Basic Information | |
---|---|
Family ID | F027847 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 193 |
Average Sequence Length | 40 residues |
Representative Sequence | MNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFILGA |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 193 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 82.90 % |
% of genes near scaffold ends (potentially truncated) | 16.58 % |
% of genes from short scaffolds (< 2000 bps) | 68.91 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (46.114 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (14.508 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.440 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.658 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 193 Family Scaffolds |
---|---|---|
PF03237 | Terminase_6N | 5.70 |
PF06067 | DUF932 | 3.11 |
PF12957 | DUF3846 | 2.59 |
PF13640 | 2OG-FeII_Oxy_3 | 1.55 |
PF01464 | SLT | 1.55 |
PF01555 | N6_N4_Mtase | 1.04 |
PF02945 | Endonuclease_7 | 1.04 |
PF01471 | PG_binding_1 | 1.04 |
PF01391 | Collagen | 1.04 |
PF07728 | AAA_5 | 0.52 |
PF13392 | HNH_3 | 0.52 |
PF13828 | DUF4190 | 0.52 |
PF00850 | Hist_deacetyl | 0.52 |
PF02086 | MethyltransfD12 | 0.52 |
PF01521 | Fe-S_biosyn | 0.52 |
PF04488 | Gly_transf_sug | 0.52 |
PF02675 | AdoMet_dc | 0.52 |
PF07553 | Lipoprotein_Ltp | 0.52 |
PF04586 | Peptidase_S78 | 0.52 |
PF01370 | Epimerase | 0.52 |
PF07098 | DUF1360 | 0.52 |
COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
---|---|---|---|
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.04 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.04 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.04 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.04 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.52 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.52 |
COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.52 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.52 |
COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.61 % |
Unclassified | root | N/A | 25.39 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352005|2200032659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300000736|JGI12547J11936_1050580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
3300000736|JGI12547J11936_1056155 | Not Available | 782 | Open in IMG/M |
3300000756|JGI12421J11937_10006097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4743 | Open in IMG/M |
3300000756|JGI12421J11937_10010780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3509 | Open in IMG/M |
3300000756|JGI12421J11937_10011787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 3342 | Open in IMG/M |
3300000756|JGI12421J11937_10022660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2305 | Open in IMG/M |
3300000756|JGI12421J11937_10053241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1300 | Open in IMG/M |
3300000882|FwDRAFT_10185244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300000928|OpTDRAFT_10405246 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 846 | Open in IMG/M |
3300001275|B570J13894_1016769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300001282|B570J14230_10048762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1414 | Open in IMG/M |
3300002372|B570J29634_100931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1260 | Open in IMG/M |
3300002835|B570J40625_100047441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 6208 | Open in IMG/M |
3300002835|B570J40625_100167134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 2465 | Open in IMG/M |
3300002835|B570J40625_100459878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1211 | Open in IMG/M |
3300002835|B570J40625_100467548 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
3300002835|B570J40625_100472109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1189 | Open in IMG/M |
3300003413|JGI25922J50271_10055750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300003490|JGI25926J51410_1021301 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
3300004112|Ga0065166_10418540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300005517|Ga0070374_10002930 | Not Available | 7688 | Open in IMG/M |
3300005517|Ga0070374_10173264 | Not Available | 1116 | Open in IMG/M |
3300005517|Ga0070374_10284327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300005517|Ga0070374_10292726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300005517|Ga0070374_10488774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300005527|Ga0068876_10091139 | Not Available | 1824 | Open in IMG/M |
3300005580|Ga0049083_10043295 | All Organisms → Viruses → Predicted Viral | 1597 | Open in IMG/M |
3300005581|Ga0049081_10258472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300005583|Ga0049085_10000720 | Not Available | 12940 | Open in IMG/M |
3300005584|Ga0049082_10008425 | Not Available | 3459 | Open in IMG/M |
3300005662|Ga0078894_10101232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2544 | Open in IMG/M |
3300005662|Ga0078894_10468880 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
3300005662|Ga0078894_10964705 | Not Available | 736 | Open in IMG/M |
3300005941|Ga0070743_10058591 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
3300005941|Ga0070743_10116075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
3300006484|Ga0070744_10028055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1667 | Open in IMG/M |
3300006484|Ga0070744_10038279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1415 | Open in IMG/M |
3300006484|Ga0070744_10049568 | Not Available | 1232 | Open in IMG/M |
3300006484|Ga0070744_10122922 | Not Available | 748 | Open in IMG/M |
3300006484|Ga0070744_10135580 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 708 | Open in IMG/M |
3300006641|Ga0075471_10001987 | Not Available | 13579 | Open in IMG/M |
3300006805|Ga0075464_10686017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300007162|Ga0079300_10071449 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
3300007544|Ga0102861_1160711 | Not Available | 611 | Open in IMG/M |
3300007549|Ga0102879_1061963 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1187 | Open in IMG/M |
3300007551|Ga0102881_1176064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300007559|Ga0102828_1130885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300007600|Ga0102920_1029059 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
3300007603|Ga0102921_1257475 | Not Available | 624 | Open in IMG/M |
3300007622|Ga0102863_1005175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 3489 | Open in IMG/M |
3300007625|Ga0102870_1144431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300007636|Ga0102856_1093539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300007639|Ga0102865_1117949 | Not Available | 794 | Open in IMG/M |
3300007670|Ga0102862_1029456 | Not Available | 1294 | Open in IMG/M |
3300007708|Ga0102859_1128878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300007708|Ga0102859_1189554 | Not Available | 610 | Open in IMG/M |
3300007716|Ga0102867_1040917 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
3300007973|Ga0105746_1356246 | Not Available | 511 | Open in IMG/M |
3300007974|Ga0105747_1259912 | Not Available | 582 | Open in IMG/M |
3300007992|Ga0105748_10091559 | Not Available | 1209 | Open in IMG/M |
3300008107|Ga0114340_1000035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 108590 | Open in IMG/M |
3300008107|Ga0114340_1003613 | Not Available | 8585 | Open in IMG/M |
3300008107|Ga0114340_1059553 | Not Available | 2697 | Open in IMG/M |
3300008110|Ga0114343_1191394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300008116|Ga0114350_1154479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300008261|Ga0114336_1010042 | Not Available | 9449 | Open in IMG/M |
3300008962|Ga0104242_1062180 | Not Available | 625 | Open in IMG/M |
3300008962|Ga0104242_1081372 | Not Available | 538 | Open in IMG/M |
3300008964|Ga0102889_1070974 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
3300009026|Ga0102829_1066386 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
3300009026|Ga0102829_1196950 | Not Available | 653 | Open in IMG/M |
3300009086|Ga0102812_10779858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300009152|Ga0114980_10000403 | Not Available | 31360 | Open in IMG/M |
3300009152|Ga0114980_10014313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 5034 | Open in IMG/M |
3300009152|Ga0114980_10018739 | All Organisms → Viruses → Predicted Viral | 4345 | Open in IMG/M |
3300009152|Ga0114980_10079504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1967 | Open in IMG/M |
3300009152|Ga0114980_10127278 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1515 | Open in IMG/M |
3300009155|Ga0114968_10010812 | Not Available | 6548 | Open in IMG/M |
3300009155|Ga0114968_10125847 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1543 | Open in IMG/M |
3300009158|Ga0114977_10204770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
3300009158|Ga0114977_10542511 | Not Available | 633 | Open in IMG/M |
3300009158|Ga0114977_10602294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300009159|Ga0114978_10191783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1295 | Open in IMG/M |
3300009161|Ga0114966_10080447 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 2228 | Open in IMG/M |
3300009161|Ga0114966_10694458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300009180|Ga0114979_10770228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300009183|Ga0114974_10062789 | Not Available | 2457 | Open in IMG/M |
3300009183|Ga0114974_10325469 | Not Available | 897 | Open in IMG/M |
3300009183|Ga0114974_10613869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300009183|Ga0114974_10684944 | Not Available | 558 | Open in IMG/M |
3300009183|Ga0114974_10688436 | Not Available | 556 | Open in IMG/M |
3300009419|Ga0114982_1027253 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1869 | Open in IMG/M |
3300009419|Ga0114982_1034617 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1631 | Open in IMG/M |
3300009419|Ga0114982_1280142 | Not Available | 522 | Open in IMG/M |
3300010885|Ga0133913_10885870 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 2318 | Open in IMG/M |
3300010885|Ga0133913_13287089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1064 | Open in IMG/M |
3300011268|Ga0151620_1000125 | Not Available | 27929 | Open in IMG/M |
3300011268|Ga0151620_1062344 | All Organisms → Viruses → Predicted Viral | 1212 | Open in IMG/M |
3300012665|Ga0157210_1000240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26565 | Open in IMG/M |
3300013004|Ga0164293_10019977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5595 | Open in IMG/M |
3300013004|Ga0164293_10040955 | Not Available | 3790 | Open in IMG/M |
3300013005|Ga0164292_10045122 | Not Available | 3492 | Open in IMG/M |
3300013005|Ga0164292_10264792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1190 | Open in IMG/M |
3300013014|Ga0164295_10134753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1834 | Open in IMG/M |
3300013372|Ga0177922_10477451 | All Organisms → Viruses → Predicted Viral | 4559 | Open in IMG/M |
3300017722|Ga0181347_1072442 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
3300017761|Ga0181356_1227465 | Not Available | 540 | Open in IMG/M |
3300019784|Ga0181359_1019750 | Not Available | 2541 | Open in IMG/M |
3300019784|Ga0181359_1061571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1436 | Open in IMG/M |
3300020141|Ga0211732_1290514 | Not Available | 8740 | Open in IMG/M |
3300020141|Ga0211732_1370100 | All Organisms → Viruses → Predicted Viral | 1475 | Open in IMG/M |
3300020151|Ga0211736_10463593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2059 | Open in IMG/M |
3300020151|Ga0211736_10575077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3706 | Open in IMG/M |
3300020151|Ga0211736_10765884 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 745 | Open in IMG/M |
3300020159|Ga0211734_10481503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300020159|Ga0211734_10649806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4607 | Open in IMG/M |
3300020160|Ga0211733_10759396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300020161|Ga0211726_10208115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3282 | Open in IMG/M |
3300020161|Ga0211726_10878105 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 552 | Open in IMG/M |
3300020162|Ga0211735_11526727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2144 | Open in IMG/M |
3300020172|Ga0211729_10681528 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 573 | Open in IMG/M |
3300020482|Ga0208464_101184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1875 | Open in IMG/M |
3300020492|Ga0208483_1006567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1524 | Open in IMG/M |
3300020498|Ga0208050_1015582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300020525|Ga0207938_1044497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300020527|Ga0208232_1002826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3037 | Open in IMG/M |
3300020533|Ga0208364_1018026 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
3300020553|Ga0208855_1034870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300020553|Ga0208855_1052749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300020554|Ga0208599_1018696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
3300020566|Ga0208222_1015627 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
3300020572|Ga0207909_1002115 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 4980 | Open in IMG/M |
3300020572|Ga0207909_1051676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300020572|Ga0207909_1068378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300021141|Ga0214163_1055547 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
3300021519|Ga0194048_10011809 | All Organisms → Viruses → Predicted Viral | 3955 | Open in IMG/M |
3300021961|Ga0222714_10480798 | Not Available | 641 | Open in IMG/M |
3300021962|Ga0222713_10085948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2286 | Open in IMG/M |
3300021963|Ga0222712_10115453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1856 | Open in IMG/M |
3300021963|Ga0222712_10243041 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1156 | Open in IMG/M |
3300022543|Ga0212119_1060649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300023174|Ga0214921_10456044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 628 | Open in IMG/M |
3300024343|Ga0244777_10011577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 5598 | Open in IMG/M |
3300024346|Ga0244775_10014843 | Not Available | 7250 | Open in IMG/M |
3300024346|Ga0244775_10127566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2154 | Open in IMG/M |
3300024346|Ga0244775_10135468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2083 | Open in IMG/M |
3300024346|Ga0244775_10696125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300024346|Ga0244775_10865803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300024346|Ga0244775_11389246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300024346|Ga0244775_11398072 | Not Available | 538 | Open in IMG/M |
3300024346|Ga0244775_11423283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300027211|Ga0208307_1016461 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
3300027246|Ga0208931_1043163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300027418|Ga0208022_1089465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300027518|Ga0208787_1059334 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
3300027586|Ga0208966_1000092 | Not Available | 27611 | Open in IMG/M |
3300027601|Ga0255079_1050768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300027627|Ga0208942_1151605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300027689|Ga0209551_1038922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
3300027720|Ga0209617_10011683 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 3934 | Open in IMG/M |
3300027733|Ga0209297_1061942 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
3300027733|Ga0209297_1094059 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1291 | Open in IMG/M |
3300027754|Ga0209596_1013114 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 5320 | Open in IMG/M |
3300027754|Ga0209596_1023920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 3587 | Open in IMG/M |
3300027754|Ga0209596_1115548 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
3300027763|Ga0209088_10000223 | Not Available | 41835 | Open in IMG/M |
3300027769|Ga0209770_10000300 | Not Available | 28059 | Open in IMG/M |
3300027769|Ga0209770_10018748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3057 | Open in IMG/M |
3300027782|Ga0209500_10177033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
3300027797|Ga0209107_10006481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6572 | Open in IMG/M |
3300027797|Ga0209107_10463085 | Not Available | 568 | Open in IMG/M |
3300027805|Ga0209229_10398785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300027892|Ga0209550_10173631 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
3300028025|Ga0247723_1002168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10712 | Open in IMG/M |
3300028178|Ga0265593_1099793 | Not Available | 775 | Open in IMG/M |
3300031787|Ga0315900_10654138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300033979|Ga0334978_0530308 | Not Available | 546 | Open in IMG/M |
3300033993|Ga0334994_0035640 | All Organisms → Viruses → Predicted Viral | 3193 | Open in IMG/M |
3300033994|Ga0334996_0000903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19481 | Open in IMG/M |
3300033995|Ga0335003_0305835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300034018|Ga0334985_0330608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300034050|Ga0335023_0061915 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 2183 | Open in IMG/M |
3300034066|Ga0335019_0113225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1811 | Open in IMG/M |
3300034101|Ga0335027_0093177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2316 | Open in IMG/M |
3300034101|Ga0335027_0151369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1702 | Open in IMG/M |
3300034102|Ga0335029_0001481 | Not Available | 18694 | Open in IMG/M |
3300034102|Ga0335029_0284806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
3300034105|Ga0335035_0288359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300034107|Ga0335037_0130315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1372 | Open in IMG/M |
3300034107|Ga0335037_0588869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300034200|Ga0335065_0007899 | Not Available | 7556 | Open in IMG/M |
3300034284|Ga0335013_0077137 | All Organisms → Viruses → Predicted Viral | 2366 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.51% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.40% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 11.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 10.36% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.77% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 7.77% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 3.63% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.11% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.11% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.59% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.07% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.55% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.04% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.04% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.52% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.52% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.52% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.52% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.52% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.52% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.52% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.52% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.52% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002372 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020482 | Freshwater microbial communities from Lake Mendota, WI - 13SEPL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020492 | Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020525 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027211 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2200242015 | 2199352005 | Freshwater | MNPFTSLIDWLDENADYAPIGAFIGLGIALVLAFTLGA |
JGI12547J11936_10505804 | 3300000736 | Freshwater And Sediment | MNPFTALQDFLDENVAYGIIGAFVGVAIAVILCFTLGA* |
JGI12547J11936_10561551 | 3300000736 | Freshwater And Sediment | MNPFTALQDFLDENVAYGIIGAFIGVAIAVILCFTLGA* |
JGI12421J11937_100060971 | 3300000756 | Freshwater And Sediment | MNPFTALIDWLDEYADVAGPIGAFIGVAVAVILCFTLGA* |
JGI12421J11937_100107807 | 3300000756 | Freshwater And Sediment | MNPFTALIDWXDESADFMAPVGAFIGVGIAIALCFINGGN* |
JGI12421J11937_100117877 | 3300000756 | Freshwater And Sediment | MTNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFIFGA* |
JGI12421J11937_100226606 | 3300000756 | Freshwater And Sediment | MNPFTALIDWIDESADFMAPVGAFIGVGIAIALCFINGGN* |
JGI12421J11937_100532415 | 3300000756 | Freshwater And Sediment | MAVIDWIDENADFGAPVGAFIGLGIALVLAFTLGA* |
FwDRAFT_101852442 | 3300000882 | Freshwater And Marine | SITTKRKGYKMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA* |
OpTDRAFT_104052462 | 3300000928 | Freshwater And Marine | MTNPIMAVIDWIDENADFGGPFAAFIGVAIAIALCFIFGGN* |
B570J13894_10167692 | 3300001275 | Freshwater | MNPFTSLIDWLDENADYAPIGAFIGLGIALVLAFTLGA* |
B570J14230_100487623 | 3300001282 | Freshwater | MNPFTYAIDWLDENADYAPIGAFIGVVIAIALCFIFGGN* |
B570J29634_1009312 | 3300002372 | Freshwater | MNPFTYAIDWLDXXADYAPIGAFIGVVIAIALCFIFGGN* |
B570J40625_1000474417 | 3300002835 | Freshwater | MNPFTSIIDWLDENADYAPIGAFIGLGIAIALAFIFGGN* |
B570J40625_1001671342 | 3300002835 | Freshwater | MTNPFTAVIDWLDENGDVGGPIGAFIGVGIAVTLCFIFGA* |
B570J40625_1004598782 | 3300002835 | Freshwater | MNPFTYVQDWLDENADYAPIGAFIGLGIAIVLAFILGGN* |
B570J40625_1004675483 | 3300002835 | Freshwater | MNPFTYVQDWLDENADYAPIGAFIGLGIAIALAFILGGN* |
B570J40625_1004721094 | 3300002835 | Freshwater | MNPFTALIDWLDENADYAPIGAFIGLGIAIALAFAFGA*PKSQK* |
JGI25922J50271_100557502 | 3300003413 | Freshwater Lake | MNPFTYIQDWLDENADYAPIGAFIGLGIAIALAFILGGN* |
JGI25926J51410_10213012 | 3300003490 | Freshwater Lake | MNPFTAVIDWIDENGDFGAPIGAFIGVGVAITLCFIFGGN* |
Ga0065166_104185401 | 3300004112 | Freshwater Lake | MNPFTYIQDWLDENADYAPIGAFIGLGIAIALAFIFGGN* |
Ga0070374_1000293022 | 3300005517 | Freshwater Lake | MNPFTALIDWLDENADYAPIGAFIGLGIALILAFTLGG* |
Ga0070374_101732642 | 3300005517 | Freshwater Lake | MTNPFTYLIDLLDEYGDVAGPIGAFIGVAIALITCFIVGA* |
Ga0070374_102843272 | 3300005517 | Freshwater Lake | MNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGA* |
Ga0070374_102927262 | 3300005517 | Freshwater Lake | MNPFTALIDWLDENADYAPIGAFIGVGIALILCFTLGM* |
Ga0070374_104887742 | 3300005517 | Freshwater Lake | MNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGG* |
Ga0068876_100911392 | 3300005527 | Freshwater Lake | MNPFTAIIDWLDENADFGAPVGAFIGVAVAVALCFILGA* |
Ga0049083_100432953 | 3300005580 | Freshwater Lentic | MNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA* |
Ga0049081_102584721 | 3300005581 | Freshwater Lentic | VNPFTAVIDWIDENADFGAPIGAFIGVGIAVALCFIFGA* |
Ga0049085_1000072035 | 3300005583 | Freshwater Lentic | MTNPIMAVIDWIDENADYAPIGAFIGLGIALVLAFTLGA* |
Ga0049082_100084257 | 3300005584 | Freshwater Lentic | MNPFTALQDFLDENVAYGIIGAFIGVGISVALCFILGA* |
Ga0078894_101012322 | 3300005662 | Freshwater Lake | MNPFTYAIDWLEDNADYAPIGAFIGLGIALVLAFTLGA* |
Ga0078894_104688803 | 3300005662 | Freshwater Lake | MNPFTYVQDWLDDNADYAPIGAFIGVGIAIALCFIFGGN* |
Ga0078894_109647052 | 3300005662 | Freshwater Lake | MNPFTAVMDWLDDNADVGAPIGAFIGVGIALALCFILGA* |
Ga0070743_100585912 | 3300005941 | Estuarine | MNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFIFGA* |
Ga0070743_101160752 | 3300005941 | Estuarine | MNPFTAVIDWIDENGDFGAPIGAFIGVGIAITLCFIFGGN* |
Ga0070744_100280556 | 3300006484 | Estuarine | MNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGG* |
Ga0070744_100382791 | 3300006484 | Estuarine | MNPFTALIDWIDDNADFMAPVGAFIGVGIAIALCFINGGN* |
Ga0070744_100495683 | 3300006484 | Estuarine | MNPFTAAQDWIDENCDYALLGAGIGIVISIALCFIFGGN* |
Ga0070744_101229222 | 3300006484 | Estuarine | MNPFTYMIDWLDENADVGAPIGAFIGVAISIALCFIFGGN* |
Ga0070744_101355802 | 3300006484 | Estuarine | MTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA* |
Ga0075471_1000198735 | 3300006641 | Aqueous | MNPFTAFIDWLDMYADVAGPIGAFIGVAIAVVTAFILG* |
Ga0075464_106860171 | 3300006805 | Aqueous | MNPFTAVIDWLDENADFGAPIGAFIGVAVAVALCFIFGA* |
Ga0079300_100714491 | 3300007162 | Deep Subsurface | MNPFTAVMDWLDDNADVGAPIGAFIGVAVAELLASFGG |
Ga0102861_11607112 | 3300007544 | Estuarine | MTNPIMAVIDWIDENADFGAPSGAFIGVGIAVALCFIFGA* |
Ga0102879_10619634 | 3300007549 | Estuarine | MTNPIMAVIDWIDENADFGGPFAAFIGVAISVALCFIFGGN* |
Ga0102881_11760642 | 3300007551 | Estuarine | MNPFTYVQDWLDDNADYAPIGAFIGVVVAVALCFIFGGN* |
Ga0102828_11308852 | 3300007559 | Estuarine | MNLFTYAIDWLEDNADYAPIGAFIGLGIALVLAFTLGA* |
Ga0102920_10290594 | 3300007600 | Estuarine | MNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFIFG* |
Ga0102921_12574752 | 3300007603 | Estuarine | MTNPIMAVIDWIDENADFGAPIGAFIGVGIAVALCFIFGA* |
Ga0102863_10051756 | 3300007622 | Estuarine | MTNPIMAVIDWIDENADFGGPFAAFIGVGIAVALCFIFGA* |
Ga0102870_11444311 | 3300007625 | Estuarine | MNPFTAFIDWLDENADYAPIGAFIGLGIALVLAFTLGG* |
Ga0102856_10935391 | 3300007636 | Estuarine | KVTKMNPFTALQDFLDENVAYGIIGAFVGVGIALVIAFTLGA* |
Ga0102865_11179491 | 3300007639 | Estuarine | PIMAVIDLIDENGDVGGPIGAFIGVGIAVALCFIFGA* |
Ga0102862_10294564 | 3300007670 | Estuarine | TNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA* |
Ga0102859_11288781 | 3300007708 | Estuarine | MNPFTAVIDWLDENADYAPIGAFIGLGIAIALAFAFGA* |
Ga0102859_11895542 | 3300007708 | Estuarine | MNPFTALQDFLDENVAYGIIGAFVGVGIALVIAFTLGA* |
Ga0102867_10409172 | 3300007716 | Estuarine | MNPFTAVIDWIDENGDFGEPIGAFIGVAIAITLCFIFGA* |
Ga0105746_13562463 | 3300007973 | Estuary Water | FTYAIDWLDDNADFMAPVGAFIGVGIAIALCFINGGN* |
Ga0105747_12599123 | 3300007974 | Estuary Water | VIIILTTTKGTKMTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA* |
Ga0105748_100915591 | 3300007992 | Estuary Water | MTNPFTAVIDWLDENADFGAPIGAFIGVGIAVALCFIFGA* |
Ga0114340_100003595 | 3300008107 | Freshwater, Plankton | MNPFTALQDFLDENVAYGLIGAFVGVAIAVILCFTLGA* |
Ga0114340_10036135 | 3300008107 | Freshwater, Plankton | MNPFTALIDWLDENADYAPIGAFVGLGIAIALAFAFGA* |
Ga0114340_10595535 | 3300008107 | Freshwater, Plankton | MNPFTAIIDWLDENADFGAPVGAFVGVAVAVALCFILGA* |
Ga0114343_11913941 | 3300008110 | Freshwater, Plankton | MNPFTYIQDWLDENADYAPIGAVIGLGIAISLAFIFGGN* |
Ga0114350_11544793 | 3300008116 | Freshwater, Plankton | MNPFTSLIDWVDENADVAGPLGAFIGLGLAITIAVIGAK* |
Ga0114336_101004223 | 3300008261 | Freshwater, Plankton | MNPFTALIDWLDENADYAPIGAFVGLGIALILAFTLGG* |
Ga0104242_10621802 | 3300008962 | Freshwater | MNPFTYAIDWLDDNADFAGPIGAFIGIGIAITLLVIGAK* |
Ga0104242_10813723 | 3300008962 | Freshwater | MNPFTYMIDFLDDNADFMAPVGAFIGLAIAFTIAIIGAK* |
Ga0102889_10709743 | 3300008964 | Estuarine | TALIDWLDENADYAPIGAFIGVGIALILCFTLGM* |
Ga0102829_10663864 | 3300009026 | Estuarine | MNPFTYLIDLLDEYGDVGGPIGAFIGVGVAIALCVIFGA* |
Ga0102829_11969501 | 3300009026 | Estuarine | KGMKMTNPIMAVIDWIDENGDVGWPIGAFIGVGIAVALCFIFGA* |
Ga0102812_107798582 | 3300009086 | Estuarine | MNPFTAVIDWIDENGDFGAPIGAFIGVGIAIALCFIFGA* |
Ga0114980_100004035 | 3300009152 | Freshwater Lake | MNPFTAVIDWIDENGDFGAPIGAFIGVGIAIALCFIFGGN* |
Ga0114980_100143139 | 3300009152 | Freshwater Lake | MNPFTYMIDWLDENADVGAPIGAFIGVAIAIGLCFIFGGN* |
Ga0114980_100187392 | 3300009152 | Freshwater Lake | MNPFTAVIDWIDENGDFGAPIGAFIGVGIAITLCFIFGA* |
Ga0114980_100795046 | 3300009152 | Freshwater Lake | MNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFVFG* |
Ga0114980_101272784 | 3300009152 | Freshwater Lake | MTNPIMAVIDWIDENADFGAPIGAFIGVAISVALCFIFGGN* |
Ga0114968_100108124 | 3300009155 | Freshwater Lake | MTNPFTALIDWIDDNADFGAPIGAFIGVGIAIALCFIFGA* |
Ga0114968_101258473 | 3300009155 | Freshwater Lake | MTEGKKMNPFTAVIDWLDEYADVAGPIGAFIGVGIAIALCFILGA* |
Ga0114977_102047702 | 3300009158 | Freshwater Lake | MNPFTYMIDWLDENADVGAPIGAFIGVAIALGLCFIFGGK* |
Ga0114977_105425113 | 3300009158 | Freshwater Lake | MNPFTYMIDFLEDNADFMAPVGAFIGLAIAFTIAIIGAK* |
Ga0114977_106022941 | 3300009158 | Freshwater Lake | MTNPIMAVIDWIDENADFGAPVGAFIGLGIALVLAFTLGA* |
Ga0114978_101917833 | 3300009159 | Freshwater Lake | MTNPIMAVIDWIDENADFGAPVGAFIGLGIALILAFTLGG* |
Ga0114966_100804473 | 3300009161 | Freshwater Lake | MTNPIMAVIDWIDENADFGGPFAAFIGVGIAVALCFIFGT* |
Ga0114966_106944582 | 3300009161 | Freshwater Lake | MVNPFWVVTNWIDENADYAPIGAFIGLGIAVLLAVIFGG* |
Ga0114979_107702282 | 3300009180 | Freshwater Lake | MNPFTAVIDWIDENGDFGAPIGAFIGVVIAIALCFIFGGN* |
Ga0114974_100627892 | 3300009183 | Freshwater Lake | MNPFTAVMDWLDDNADVGAPIGAFIGVAVAVIACFIWG* |
Ga0114974_103254692 | 3300009183 | Freshwater Lake | MFILDWIDENADVMGPLGAFLGVAVAVALCFIFG* |
Ga0114974_106138691 | 3300009183 | Freshwater Lake | MNPFTYMIDLLDEYDYMGPIGAFIGVVISVALCFIFGGN* |
Ga0114974_106849442 | 3300009183 | Freshwater Lake | IIILTTTKGTKMTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA* |
Ga0114974_106884362 | 3300009183 | Freshwater Lake | IIILTTTKGTKMTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGT* |
Ga0114982_10272532 | 3300009419 | Deep Subsurface | MNPFTAVIDWLDEYADVAAPVGAFVGVAIAVAIAFILG* |
Ga0114982_10346171 | 3300009419 | Deep Subsurface | MNPFTAVIDWLDEYADVAGPVGAFVGVAIAVAIAFILG* |
Ga0114982_12801421 | 3300009419 | Deep Subsurface | MNPFTYAIDWLDDNADFMAPVGAFIGVGIAIALCFINGGN* |
Ga0133913_108858702 | 3300010885 | Freshwater Lake | MTEGKKMNPFTAVIDWLDEYADVAGPIGAFIGVGIAVALCFILGA* |
Ga0133913_132870891 | 3300010885 | Freshwater Lake | TNKGQTMNPFTYMIDWLDENADYAPIGAFIGVVIAIALCFIFGGN* |
Ga0151620_100012540 | 3300011268 | Freshwater | MEIQMFILDWIDENADVAGPVGAFIGVAIAVALCFILGA* |
Ga0151620_10623444 | 3300011268 | Freshwater | MNPFTALIDWLDENADYAPIGAFIGLGIAIALAFAFGA* |
Ga0157210_10002405 | 3300012665 | Freshwater | MNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFILGA* |
Ga0164293_100199773 | 3300013004 | Freshwater | MNPFTALQDFLDENVAYGLIGAFIGVAVAVILCLTLGA* |
Ga0164293_100409552 | 3300013004 | Freshwater | MNPFTAVIDWLDEYADVAGPVGAFIGVGVAVALCFIFGA* |
Ga0164292_100451227 | 3300013005 | Freshwater | MNPFTAVIDWLDEYADVAGPIGAFIGVGVAVALCFIFGA* |
Ga0164292_102647921 | 3300013005 | Freshwater | TTKGTKMTNPFTALIDWIDDNADFGAPIGAFIGVGIAIALCFIFGA* |
Ga0164295_101347533 | 3300013014 | Freshwater | MIDWLDENADVGAPIGAFIGVAIAIGLCFIFGGN* |
Ga0177922_104774513 | 3300013372 | Freshwater | MNPFTYMIDWLDDNADYAPIGAFIGVVIAIALCFIFGGK* |
Ga0181347_10724424 | 3300017722 | Freshwater Lake | MNPFTALIEWLDENADYAPIGAFIGLGIALVLAFTLGA |
Ga0181356_12274651 | 3300017761 | Freshwater Lake | MTNPIMAVIDWIDENADFGAPIGAFIGVGIAVALCFIFGA |
Ga0181359_10197503 | 3300019784 | Freshwater Lake | MNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGA |
Ga0181359_10615712 | 3300019784 | Freshwater Lake | MNPFTAVIDWIDENGDFGAPIGAFIGVGVAITLCFIFGGN |
Ga0211732_12905144 | 3300020141 | Freshwater | MNPFTAVIDWLDENADYAPIGAFVGVVIAIALCFIFGGN |
Ga0211732_13701004 | 3300020141 | Freshwater | MNPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGG |
Ga0211736_104635931 | 3300020151 | Freshwater | MNPFTALIDWLDENADYAPIGAFIGLGIALVLAFALGG |
Ga0211736_105750775 | 3300020151 | Freshwater | MNPFTALIDWIDENADFMAPVGAFIGVGIAIALCFINGGN |
Ga0211736_107658842 | 3300020151 | Freshwater | MNPFTAAQDWLEDNADFGAPLAAFIGVGIAIALCFIFGA |
Ga0211734_104815032 | 3300020159 | Freshwater | MNPFTALIDWLDENADYAPIGAFVGLGIALILAFTLGA |
Ga0211734_106498068 | 3300020159 | Freshwater | MNPFTALIDWLDEYADVAGPIGAFIGVAVAVILCFTLGA |
Ga0211733_107593961 | 3300020160 | Freshwater | VNMNPFTYAIDWLDDNADYAPIGAFIGLGIAIALCFIFGGN |
Ga0211726_102081155 | 3300020161 | Freshwater | MNPFTSLIDWVDENADVAGPLGAFIGLGLAITIAVIGAK |
Ga0211726_108781051 | 3300020161 | Freshwater | MTNPFTALIDWIDENADFGAPLAAFIGVGIAVALCFIFGA |
Ga0211735_115267271 | 3300020162 | Freshwater | MNPFTALQDFLDENVAYGLIGAFVGIGIALILCFTLGA |
Ga0211729_106815282 | 3300020172 | Freshwater | MTNPIMAVIDWIDENGDVGGPIGAFIGVGIAVALCFIFGA |
Ga0208464_1011842 | 3300020482 | Freshwater | MNPFTYVQDWLDENADYAPIGAFIGLGIAIVLAFILGGN |
Ga0208483_10065672 | 3300020492 | Freshwater | MNPFTSIIDWLDENADYAPIGAFIGLGIAIALAFIFGGN |
Ga0208050_10155822 | 3300020498 | Freshwater | MNPFTYAIDWLDENADYAPIGAFIGVVIAIALCFIFGGN |
Ga0207938_10444971 | 3300020525 | Freshwater | MNPFTALIDWIDESADFMAPVGAFIGVGIAIALCFINGGN |
Ga0208232_10028264 | 3300020527 | Freshwater | MNPFTALIDWLDENADYAPIGAFIGLGIAIALAFAFGA |
Ga0208364_10180262 | 3300020533 | Freshwater | MNPFTAVIDWLDEYADVAGPVGAFVGVAIAVAIAFILG |
Ga0208855_10348702 | 3300020553 | Freshwater | VNKMNPFTYAIDWLDENADYAPIGAFIGVVIAIALCFIFGGN |
Ga0208855_10527493 | 3300020553 | Freshwater | TNKGQKMNPFTALIDWIDDNADFMAPVGAFIGVGIAIALCFINGGN |
Ga0208599_10186962 | 3300020554 | Freshwater | MNPFTYAIDWLDDNADFMAPVGAFIGVGIAIALCFINGGN |
Ga0208222_10156275 | 3300020566 | Freshwater | MNPFTALIDWLDENADYAPIGAFVGLGIAIALAFTLGA |
Ga0207909_10021158 | 3300020572 | Freshwater | MTNPFTAVIDWLDENGDVGGPIGAFIGVGIAVTLCFIFGA |
Ga0207909_10516763 | 3300020572 | Freshwater | PFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA |
Ga0207909_10683783 | 3300020572 | Freshwater | NKGQKMNPFTALIDWIDESADFMAPVGAFIGVGIAIALCFINGGN |
Ga0214163_10555473 | 3300021141 | Freshwater | MNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA |
Ga0194048_100118099 | 3300021519 | Anoxic Zone Freshwater | MNPFTYMIDWLDDNADYAPIGAFIGVAIAIVICIVAG |
Ga0222714_104807982 | 3300021961 | Estuarine Water | MEIQMFILDWIDENADVAGPVGAFIGVAIAVALCFILGA |
Ga0222713_100859485 | 3300021962 | Estuarine Water | MNPFTAFIDWLDMYADVAGPIGAFIGVAIAVVTAFILG |
Ga0222712_101154534 | 3300021963 | Estuarine Water | MNPFTAVIDWIDENADFGAPIGAFIGVVIAITLCFIFGGK |
Ga0222712_102430412 | 3300021963 | Estuarine Water | MTNPIMAVIDWIDENADFGGPFAAFIGVGIAVALCFIFGT |
Ga0212119_10606492 | 3300022543 | Freshwater | MNPFTYVQDWLDENADYAPIGAFIGLGIAIALAFILGGN |
Ga0214921_104560442 | 3300023174 | Freshwater | MTNPFTAVIDWLDENADFGAPIGAFIGVGIAVALCFILGA |
Ga0244777_100115778 | 3300024343 | Estuarine | MNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFIFGA |
Ga0244775_100148438 | 3300024346 | Estuarine | MNPFTYAIDWLEDNADYAPIGAFIGLGIALVLAFTLGA |
Ga0244775_101275667 | 3300024346 | Estuarine | MNPFTAAQDWIDENCDYALLGAGIGIVISIALCFIFGGN |
Ga0244775_101354684 | 3300024346 | Estuarine | MNPFTALIDWIDDNADFMAPVGAFIGVGIAIALCFINGGN |
Ga0244775_106961253 | 3300024346 | Estuarine | MNPFTYLIDLLDEYGDVGGPIGAFIGVGVAIALCVIFGA |
Ga0244775_108658032 | 3300024346 | Estuarine | MNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGAXPI |
Ga0244775_113892461 | 3300024346 | Estuarine | MNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGG |
Ga0244775_113980722 | 3300024346 | Estuarine | MNPFTYMIDWLDENADVGAPIGAFIGVAISIALCFIFGGN |
Ga0244775_114232831 | 3300024346 | Estuarine | NPFTAIIDWLDENADYAPIGAFIGLGIALVLAFTLGA |
Ga0208307_10164612 | 3300027211 | Estuarine | MTNPIMAVIDWIDENADFGAPVGAFIGLGIALVLAFTLGA |
Ga0208931_10431633 | 3300027246 | Estuarine | TTKRKGYKMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA |
Ga0208022_10894652 | 3300027418 | Estuarine | MNPFTAVIDWIDENGDFGAPIGAFIGVGIAITLCFIFGGN |
Ga0208787_10593343 | 3300027518 | Deep Subsurface | MNPFTAVMDWLDDNADVGAPIGAFIGVAVAVIACF |
Ga0208966_100009221 | 3300027586 | Freshwater Lentic | MNPFTALQDFLDENVAYGIIGAFIGVGISVALCFILGA |
Ga0255079_10507681 | 3300027601 | Freshwater | TKRKGYKMNPFTALIDWLDENADYAPIGAFVGLGIALVLAFTLGA |
Ga0208942_11516051 | 3300027627 | Freshwater Lentic | MTNPIMAVIDWIDENADYAPIGAFIGLGIALVLAFTLGA |
Ga0209551_10389224 | 3300027689 | Freshwater Lake | MNPFTALIDWLDENADYAPIGAFVGLGIALILAFTLGG |
Ga0209617_100116833 | 3300027720 | Freshwater And Sediment | MTNPFTAVIDWLDENADFGAPIGAFIGVGIAVALCFIFGA |
Ga0209297_10619422 | 3300027733 | Freshwater Lake | MNPFTYMIDWLDENADYAPIGAFIGVVIAIALCFIFGGN |
Ga0209297_10940592 | 3300027733 | Freshwater Lake | MTNPIMAVIDWIDENADFGAPIGAFIGVAISVALCFIFGGN |
Ga0209596_10131149 | 3300027754 | Freshwater Lake | MTEGKKMNPFTAVIDWLDEYADVAGPIGAFIGVGIAIALCFILGA |
Ga0209596_10239206 | 3300027754 | Freshwater Lake | MTNPFTALIDWIDDNADFGAPIGAFIGVGIAIALCFIFGA |
Ga0209596_11155482 | 3300027754 | Freshwater Lake | MNPFTAVIDWIDENGDFGAPIGAFIGVGIAITLCFIFGA |
Ga0209088_1000022328 | 3300027763 | Freshwater Lake | MNPFTYMIDWLDENADVGAPIGAFIGVAIAIGLCFIFGGN |
Ga0209770_1000030011 | 3300027769 | Freshwater Lake | MNPFTALIDWLDENADYAPIGAFIGLGIALILAFTLGG |
Ga0209770_100187489 | 3300027769 | Freshwater Lake | MNPFTYIQDWLDENADYAPIGAFIGLGIAIALAFILGGN |
Ga0209500_101770331 | 3300027782 | Freshwater Lake | MNPFTAVIDWIDENGDFGAPIGAFIGVAIAITLCFVFG |
Ga0209107_1000648114 | 3300027797 | Freshwater And Sediment | MNPFTALQDFLDENVAYGIIGAFVGVAIAVILCFTLGA |
Ga0209107_104630851 | 3300027797 | Freshwater And Sediment | LPVIIILTTTKGTKMTNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFIFGA |
Ga0209229_103987851 | 3300027805 | Freshwater And Sediment | IRMNPFTALIDWLDENADYAPIGAFIGLGIAIVLAFTLGA |
Ga0209550_101736311 | 3300027892 | Freshwater Lake | MNPFTYMIDWLDENADYAPIGAFIGVGIAIALCFIFGGN |
Ga0247723_100216824 | 3300028025 | Deep Subsurface Sediment | MNPFTAVIDWLDENADFGAPIGAFIGVGIALALCFILGA |
Ga0265593_10997933 | 3300028178 | Saline Water | ERLIKMTNPIMAVIDWIDENADYCAPVGAFIGLGIALVLAFTLGA |
Ga0315900_106541381 | 3300031787 | Freshwater | MNPFTALIDWLDENADYAPIGAFVGLGIAIALAFAFGAXPKS |
Ga0334978_0530308_411_545 | 3300033979 | Freshwater | TTEGKKMNPFTAVIDWLDEYADVAGPVGAFVGVAIAVAIAFILG |
Ga0334994_0035640_27_143 | 3300033993 | Freshwater | MNPFTALQDFLDENVAYGLIGAFIGVAVAVILCLTLGA |
Ga0334996_0000903_16181_16303 | 3300033994 | Freshwater | MTNPFTAVIDWIDDNADFGAPIGAFIGVGIAITLCFIFGA |
Ga0335003_0305835_82_198 | 3300033995 | Freshwater | MNPFTYAIDWLDDNADFMAPVGAFIGVAIAIALCFINA |
Ga0334985_0330608_827_940 | 3300034018 | Freshwater | NPFTALIDWLDENADYAPIGAFIGLGIALVLAFTLGA |
Ga0335023_0061915_368_490 | 3300034050 | Freshwater | MTNPFTAVIDWLDENGDVGGPIGAFIGVGIALALCFIFGA |
Ga0335019_0113225_855_971 | 3300034066 | Freshwater | MNPFTALIDWLDENADYAPIGAFVGLGIAIALAFAFGA |
Ga0335027_0093177_1456_1572 | 3300034101 | Freshwater | MNPFTALIDLLDEYEYAGPIGAFVGLGIALILAFTLGG |
Ga0335027_0151369_579_695 | 3300034101 | Freshwater | MNPFTALIDFLDENADYAPIGAFIGLGIALVIAFTLGA |
Ga0335029_0001481_14219_14341 | 3300034102 | Freshwater | MNPFTAVIDWIDENGDFGAPIGAFIGVVIAIALCFIFGGN |
Ga0335029_0284806_593_712 | 3300034102 | Freshwater | MNPFTYMIDWLDENADYAPIGAFIGVVIAIALCFILGGK |
Ga0335035_0288359_2_133 | 3300034105 | Freshwater | GQKMNPFTALIDWIDESADFMAPVGAFIGVGIAIALCFINGGN |
Ga0335037_0130315_1_114 | 3300034107 | Freshwater | PFTAVIDWLDENADFGAPIGAFIGVGIAVALCFIFGA |
Ga0335037_0588869_2_148 | 3300034107 | Freshwater | NPTTKGTKMTNPFTALIDWIDDNADFGAPIGAFIGVGIAIALCFIFGA |
Ga0335065_0007899_7106_7222 | 3300034200 | Freshwater | MNPFTALIDWLDENADYAPIGALIGLGIALVLAFTLGG |
Ga0335013_0077137_291_410 | 3300034284 | Freshwater | MNPFTAVIDWLDEYADVAGPVGAFIGVGVAVALCFIFGA |
⦗Top⦘ |