033412633300027785Freshwater LakeMPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPI
Ga0209107_1011530713300027797Freshwater And SedimentMTKTEQLLDDVITTIQQRGNVYGHPYYNHKRIAGLWS
Ga0209353_1004803713300027798Freshwater LakeMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELW
Ga0209353_1007267713300027798Freshwater LakeMANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYLG
Ga0209353_1010603643300027798Freshwater LakeMPTTTEQLLDNVVKTIHARGLNYGHPITNHKRIAELWSAYLGYPIQPNEVA
Ga0209353_1045796613300027798Freshwater LakeMTKTEKLFDEVIKTIHSRGESYGHPYYNHKRIAELWSAYTGYPLQP
Ga0209358_1017600833300027804Freshwater LakeMTKTEQLLNDVITTIQQRGNVYGHPYYNHKRIAGLWSAYLDFPITPHQAA
Ga0209354_1002721013300027808Freshwater LakeMANLMSTTTEKLFDNVIKTIHARGVSYGHPITNHKRIA
Ga0209550_1025498343300027892Freshwater LakeMTKTEQLLDEVITTIQQRGSVYGHPFYNHKRIAGLWSAYLDFPITP
Ga0209401_105067613300027971Freshwater LakeMSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQPNE
Ga0209079_1004761543300027972Freshwater SedimentMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA
Ga0209299_101695513300027974Freshwater LakeMSTTTEQLFDNVVKTIHARGVSYGHPISQHKRIAELWSAYLGYPIQP
(restricted) Ga0247834_103060013300027977FreshwaterMTKTETLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFP
Ga0247723_105044943300028025Deep Subsurface SedimentMKSTTEALFDEVITTLQQRGSVYGHPFYNHKRIAG
Ga0304729_108711333300028392Freshwater LakeMPTTTEKLFSEVISTIQERGAVYGHPAINHKRIADLWSAYLDYPIQPH
(restricted) Ga0247831_128653833300028559FreshwaterMSTTTEKLFENVVKTIHARGINYGHPITNHKRIAELWSAYLGYPIQPNEVAI
(restricted) Ga0247842_1012554053300029268FreshwaterMTKTEKLFDEVIKTIHARGESYGHPYYNHKRIAELWSAY
Ga0315291_1060189813300031707SedimentMTTTTESLFDNVIKTIHARGVSYGHPITNHKRIAEL
Ga0315288_1068673433300031772SedimentMTTTTESLFDNVIKTIHARGVSYGHPITNHKRIAELWSAYIGY
Ga0315900_1000961913300031787FreshwaterMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYL
Ga0315900_1004860213300031787FreshwaterMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDYPITPHQ
Ga0315909_10007375193300031857FreshwaterMKKTEDLLNEVITTIQDRGRIYGHPYYNHKRIAQLWSAYL
Ga0315909_1006694213300031857FreshwaterMTKTEQLLDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYL
Ga0315909_1014009513300031857FreshwaterMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ
Ga0315904_1017275473300031951FreshwaterMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYL
Ga0315904_1018753573300031951FreshwaterMKSLIMTKTEQLFANVIDTLHRRGANYGHPIANHKRIAELWSAYLGY
Ga0315904_1096923913300031951FreshwaterMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITP
Ga0315901_1016742363300031963FreshwaterMTKTEQLFANVIDTLHRRGANYGHPIANHKRIAELWSAYLGY
Ga0315902_1007042113300032093FreshwaterMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDYPITPHQAALC
Ga0315903_1052260843300032116FreshwaterMRSLTMTKTEQLFANVIDTLHRRGANYGHPIANHKRIAELWSAYLGY
Ga0334980_0296231_3_1163300033816FreshwaterMKSLIMTKTEQLFDEAITTIQSRGVVYGHPYYNMERIS
Ga0334982_0132421_1_1473300033981FreshwaterMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA
Ga0334992_0072538_1737_18923300033992FreshwaterMTKTEQLFANVIEILHKRGADYGHPIGNHKRIAELWSAYLGYPIQANEVAIL
Ga0334994_0587016_360_5003300033993FreshwaterMKYLIMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWTAYLDF
Ga0335003_0238020_2_1483300033995FreshwaterMPTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPNE
Ga0335004_0635697_405_5603300034021FreshwaterMPTTTEQLLDNVVKTIHARGLNYGHPITNHKRIAELWSAYLGYPIQPNEVAV
Ga0334987_0214619_3_1583300034061FreshwaterMKSTTEALFDEVITTLQQRGSVYGHPFYNHKRIAGLWSAYLDFPITPHQAAL
Ga0334987_0335434_872_9853300034061FreshwaterMTKTEQLLDDVITTIQQRGSVYGHPYYNHKRIAGLWSA
Ga0334995_0668049_443_5893300034062FreshwaterMTKTEQLLDDVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA
Ga0335019_0380753_708_8663300034066FreshwaterMPTTTEQLLDNVVKTIHARGINYGHPITNHKRIAELWSAYLGYPIQPNEVAVC
Ga0310127_094247_1160_13093300034072Fracking WaterMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDFPITPHQAA
Ga0335020_0081374_1544_16633300034082FreshwaterMPTTTEQLLDNVVKTIHARGVSYGHPISQHKRIAELWSAY
Ga0335010_0077059_2164_22863300034092FreshwaterMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLD
Ga0335010_0108774_3_1193300034092FreshwaterMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAY
Ga0335010_0294215_2_1303300034092FreshwaterMTKTEQLFANVIDTIHSRGANYGHPIGNHKRIAELWSAYLGYP
Ga0335022_0369934_637_7833300034095FreshwaterMTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPNE
Ga0335027_0452034_3_1493300034101FreshwaterMIKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDMPITPHQA
Ga0335027_0549359_2_1243300034101FreshwaterMKSLIMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLW
Ga0335027_0622801_542_6523300034101FreshwaterMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWS
Ga0335031_0842128_355_5073300034104FreshwaterMIKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGLWSAYLDMPITPHQAAL
Ga0335036_0005470_2_1243300034106FreshwaterMTKTEDLLNEVITTIQQRGSVYGHPYYNHQRIAGLWSAYLD
Ga0335036_0125274_3_1073300034106FreshwaterMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGL
Ga0335051_0128998_1168_12993300034109FreshwaterMTKTEDLLNEVIATIQERGSVYGHPYYNHKRIAGLWSAYLDFPI
Ga0335063_0457315_3_1073300034111FreshwaterMTKTEDLLNEVITTIQERGSVYGHPYYNHKRIAGL
Ga0335053_0444629_665_7753300034118FreshwaterMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWS
Ga0335056_0169021_1139_12823300034120FreshwaterMTKTEQLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ
Ga0335056_0381099_2_1093300034120FreshwaterMTNTEKLFNNVIKTIHERGVRYGHPITNHKRIAELW
Ga0335060_0594939_3_1223300034122FreshwaterMTKTEQLLDDVITTIQQRGNVYGHPYYNHKRIAGLWSAYL
Ga0335016_0377325_1_1593300034166FreshwaterMKFLIMTKTEHLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQ
Ga0335065_0773287_3_1523300034200FreshwaterMPNEIKYLTMTKTESLFDEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLD
Ga0335007_0698670_3_1613300034283FreshwaterMTTTEQLFDNVIKTIHERGVRYGHPITNHKRIAELWSAYLGYPIQPNEAAIC
Ga0335013_0018045_1_1353300034284FreshwaterMTKTEDLLNEVIATIQDRGSVYGHPYYNHKRIAGLWSAYLDFPIT
Ga0335048_0055742_1_1443300034356FreshwaterMPTTTEKLFDNVIKIIHDRGVRYGHPITNHKRIAELWSAYLGYPIQPN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.