NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027905

Metagenome / Metatranscriptome Family F027905

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027905
Family Type Metagenome / Metatranscriptome
Number of Sequences 193
Average Sequence Length 45 residues
Representative Sequence VYLYAGLRAGASAEDVLARAEADGAPFARSDELKAWVAQGLAELA
Number of Associated Samples 172
Number of Associated Scaffolds 193

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.68 %
% of genes near scaffold ends (potentially truncated) 90.16 %
% of genes from short scaffolds (< 2000 bps) 93.78 %
Associated GOLD sequencing projects 163
AlphaFold2 3D model prediction Yes
3D model pTM-score0.73

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.575 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.953 % of family members)
Environment Ontology (ENVO) Unclassified
(27.979 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.560 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.68%    β-sheet: 0.00%    Coil/Unstructured: 49.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.73
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.52.1.7: Restriction endonuclease-liked1cfra_1cfr0.68
c.52.1.7: Restriction endonuclease-liked1knva_1knv0.67
c.45.1.0: (Phosphotyrosine protein) phosphatases IId2h4va12h4v0.67
c.45.1.1: (Phosphotyrosine protein) phosphatases IId1d5ra21d5r0.66
c.45.1.0: (Phosphotyrosine protein) phosphatases IId3zm1a13zm10.66


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 193 Family Scaffolds
PF06224HTH_42 10.88
PF00753Lactamase_B 6.74
PF14378PAP2_3 5.70
PF14681UPRTase 2.59
PF07883Cupin_2 2.59
PF13714PEP_mutase 2.07
PF00106adh_short 1.04
PF00891Methyltransf_2 1.04
PF00440TetR_N 1.04
PF07992Pyr_redox_2 1.04
PF03992ABM 1.04
PF00005ABC_tran 1.04
PF08448PAS_4 1.04
PF13460NAD_binding_10 1.04
PF00797Acetyltransf_2 1.04
PF12681Glyoxalase_2 1.04
PF16859TetR_C_11 1.04
PF01872RibD_C 1.04
PF12840HTH_20 1.04
PF13417GST_N_3 1.04
PF16864Dimerisation2 1.04
PF01925TauE 0.52
PF13191AAA_16 0.52
PF09678Caa3_CtaG 0.52
PF00188CAP 0.52
PF00579tRNA-synt_1b 0.52
PF00196GerE 0.52
PF06325PrmA 0.52
PF06245DUF1015 0.52
PF13474SnoaL_3 0.52
PF00583Acetyltransf_1 0.52
PF12695Abhydrolase_5 0.52
PF00155Aminotran_1_2 0.52
PF01243Putative_PNPOx 0.52
PF13305TetR_C_33 0.52
PF13207AAA_17 0.52
PF02720DUF222 0.52
PF13396PLDc_N 0.52
PF00111Fer2 0.52
PF00211Guanylate_cyc 0.52
PF07931CPT 0.52
PF04203Sortase 0.52
PF08031BBE 0.52
PF00248Aldo_ket_red 0.52
PF01894UPF0047 0.52
PF13673Acetyltransf_10 0.52
PF00990GGDEF 0.52
PF01799Fer2_2 0.52
PF02687FtsX 0.52
PF00487FA_desaturase 0.52
PF03193RsgA_GTPase 0.52
PF01142TruD 0.52
PF09828Chrome_Resist 0.52
PF00441Acyl-CoA_dh_1 0.52
PF13977TetR_C_6 0.52
PF00857Isochorismatase 0.52
PF08530PepX_C 0.52
PF13193AMP-binding_C 0.52
PF01370Epimerase 0.52
PF00089Trypsin 0.52
PF12833HTH_18 0.52
PF00561Abhydrolase_1 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 193 Family Scaffolds
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 10.88
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.04
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.04
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.04
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.52
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 0.52
COG3896Chloramphenicol 3-O-phosphotransferaseDefense mechanisms [V] 0.52
COG3897Protein N-terminal and lysine N-methylase, NNT1/EFM7 familyPosttranslational modification, protein turnover, chaperones [O] 0.52
COG4198Uncharacterized conserved protein, DUF1015 familyFunction unknown [S] 0.52
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.52
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.52
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.52
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.52
COG0585tRNA(Glu) U13 pseudouridine synthase TruDTranslation, ribosomal structure and biogenesis [J] 0.52
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.52
COG1162Ribosome biogenesis GTPase RsgATranslation, ribosomal structure and biogenesis [J] 0.52
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.52
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.52
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.52
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.52
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.52
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.52
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 0.52
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.52
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.58 %
UnclassifiedrootN/A26.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig31789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1036Open in IMG/M
2170459011|GKWS7RC01DEPJ4Not Available514Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2302455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2325642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium952Open in IMG/M
3300000887|AL16A1W_10374151All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300000953|JGI11615J12901_10393045All Organisms → cellular organisms → Bacteria → Terrabacteria group927Open in IMG/M
3300001356|JGI12269J14319_10136448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1087Open in IMG/M
3300003996|Ga0055467_10282593All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300004081|Ga0063454_100933925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300004081|Ga0063454_100999769Not Available672Open in IMG/M
3300004114|Ga0062593_101148038All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300004114|Ga0062593_101584520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300004153|Ga0063455_100160649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1049Open in IMG/M
3300004157|Ga0062590_100860117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia843Open in IMG/M
3300005332|Ga0066388_101399353All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300005334|Ga0068869_100591366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria936Open in IMG/M
3300005355|Ga0070671_100362327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1238Open in IMG/M
3300005439|Ga0070711_100047658All Organisms → cellular organisms → Bacteria2927Open in IMG/M
3300005518|Ga0070699_101977264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300005535|Ga0070684_100787105All Organisms → cellular organisms → Bacteria → Terrabacteria group889Open in IMG/M
3300005542|Ga0070732_10796333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300005545|Ga0070695_100704175All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005558|Ga0066698_10440988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium890Open in IMG/M
3300005559|Ga0066700_10366225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300005561|Ga0066699_10960285Not Available594Open in IMG/M
3300005563|Ga0068855_100494266All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300005569|Ga0066705_10838673All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300005576|Ga0066708_10943132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300005587|Ga0066654_10392290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300005614|Ga0068856_101648348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300005614|Ga0068856_102550080All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300005764|Ga0066903_102302462All Organisms → cellular organisms → Bacteria → Terrabacteria group1040Open in IMG/M
3300005764|Ga0066903_103419278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia856Open in IMG/M
3300005842|Ga0068858_100253893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea aridisoli1671Open in IMG/M
3300005985|Ga0081539_10324354Not Available654Open in IMG/M
3300006028|Ga0070717_11685795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300006032|Ga0066696_10313120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1021Open in IMG/M
3300006178|Ga0075367_10800290Not Available600Open in IMG/M
3300006237|Ga0097621_100411226All Organisms → cellular organisms → Bacteria → Terrabacteria group1213Open in IMG/M
3300006755|Ga0079222_10255712Not Available1106Open in IMG/M
3300006800|Ga0066660_11203892Not Available595Open in IMG/M
3300006871|Ga0075434_100302159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1621Open in IMG/M
3300006894|Ga0079215_10644188All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006954|Ga0079219_11902436Not Available561Open in IMG/M
3300009012|Ga0066710_100255919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2536Open in IMG/M
3300009012|Ga0066710_102024861All Organisms → cellular organisms → Bacteria → Terrabacteria group852Open in IMG/M
3300009029|Ga0066793_10883082Not Available506Open in IMG/M
3300009089|Ga0099828_11487157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300009147|Ga0114129_10758789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1241Open in IMG/M
3300009147|Ga0114129_11564283All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300009148|Ga0105243_10311790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1430Open in IMG/M
3300009177|Ga0105248_11153123All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300009177|Ga0105248_12935396Not Available543Open in IMG/M
3300009522|Ga0116218_1472197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae559Open in IMG/M
3300009698|Ga0116216_10866727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300009698|Ga0116216_10998853All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300009700|Ga0116217_10694702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300010042|Ga0126314_11178281All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300010046|Ga0126384_10874665All Organisms → cellular organisms → Bacteria → Terrabacteria group810Open in IMG/M
3300010048|Ga0126373_11088445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300010337|Ga0134062_10348220All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300010359|Ga0126376_11705870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300010362|Ga0126377_12334591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300010366|Ga0126379_11019340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria933Open in IMG/M
3300010379|Ga0136449_101162269Not Available1220Open in IMG/M
3300010397|Ga0134124_12760075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300012199|Ga0137383_10749624All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300012201|Ga0137365_10433546Not Available968Open in IMG/M
3300012206|Ga0137380_10637459All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300012206|Ga0137380_11604577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300012207|Ga0137381_11801067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300012208|Ga0137376_10919290All Organisms → cellular organisms → Bacteria → Terrabacteria group751Open in IMG/M
3300012208|Ga0137376_11790785Not Available504Open in IMG/M
3300012210|Ga0137378_11039489Not Available733Open in IMG/M
3300012212|Ga0150985_122483662All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300012349|Ga0137387_10673525Not Available749Open in IMG/M
3300012353|Ga0137367_11000031Not Available571Open in IMG/M
3300012358|Ga0137368_10826589Not Available571Open in IMG/M
3300012363|Ga0137390_11463287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium625Open in IMG/M
3300012513|Ga0157326_1005087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora1385Open in IMG/M
3300012529|Ga0136630_1282187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300012896|Ga0157303_10325693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300012917|Ga0137395_11025874All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012929|Ga0137404_12048207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300012955|Ga0164298_10642526Not Available735Open in IMG/M
3300012955|Ga0164298_10958629Not Available628Open in IMG/M
3300012958|Ga0164299_11186444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300012961|Ga0164302_11204670Not Available605Open in IMG/M
3300012985|Ga0164308_10577126Not Available953Open in IMG/M
3300012985|Ga0164308_10603503All Organisms → cellular organisms → Bacteria → Terrabacteria group934Open in IMG/M
3300012986|Ga0164304_10513945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria877Open in IMG/M
3300012986|Ga0164304_11088246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300012988|Ga0164306_10398308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1034Open in IMG/M
3300013105|Ga0157369_10779885All Organisms → cellular organisms → Bacteria → Terrabacteria group982Open in IMG/M
3300013308|Ga0157375_12678592All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300013758|Ga0120147_1018855All Organisms → cellular organisms → Bacteria → Proteobacteria1357Open in IMG/M
3300013763|Ga0120179_1031328All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300014157|Ga0134078_10663284All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300014169|Ga0181531_10897660Not Available555Open in IMG/M
3300014295|Ga0075305_1092459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia601Open in IMG/M
3300014497|Ga0182008_10357236All Organisms → cellular organisms → Bacteria → Terrabacteria group776Open in IMG/M
3300014968|Ga0157379_10015220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6745Open in IMG/M
3300015245|Ga0137409_11116416All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300015358|Ga0134089_10464896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300015372|Ga0132256_102187155All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300015374|Ga0132255_106359257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae500Open in IMG/M
3300016319|Ga0182033_11411127Not Available627Open in IMG/M
3300016357|Ga0182032_11239654Not Available643Open in IMG/M
3300017934|Ga0187803_10097593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1155Open in IMG/M
3300017937|Ga0187809_10210224All Organisms → cellular organisms → Bacteria → Terrabacteria group693Open in IMG/M
3300017966|Ga0187776_10034130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2841Open in IMG/M
3300017966|Ga0187776_11057631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei600Open in IMG/M
3300018042|Ga0187871_10319625Not Available858Open in IMG/M
3300018060|Ga0187765_10005450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium5410Open in IMG/M
3300018081|Ga0184625_10220984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300018089|Ga0187774_11169285All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300018468|Ga0066662_12778006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300018469|Ga0190270_10497016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1161Open in IMG/M
3300018476|Ga0190274_13496029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium530Open in IMG/M
3300018482|Ga0066669_10984332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300018482|Ga0066669_11832562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300020082|Ga0206353_10140334Not Available1157Open in IMG/M
3300021080|Ga0210382_10099828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1208Open in IMG/M
3300021363|Ga0193699_10317962Not Available649Open in IMG/M
3300023071|Ga0247752_1026945Not Available838Open in IMG/M
3300024055|Ga0247794_10089937All Organisms → cellular organisms → Bacteria → Terrabacteria group900Open in IMG/M
3300025906|Ga0207699_10091516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1910Open in IMG/M
3300025916|Ga0207663_11281286All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300025927|Ga0207687_11034419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300025928|Ga0207700_10452303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1132Open in IMG/M
3300025930|Ga0207701_10894084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128744Open in IMG/M
3300025935|Ga0207709_10527226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria925Open in IMG/M
3300025940|Ga0207691_11611685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14528Open in IMG/M
3300025949|Ga0207667_10607227All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300025960|Ga0207651_10842299Not Available815Open in IMG/M
3300026058|Ga0208421_1014486Not Available697Open in IMG/M
3300026070|Ga0208423_1004205Not Available1362Open in IMG/M
3300026078|Ga0207702_11522894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300026547|Ga0209156_10484987All Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300026552|Ga0209577_10139577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1919Open in IMG/M
3300026816|Ga0207509_104154All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300027842|Ga0209580_10545519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300028709|Ga0307279_10003465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1563Open in IMG/M
3300028718|Ga0307307_10259055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684556Open in IMG/M
3300028755|Ga0307316_10227366All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300028755|Ga0307316_10300544Not Available587Open in IMG/M
3300028784|Ga0307282_10123669All Organisms → cellular organisms → Bacteria → Terrabacteria group1213Open in IMG/M
3300028799|Ga0307284_10007299All Organisms → cellular organisms → Bacteria3179Open in IMG/M
3300028824|Ga0307310_10018276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2732Open in IMG/M
3300028885|Ga0307304_10508185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300028889|Ga0247827_10908549Not Available592Open in IMG/M
3300030006|Ga0299907_10545372All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300030707|Ga0310038_10466300Not Available539Open in IMG/M
3300030785|Ga0102757_11362893All Organisms → cellular organisms → Bacteria → Terrabacteria group798Open in IMG/M
3300031231|Ga0170824_100716926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300031231|Ga0170824_115119127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300031366|Ga0307506_10042839All Organisms → cellular organisms → Bacteria → Terrabacteria group1279Open in IMG/M
3300031544|Ga0318534_10658569Not Available593Open in IMG/M
3300031564|Ga0318573_10178872All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300031564|Ga0318573_10274935Not Available900Open in IMG/M
3300031716|Ga0310813_11027008All Organisms → cellular organisms → Bacteria → Terrabacteria group753Open in IMG/M
3300031719|Ga0306917_10606179All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria861Open in IMG/M
3300031723|Ga0318493_10713362All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031748|Ga0318492_10301887Not Available833Open in IMG/M
3300031768|Ga0318509_10741275Not Available544Open in IMG/M
3300031770|Ga0318521_10182599All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300031771|Ga0318546_10280375All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300031771|Ga0318546_11047798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae574Open in IMG/M
3300031779|Ga0318566_10418025Not Available659Open in IMG/M
3300031781|Ga0318547_10426935All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300031821|Ga0318567_10255686Not Available984Open in IMG/M
3300031847|Ga0310907_10476553Not Available664Open in IMG/M
3300031854|Ga0310904_11131409Not Available562Open in IMG/M
3300031859|Ga0318527_10346451All Organisms → cellular organisms → Bacteria → Terrabacteria group633Open in IMG/M
3300031897|Ga0318520_10704327Not Available631Open in IMG/M
3300031996|Ga0308176_11314621All Organisms → cellular organisms → Bacteria → Terrabacteria group768Open in IMG/M
3300032008|Ga0318562_10840296Not Available525Open in IMG/M
3300032066|Ga0318514_10396551Not Available732Open in IMG/M
3300032068|Ga0318553_10647560Not Available553Open in IMG/M
3300032180|Ga0307471_102803241All Organisms → cellular organisms → Bacteria → Terrabacteria group619Open in IMG/M
3300032180|Ga0307471_104312780Not Available502Open in IMG/M
3300032205|Ga0307472_102190081All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300032770|Ga0335085_10160202All Organisms → cellular organisms → Bacteria2809Open in IMG/M
3300032782|Ga0335082_10196918All Organisms → cellular organisms → Bacteria1916Open in IMG/M
3300032828|Ga0335080_11665878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300032954|Ga0335083_10069837All Organisms → cellular organisms → Bacteria3593Open in IMG/M
3300033004|Ga0335084_11050100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium819Open in IMG/M
3300033158|Ga0335077_10381373All Organisms → cellular organisms → Bacteria1520Open in IMG/M
3300033550|Ga0247829_10565428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria944Open in IMG/M
3300033551|Ga0247830_10658116Not Available831Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.11%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.11%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.07%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.55%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.04%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.04%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.04%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.04%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.52%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.52%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.52%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.52%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.52%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.52%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.52%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459011Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cmEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013758Permafrost microbial communities from Nunavut, Canada - A24_65cm_12MEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026058Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026070Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026816Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030785Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0789.000027102166559005SimulatedLIYLYAGLRAGASAEDVLARADADDAPFVPSEELRAWITEGLAQLSSK
F64_040267102170459011Grass SoilMYLYAGLRQGSSADEVIAQAEADGAPFAGSDELKAWVAQGLDELS
ICChiseqgaiiDRAFT_230245513300000033SoilAEEVLARAEADGAPFVASDALVAWVEQGLVELGESSA*
ICChiseqgaiiDRAFT_232564213300000033SoilVIYLYAGLRAGASADEVLARAEADDAVFCSTDELKAWVAQGL
AL16A1W_1037415123300000887PermafrostVYLYAGLRAGATADEVLARAEEDDAPFCGSAELKAWVAQGLAELS*
JGI11615J12901_1039304513300000953SoilSASAEEVVARAEADGATFLQSDELRAWVTNGLEQLS*
JGI12269J14319_1013644823300001356Peatlands SoilSSALVYLYSGLRSGASPADVLARAEADGAPFVQAEPLKQWVVQGLAELSGN*
Ga0055467_1028259323300003996Natural And Restored WetlandsAGASADEVLAQAAADDAPFAKSDELRNLVRRGLDELAND*
Ga0063454_10093392513300004081SoilRSSALVYLYAGLKDRASADDVLRQAEDDGAPFTKSDELKAWVRQGLGELAERS*
Ga0063454_10099976913300004081SoilGRSSAVIYLYAGLRAGATADEVLARAEADGALFCGSDDAKSWVTQGLAELR*
Ga0062593_10114803823300004114SoilAVVYLYSGLKAGASADEVIARAEADGAPFAQSDELKVWVAQGLEELSEK*
Ga0062593_10158452023300004114SoilLVTCRSGGRSSAVIYLYAGLRAGATADEVLARAEADGALFCGSDDAKAWVRQGLAELT*
Ga0063455_10016064933300004153SoilIYLYAGLRAGASAEDVLARADADGAPFVQSDELRAWVSDGLAQLS*
Ga0062590_10086011713300004157SoilIYLYAGLRAGATADEVLARAEADGALFCGSDDAKAWVRQGLAELT*
Ga0066388_10139935323300005332Tropical Forest SoilGLRAGATADEVLAHAEADGAAFAGSDELKTWVAQGLNELA*
Ga0068869_10059136613300005334Miscanthus RhizosphereYLYAGLKGGASADDVLSRAAADGAPFMGSDELKAWIAQGLDELG*
Ga0070671_10036232723300005355Switchgrass RhizosphereGLKEGATADEVLARAEADDAPFARSEELRAWVAQNLDALS*
Ga0070711_10004765853300005439Corn, Switchgrass And Miscanthus RhizosphereSSALIYLYAGLKSGASADDVLARAEADDAPWARSDELRAWVTDGLEQLS*
Ga0070699_10197726413300005518Corn, Switchgrass And Miscanthus RhizosphereRSSAVVYLYAGLRAGATADEVLARAERDSAPFTGSDDLKAWVTQGLDELS*
Ga0070684_10078710513300005535Corn RhizosphereLIYLYAGLQAGASAEDVFARARADEAAFVQSDELRAWVADGLEQLS*
Ga0070732_1079633313300005542Surface SoilRSSAVIYLYAGLEAGASAEAVLARAEADGAPFYASDELKAWVSQGLDELS*
Ga0070695_10070417523300005545Corn, Switchgrass And Miscanthus RhizosphereVYLYSGLRSGATADEVLTRAEADDAPFTKSEELRAWVAQGLDELSGD*
Ga0066698_1044098813300005558SoilGASADQVLAGAEADDAPFAGSDELRAWVAEGLDELA*
Ga0066700_1036622523300005559SoilVYLYAGLRAGASAEDVLARAEADGAPFARSDELKAWVAQGLAELA*
Ga0066699_1096028523300005561SoilSAVAYLYAGLRSGASAEEVLARADADGAPFTGFDDLRAFVTQGIEELASDE*
Ga0068855_10049426633300005563Corn RhizosphereKAGASADEVIARAEADGAPFAGSEELETWVRQGLDELD*
Ga0066705_1083867313300005569SoilAGAPAEDVLARAEADDASFVRSDELRAWVTDGLTQLS*
Ga0066708_1094313233300005576SoilASAEDVLARADADDAPFARSEELRAWVADGLAQLSRKPTQR*
Ga0066654_1039229013300005587SoilVVYLYAGLRAGAAPDEVLACADADDAPFCGSDELRAWVTQGLDELS*
Ga0068856_10164834813300005614Corn RhizosphereLIYLYAGLRAGSTAEEVLERAEADDALFVRSDELRAWVVDGLAQLS*
Ga0068856_10255008013300005614Corn RhizospherePRSSALIYLYAGLQAGASAEDVFARARADEAAFVQSDELRAWVADGLEQLS*
Ga0066903_10230246223300005764Tropical Forest SoilSSALIYLYGGLEAGASTEEVLARAAADDAAFLKSDELRAWVAEGLEQLS*
Ga0066903_10341927823300005764Tropical Forest SoilLVYLYSGLREGAQAGEVLERAHADGAPFTRSDELRAWVEHGLTELA*
Ga0068851_1014141813300005834Corn RhizosphereCRTGPRSAAVAYLYAGLRAGASADDVLAAADADGAPFAGVEAYREFVTRGLTELADE*
Ga0068858_10025389343300005842Switchgrass RhizosphereRSSALVYLYSGLEAGAPADEVLRQAEADGAPFAKSDELREWVTQGLEELA*
Ga0081539_1032435423300005985Tabebuia Heterophylla RhizosphereGGVRSSAAAYLYAGLRSGATADEVIAKAEADQAPFAGNDALNAWIRQGLDELD*
Ga0070717_1168579513300006028Corn, Switchgrass And Miscanthus RhizospherePRSSALVYMYAGLKAGATLGEVLARAEADEAPFTKSDEIKAWVAQGLEELSLED*
Ga0066696_1031312013300006032SoilSAEDVLARAEAVGAPFMQSDELRAWVSDGLAQLS*
Ga0075367_1080029013300006178Populus EndosphereAGLRAGATAEEVLARAEADGALFAGSDELRGWVAQGLDELS*
Ga0097621_10041122623300006237Miscanthus RhizosphereSSALIYLYAGLQAGASAEDVFARAEADDAAFVKSDELRAWVANGLEQLS*
Ga0079222_1025571213300006755Agricultural SoilAGLEAGAGADEVIARARADAAPFSGSEELEAWVRQGLSELS*
Ga0066660_1120389233300006800SoilAVIYLYAGLRSAATAAEVLARAEADDALFTRSDELKAWVSQGLDELS*
Ga0075434_10030215943300006871Populus RhizosphereLYAGLRSGASAEEVLERAKADGAPFVGNAEYEAWVAQGIRELR*
Ga0079215_1064418823300006894Agricultural SoilAGLKAGASEEEVLARADADGAPFASNEELRAWVAQGLRELA*
Ga0079219_1190243633300006954Agricultural SoilSGLRAGASAEDVLARAEADGAAFVQSEELRGWVVDGLARLS*
Ga0066710_10025591913300009012Grasslands SoilALVYLYTGLGAGASADQVLAGAEADDAPFAGSDELRAWVAQGLDELA
Ga0066710_10202486113300009012Grasslands SoilALIYLYAGLKAGASADDVLARAAADGAPFMGSDELKAWLTQGLEDLGDG
Ga0066793_1088308223300009029Prmafrost SoilVYLYAGLKAGATADAVLARAEADDAPFCASEDLKAWVRQGLDELFVGEVSA*
Ga0099828_1148715713300009089Vadose Zone SoilAGLRAGATADEVLARAERDSAPFTGSEELKAWVTQGLDELS*
Ga0114129_1075878923300009147Populus RhizosphereGLKAGASADEVLARAEADDAPFTRSDELKAWVAQNLDELS*
Ga0114129_1156428323300009147Populus RhizosphereSSAVVYLYAGLRSGASAEEVLARAEADNAPFTQSEELRAWVAQGLDELSAN*
Ga0105243_1031179033300009148Miscanthus RhizosphereGLRAGASADEVLARAEADDAPFIRSDELRSWVAQNLEELS*
Ga0105248_1115312313300009177Switchgrass RhizosphereLYSGLRSGASADEVIARAEADNAPFTESDDLKNWVRRGFDELA*
Ga0105248_1293539623300009177Switchgrass RhizosphereLYAGLESGASADDVLARAEADDAPWARSDELRAWVTDGLEQLR*
Ga0116218_147219723300009522Peatlands SoilALVYLYSGLRSGASPADVLARAEADGAPFVQAEPLKEWVAQGLVELSAH*
Ga0116216_1086672723300009698Peatlands SoilLVYLFAGLKAGASADDVLERAESDGAPFVDSDALRSWVMQGLSELAPPEV*
Ga0116216_1099885323300009698Peatlands SoilASADEVLARAEADDAPFTHAEDLKAWVLQGLDELA*
Ga0116217_1069470223300009700Peatlands SoilLVYLFAGLKAGASADDVLERAESDGAPFVGSDALRSWVMQGLSELAPPEA*
Ga0126314_1117828123300010042Serpentine SoilVYLYAGLRAGASADDVIARAEADGAPFTGSVELKAWVAQGLDELA*
Ga0126384_1087466513300010046Tropical Forest SoilPRSSALIYLYAGLQAGASAEQVLARAEADDAPFASSDELRA*
Ga0126373_1108844513300010048Tropical Forest SoilLYAGLQSGASAEEVLARAEADDAPFLRTDSLREWVVRGLAELRP*
Ga0134062_1034822013300010337Grasslands SoilPRSSALVYLYAGLQSGASADEVIARAKADSAPFAQSDDLKSWVRQGLGELA*
Ga0126376_1170587023300010359Tropical Forest SoilALIYLYAGLQDGASADDVLARAEADGAPFVRSDELRGWVADGLAQLS*
Ga0126377_1233459123300010362Tropical Forest SoilVALIYLYSGLQSGASKEEVLARAEADDATFLKSDELRAWVAEGLEQLS*
Ga0126379_1101934033300010366Tropical Forest SoilSSAAIYLYAGLEAGATADEVLERADADDAPFAKSEELRAWVTQGLAELS*
Ga0136449_10116226923300010379Peatlands SoilAGLRSGATADEVLARAEEDDAPFAGSDELKAWITRGLDELA*
Ga0134124_1276007523300010397Terrestrial SoilSSALIYLYAGLRAGSTAEEVLERAEADDALFVRSDELRAWVVDGLAQLS*
Ga0137383_1074962423300012199Vadose Zone SoilLIYLYAGLQAGASADDVLARAEADDAAWTNSDELRAWVADGLEQLS*
Ga0137365_1043354623300012201Vadose Zone SoilRSSALVYLYAGLKAGAPADEVLARAEADGAPFCGSDELKAWVRQGLAELA*
Ga0137380_1063745913300012206Vadose Zone SoilLIYLYSGLKAGASAKDVLARAEADDAPFARSDELRTWVTEGLERLS*
Ga0137380_1160457733300012206Vadose Zone SoilAADEVLARAEADDAPFSRSDDLKAWVAQGLDELS*
Ga0137381_1180106723300012207Vadose Zone SoilLVYLYAGLKAGAAADEVLARAVADNAPFTGSEELKAWVRRGLDELS*
Ga0137376_1091929023300012208Vadose Zone SoilGLRAGASADQVLARAEEDGAPFSSSAELKAWVTQGLAELA*
Ga0137376_1179078513300012208Vadose Zone SoilVIYLYAGLRAGGTADEVLARAEADNAPFTGSDDLKAWVARGLAELS*
Ga0137378_1103948913300012210Vadose Zone SoilATADEVLARAEADGAPFCGSDELKAWVAQGLAELS*
Ga0150985_12248366213300012212Avena Fatua RhizosphereLVYLWTGLQDGASAEDVLARAEAAGAPFTRSEELRAWVTQGLAELG*
Ga0137387_1067352523300012349Vadose Zone SoilGATASEVLARAEADGAPFCGSDELKAWVAQGLDELA*
Ga0137367_1100003113300012353Vadose Zone SoilVVYLYAGLRAGAAADEVLARAEADGAPFAGSDDLKAWVARGLDELF*
Ga0137368_1082658913300012358Vadose Zone SoilTPDEVLARAEADGAPFAGSEDLKAWVVQGLDELS*
Ga0137390_1146328723300012363Vadose Zone SoilVYLYAGLRAGASPDEVLARADADGAPFAAFADLRAFVTHSLQELAPKP*
Ga0157326_100508743300012513Arabidopsis RhizosphereSSALVYLYAGLETGATADEVLARAEADGAPFAGSEELKAWVRQGLDELRSD*
Ga0136630_128218723300012529Polar Desert SandVVYFYAGLRAGAAPDEVLARAEADGAPFAGSDELKAWVAQGL
Ga0157303_1032569313300012896SoilKEGATADEVLARADADDAPFARSDELRAWVAQNLAALS*
Ga0137395_1102587413300012917Vadose Zone SoilALVYLYAGLRAGAEADEVLARAAADSAPFSGSDELEAWVAQGLAELS*
Ga0137404_1204820723300012929Vadose Zone SoilAGLEAGASADEVLARAEADGAPFVRSDALKAWVVQALAELG*
Ga0164298_1064252613300012955SoilAGLESGEPADEVLRQAEADQAPFTRSDALKAWVAKGLGELA*
Ga0164298_1095862923300012955SoilRSSALVYLYAGLRTGATADEVLARAEAENAPFCDSPALKHWVEQGLDELS*
Ga0164299_1118644413300012958SoilVSNGPSLLRLIYLYAGLRAGAAPDEVLARAEADEALFIASDDLRAWVRQGLEELS*
Ga0164302_1120467023300012961SoilAPADDVIARAEADNAPFAQSDELKAWVRQGLDELA*
Ga0164308_1057712643300012985SoilSGEPADEVLRQAEADQAPFTRSDALKAWVVKGLGELA*
Ga0164308_1060350313300012985SoilALIYLYAGLQSDASAKDVFARAEGDGAAFVKSDELRAWVANGLEQLS*
Ga0164304_1051394513300012986SoilSAALIYLYAGLSAGAAAEDVLARADADDAPFVGSEELRAWITEGLAQLSSK*
Ga0164304_1108824623300012986SoilLRAGATPDEVLARAEADGAPFCGSDELKAWVVQGLDELS*
Ga0164306_1039830813300012988SoilLRAEAPAEDVLACADADDAPFVRSEELRAWITEGLAQLSSK*
Ga0157369_1077988513300013105Corn RhizosphereSALIYLYAGLRAGASAEDLFARAEADDAMFVQSDELRAWVADGLKQLS*
Ga0157375_1267859223300013308Miscanthus RhizosphereLIYLYSGLRSGASADEVIARGEADNAPFTESDDLKNWVRQGFDELA*
Ga0120147_101885513300013758PermafrostLVYLHAGLRSGAGADEVLARAQADDAPFTHAEDLKAWVVQGINELA*
Ga0120179_103132833300013763PermafrostIYLYAGLRAGASAKDVLARAEVDDAPFARSEELRAWVTEGLEQLS*
Ga0134078_1066328413300014157Grasslands SoilLYSGLQAGASAEDVFARARADDAAFVQSDELRAWVADGLEQLS*
Ga0181531_1089766013300014169BogQSHASPDEVVERAEADGAPWVHSDEITAWVRQGLDELR*
Ga0075305_109245913300014295Natural And Restored WetlandsKTGATADEVLTRAESDEAPFAGSDELKAWVTQGLSELA*
Ga0182008_1035723623300014497RhizosphereALVYLYAGLKAGAGRDEVLARAEADGAPFSGSDELKAWVAQGLDELA*
Ga0157379_10015220103300014968Switchgrass RhizosphereSSALVYLYSGLEAGAPADEVLRQAEADGAPFAKSDELREWVTQGLEELA*
Ga0137409_1111641613300015245Vadose Zone SoilGASADDVLARAAADGALFMGSDELKAWVTQGLDDLGDD*
Ga0134089_1046489623300015358Grasslands SoilRSSALVYLYTGLGAGASADQVLARAEADDAPFAGSDELRAWVAEGLDELA*
Ga0132256_10218715523300015372Arabidopsis RhizosphereAGASAEEVLARADVDAAPFAASDELRALVSHGLADLAPDG*
Ga0132255_10635925713300015374Arabidopsis RhizosphereDEVLAQAEADGAPFVEAEPLKAWVTQGLSELSAQ*
Ga0182033_1141112713300016319SoilLYSGLRSGAGADEVMARAEADGAPFVEVDSLKGWVVQGLAELT
Ga0182032_1123965423300016357SoilRGGASADEVLERAQADGAPFIDAGPLKAWVAQGLAELS
Ga0187803_1009759323300017934Freshwater SedimentSSALVYLYSGLRSGASPADVLARAEADGAPFVQAEPLKQWVVQGLEELR
Ga0187809_1021022423300017937Freshwater SedimentGLQAGASAEDVLARADADDAPFAKSDELRAWVSDGLRQL
Ga0187776_1003413013300017966Tropical PeatlandPGVPVRGARSGASADELLARAEADGAPFTQAEPLEAWVAQGLAELS
Ga0187776_1105763123300017966Tropical PeatlandGLRSGASAEEVLTRAEADGAPFTQAEPLKAWVVQGLAELS
Ga0187871_1031962533300018042PeatlandYLYAGLKAGATEQEVLAQAQSDGAPFVQSDELVAWVKQGLAELK
Ga0187765_1000545053300018060Tropical PeatlandRSSALIYLYAGLRSSASAEDVIARAEADDAPFVRSDELRAWVTEGLTQLA
Ga0184625_1022098433300018081Groundwater SedimentVYLYAGLKAGATADEVLARAEADGAPFAGSDELRAWVTRGLDELS
Ga0187774_1116928523300018089Tropical PeatlandVYLYAGLLARAEADGAPFTQAEPLEAWVAQGLAELS
Ga0066662_1277800623300018468Grasslands SoilGASADEVLARAEADEAPFAGSEEIRTWITESLTELS
Ga0190270_1049701633300018469SoilSAVIYLYAGLQQQASAEEVLARAEQDGATFVADEGLRSWVSEGLTELA
Ga0190274_1349602923300018476SoilVYLYAGLRAGASASDVLARARADGAPFVGNEALEDWVTQGLTELA
Ga0066669_1098433223300018482Grasslands SoilAALIYLSAGLKAGASADDVLARAAADGAPFMGSDELKAWVTQGLDDLIDD
Ga0066669_1183256213300018482Grasslands SoilGATADEVLARAERDSAPFTGSDDLKAWVTQGLDELS
Ga0206353_1014033413300020082Corn, Switchgrass And Miscanthus RhizosphereGASADDVLARADADGAPFIGSDDLKAWVRQGLAELG
Ga0210382_1009982813300021080Groundwater SedimentGAAADQVLARAEADDAPFTRSDDLKAWVAQGLDELS
Ga0193699_1031796213300021363SoilRSGATADQVLAQADADDAPFSHSDELKAWVVQGLEELS
Ga0247752_102694533300023071SoilGLAAGASADEVLRRAAADDAPFAQNQELEQWVTQGLEELS
Ga0247794_1008993713300024055SoilSALIYLYAGLRAGASAEDVFARAEADDAMFVQSDELRAWVADGLKQLS
Ga0207699_1009151613300025906Corn, Switchgrass And Miscanthus RhizosphereLVYLYSGLKEGATADEVLARAEADDAPFARSEELRAWVAQNLDALS
Ga0207663_1128128623300025916Corn, Switchgrass And Miscanthus RhizosphereSSAAVYLYAGLRAGAPAEEVLASAAAEGAPFSGMPPLEAWVTQGLAELA
Ga0207687_1103441923300025927Miscanthus RhizosphereLRAGASADEVLARAEADDAPFIRSDELKSWVAQNLEELS
Ga0207700_1045230323300025928Corn, Switchgrass And Miscanthus RhizosphereALVYLYSGLKEGATADEVLARAEADDAPFARSEELRAWVAQNLDALS
Ga0207701_1089408413300025930Corn, Switchgrass And Miscanthus RhizosphereRSSAVIYLYAGLRSGASSDEVLARAGADDAPFTKSDELVAWVRQGLADLA
Ga0207709_1052722623300025935Miscanthus RhizosphereAGLRAGASADEVLARAEADDAPFIRSDELRSWVAQNLEELS
Ga0207691_1161168523300025940Miscanthus RhizosphereGASADDVLARAEADGAPFADADPLRAWVVQGLAELA
Ga0207689_1110645713300025942Miscanthus RhizosphereLVTCRTGGRSAALIYLYAGLKGGASADDVLSRAAADGAPFMGSDELKAWIAQGLDELG
Ga0207667_1060722713300025949Corn RhizosphereGLKAGASADEVIARAEADGAPFAGSEELETWVRQGLDELD
Ga0207651_1084229913300025960Switchgrass RhizosphereTCRTGGRSAALIYLYAGLKGGASADDVLARAAADGAPFMGSDELKTWIAQGLDELG
Ga0208421_101448613300026058Natural And Restored WetlandsNAPADEVLRRAEADDAPFAKSDELRAWVTQGLEELPELGR
Ga0208423_100420513300026070Natural And Restored WetlandsLVYLYAGLKAGATADEVLTRAEEDEAPFTGSDDLKAWVAQGLHQLS
Ga0207702_1152289433300026078Corn RhizosphereAGLRAGSTAEEVLERAEADDALFVRSDELRAWVVDGLAQLS
Ga0209156_1048498713300026547SoilYAGLRAGAPAEDVLARAEADDASFVRSDELRAWVTDGLTQLS
Ga0209577_1013957713300026552SoilAVVYLYAGLRAGASPDEVLARADADGAPFAGSDELRGFVVQGLHELAPDNT
Ga0207509_10415433300026816SoilLESGASADDVLARAEADDAPWARSDGLRAWVTDGLEQLR
Ga0209580_1054551923300027842Surface SoilRSSAVIYLYAGLEAGASAEAVLARAEADGAPFYASDELKAWVSQGLDELS
Ga0307279_1000346533300028709SoilGLRAGASADEVLERAEADDAPFIRSDELKSWVAQNLEELS
Ga0307307_1025905513300028718SoilSSALVYLYAGLRAGAGPDDVLARAEADGAPFAGSDELKGWVTQGLDELS
Ga0307316_1022736613300028755SoilSGLKAGASADEVIARAEADGAPFAQSDELKAWVTQGLGELSEK
Ga0307316_1030054423300028755SoilRAGASAGEVLARAEADGAPFCGSDELKAWVTQGLDELA
Ga0307282_1012366933300028784SoilLTAGAGPDDVLARAEADGAPFAGSDELKGWVTQGLDELS
Ga0307504_1048720313300028792SoilGPRSAAVAYLYAGLRAGASADDVLARADADAAPFAGVDAFRAFVTRGLEELRTEAQ
Ga0307284_1000729953300028799SoilLFRSDEVLARAEADDAPFIRSDELKSWVAQNLEELS
Ga0307310_1001827613300028824SoilAGATADAVLARADADDAPFAGSDELRAWVTRGLDELS
Ga0307304_1050818523300028885SoilLVYLYAGLKAGATADDVLARADADDAPFAGSDELRAW
Ga0247827_1090854913300028889SoilGAAADAVLARAEADGAPFCGSDELKAWVAQGLDELS
Ga0299907_1054537213300030006SoilVYLYSGLRAGASSGEVLARADADGAPFAGFDDLRAFVTEGLTELAPDA
Ga0310038_1046630013300030707Peatlands SoilKAGASADDVLERAESDGAPFVGSDALRSWVMQGLSELAPPEA
Ga0102757_1136289323300030785SoilAGAAADEVLARAEADDAPFSHSDDLRAWVTQGLDELS
Ga0170824_10071692613300031231Forest SoilYLYAGLRAEASVEEVLARADADDAPFVRSEELLAWITEGLAQLSSK
Ga0170824_11511912733300031231Forest SoilPRSSALVYLYAGLRAGATAEEVLARAEADDAPFFGSAELKAWVVQGLEELS
Ga0307506_1004283923300031366SoilPRSSALIYLYAGLQAGAQTEDVLARAEADGAAFVQSDELRAWVADGLEQLS
Ga0318534_1065856913300031544SoilPALIYLYAGLQAGATAEDVLARAEADGAVFVQSDELRAWVTDGLTQLAAT
Ga0318573_1017887213300031564SoilLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS
Ga0318573_1027493513300031564SoilLYAGLLAGASAEDVLARADEDDAPFVGSAELRAWITDGLTQLSSN
Ga0310813_1102700813300031716SoilIYLYAGLQAGASADDVLPRAAADDAAFVQSDELRAWVADGLEQLS
Ga0306917_1060617913300031719SoilGGASADEVLERAQADGAPFIDAGPLKAWVAQGLAELS
Ga0318493_1071336213300031723SoilCRTGPRASALVYLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS
Ga0318492_1030188713300031748SoilLYAGLRAGASVDEVLERAEADGAPFIGAEPLKAWVAQGLAELP
Ga0318509_1074127523300031768SoilLIYLYAGLQAGATAEDVLARAEADGAVFVQSDELRAWVTDGLTQLAAT
Ga0318521_1018259913300031770SoilPRASALVYLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS
Ga0318546_1028037513300031771SoilGPRASALVYLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS
Ga0318546_1104779813300031771SoilVYLYSGLRSGASADEVLARAEADGAPFVQAEPLKEWVVQGLSQLHPEVVDR
Ga0318566_1041802513300031779SoilIYLYAGLLAGASAEDVLARADEDDAPFVGSAELRAWITDGLTQLSSN
Ga0318547_1042693523300031781SoilVYLYAGLRSGASADQVLARAEADEAPFTQAEPLKAWVEQGLAELS
Ga0318567_1025568613300031821SoilSALVYLYSGLLSGAPADDVLARAEADGAPFTQAEPLKAWVTQGLAELS
Ga0310907_1047655323300031847SoilAGLKAGASAEEVLARAEADGAPFVASDALVAWVEQGLVELGESPA
Ga0310904_1113140923300031854SoilKAGASAEEVLARAEADDAPFVASDELKAWVTQGLTELA
Ga0318527_1034645113300031859SoilYLYAGLQAGASADDVLARAEADDAVFVKSDELRAWVADGLEQLS
Ga0318520_1070432723300031897SoilGLQAGATADEVLARADADSAPFAKVEEYRALVARGLDELANDD
Ga0308176_1131462113300031996SoilALIYLYAGLRAGASPDDVLARAETDHAQFVKSDELRDWVAKGLVQLS
Ga0318562_1084029613300032008SoilLYAGLRAGASADEVLERAEADGAPFIEAEPLKAWVAQGLAELS
Ga0318514_1039655133300032066SoilVTCRTGPRSAALIYLYAGLLAGASAEDVLARADEDDAPFVGSAELRAWITDGLTQLSSN
Ga0318553_1064756023300032068SoilALSSSALIYLYSGLRAGASADDVLERAEADGAPWTQSDELKAWVRQGLDELA
Ga0307471_10280324123300032180Hardwood Forest SoilAGASTEDVLARAETDGAAFVQSDDLRAWVANGLEQLS
Ga0307471_10431278023300032180Hardwood Forest SoilLRSGASAHEELARAEADGAPVTEAEPLKAWVVQGLAELS
Ga0307472_10219008133300032205Hardwood Forest SoilRSSALVYLYAGLRAGATADEVLARAEADDAPFFASDELKAWVAQGLDELG
Ga0335085_1016020243300032770SoilVTDFETPTDLIYLYAGLRAGVSAEAVLARAEADDAAFLKSDELRTWVATGLEQLS
Ga0335082_1019691823300032782SoilVTDFETPTDLIYLYAGLRAGASAEAVLARAEADDAAFLRSDELRIWVATGLEQLS
Ga0335080_1166587823300032828SoilVTDFETPTDLIYLCAGLRAGASAEDVLARAEADDAAFLKSDELRIWVATGLEQLS
Ga0335083_1006983753300032954SoilYAGLRAGVSAEAVLARAEADDAAFLKSDELRTWVATGLEQLSRPPREGHA
Ga0335084_1105010023300033004SoilVTDFETPTDLIYLYAGLRAGASAEAVLARAEADDAAFLKSDELRTWVATGLEQLS
Ga0335077_1038137333300033158SoilVTDFETPTDLIYLYAGLRAGASAEDVLARAEADDAAFLKSDDLRTWVATGLEQLS
Ga0247829_1056542823300033550SoilVYLYAGLRAGASGDEVLARAEADDAPFIRSDELKSWVAQNLEELS
Ga0247830_1065811613300033551SoilSAVIYLYAGLQQRASAEEVLARAERDGAMFVADEGLKAWVTEGLTELA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.