Basic Information | |
---|---|
Family ID | F028060 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 192 |
Average Sequence Length | 44 residues |
Representative Sequence | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNA |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 192 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 93.89 % |
% of genes near scaffold ends (potentially truncated) | 93.23 % |
% of genes from short scaffolds (< 2000 bps) | 93.75 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (98.958 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (51.042 % of family members) |
Environment Ontology (ENVO) | Unclassified (87.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (84.896 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 98.96 % |
All Organisms | root | All Organisms | 1.04 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 51.04% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 33.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.12% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 2.60% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010263 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 16_60_3.3_214_A3 metaG | Engineered | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028057 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032548 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070666_104446121 | 3300005335 | Switchgrass Rhizosphere | MEWVGCIRCEKIQNDFMAQTCALIAPVQPVLQRVSCSNETLPNAPKHYET |
Ga0070669_1005615331 | 3300005353 | Switchgrass Rhizosphere | MEWVGCIRYEKFQNDFMTQTCALIAPVQPVLQRVLCSNETLPNAPK |
Ga0068859_1006883761 | 3300005617 | Switchgrass Rhizosphere | MGLIGCVRGEKFQNDFMAQTSALIALVQPVLHRVS |
Ga0068859_1007310132 | 3300005617 | Switchgrass Rhizosphere | MKWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLP |
Ga0068861_1025744861 | 3300005719 | Switchgrass Rhizosphere | MEWVGSIRCEKFQNDFMAQTCALIAPVQPVLHRVSCSNET |
Ga0068863_1008856181 | 3300005841 | Switchgrass Rhizosphere | MEWVWCIRCVKFQNDFMTQTCALIAPVQPVLQRVLCSNETLPNAPKYYE |
Ga0068863_1012350861 | 3300005841 | Switchgrass Rhizosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNE |
Ga0068863_1016394702 | 3300005841 | Switchgrass Rhizosphere | MECVGCVLCEKFYNEFMAETCALIAPVQPVMHRVSCSNETLPNAPKHYE |
Ga0068863_1019808131 | 3300005841 | Switchgrass Rhizosphere | MEWVGSIRYEKLQNDFMAQTCALIAPVQPVLHRVSCSNETLPNAPKHYEM |
Ga0068863_1023436542 | 3300005841 | Switchgrass Rhizosphere | MEWVGCIRCAKFQNDFMAQTCALIALVQPVLQRVSCSNEILPNAPKHYETHTNMS |
Ga0068863_1025022091 | 3300005841 | Switchgrass Rhizosphere | MEWVGCIRGEKFQNDFMAQTCALIALVQPVLHRVSCSNE |
Ga0068858_1013151141 | 3300005842 | Switchgrass Rhizosphere | MEWVRRVRFEKFKNDFMAQTCALIAPVQPVLQRVS |
Ga0068858_1018320211 | 3300005842 | Switchgrass Rhizosphere | MESIGCIRGEKFPNDFHAQTCALIAPVQPVLYRVSCSNETLPNAPK |
Ga0068860_1009699212 | 3300005843 | Switchgrass Rhizosphere | MEWVGCIRCEKFQNDFMAQTCALITPVQPVLQRVTCSNE |
Ga0105133_1027531 | 3300009981 | Switchgrass Associated | MEWVGCIRCEKFQNDFMAQTCALIAPVQPILHRVSCSNETLPNGPKH |
Ga0105131_1149952 | 3300009989 | Switchgrass Associated | GCIRCEKFQNDFMTQTCALIAPVQPVLQRVSCSNETLPNAPK* |
Ga0105132_1021352 | 3300009990 | Switchgrass Associated | MESVGCIRGEKFQNDFLAQTCALIAPVQPVLYRVSCSNETLPNAP |
Ga0105132_1460631 | 3300009990 | Switchgrass Associated | MGWIGCFRCQIFQNDLMAQTCALIALVQPVLQRVL |
Ga0105139_10414601 | 3300009995 | Switchgrass Associated | MVWVRCFRCEKFQNDFMAQTCALIAPVQPVLQRDSCSNETLPNAPKHYETHQNTSLW |
Ga0134105_10637621 | 3300010263 | Switchgrass Degrading | MEWVRCIRCEKFQNDFIAQTCALIAPVQPVLQRISCSYEKLPNAPKHYETHTNMSL |
Ga0134122_133477211 | 3300010400 | Terrestrial Soil | MEWVGCIRCEKFQNDFMAQTCPLIAPVQPVLQRLSSSNETLPNAPKHYETHQNMSLGS |
Ga0157379_113432231 | 3300014968 | Switchgrass Rhizosphere | MEWVGCIRCEKFQNDFMAQTCALITPVQPVLQRVSCNNETL |
Ga0182183_10352622 | 3300015270 | Switchgrass Phyllosphere | MEWVGSIRYEKLQNDFMAQTCALIAPVQPVLHRVSCSNETLPNA |
Ga0182183_10469111 | 3300015270 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNAP |
Ga0182099_10416021 | 3300015278 | Switchgrass Phyllosphere | MEWVGCILCDKFQNDIMAQTCALIAPVQLILQRVSCSNETLPNAPKHYETHQNMSLG |
Ga0182100_10523911 | 3300015280 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDIMAQTSALIAPVQPVLQRVSCSNETLPNA |
Ga0182101_10657431 | 3300015284 | Switchgrass Phyllosphere | MVWVRCFRCEKFQNDFMAQTCALIAPVQPVLQRDSCSNETLPNAPVQFIL |
Ga0182101_10834421 | 3300015284 | Switchgrass Phyllosphere | MEWVGCIHCEKLQNDFMAQTCALIAPIQPVLQRVSCS |
Ga0182105_10251371 | 3300015290 | Switchgrass Phyllosphere | MGWVGSVRCEKFQNDFMAQTCALIAHVQPVLHRVSCSNETLPNAPKHYEMH |
Ga0182105_10977851 | 3300015290 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNAH |
Ga0182104_10461711 | 3300015297 | Switchgrass Phyllosphere | MMWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPKAPKHYETHQNMSLGSNG |
Ga0182104_10683802 | 3300015297 | Switchgrass Phyllosphere | MEWVRCVRCEKFKNDFMAQTCALIAPVQLVLQRVSCSNETLPNAPKH |
Ga0182104_10832711 | 3300015297 | Switchgrass Phyllosphere | MGWISCVRCEKFQNDFMAQTCTLIAPVQPVLQRVLCSNETLPNAPKHYE |
Ga0182162_10630181 | 3300015310 | Switchgrass Phyllosphere | MEWVRCIRCEKVKTDIMAQTCALIATVQPVLQRVSCSNEILPNAP |
Ga0182162_11076211 | 3300015310 | Switchgrass Phyllosphere | MEWVGSIRCEKFQNDFMAQTCALIAPVQPVLHRVSCSNETLPNAPKHYE |
Ga0182182_10119032 | 3300015311 | Switchgrass Phyllosphere | MSIGPMEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSSSNE |
Ga0182168_10966571 | 3300015312 | Switchgrass Phyllosphere | MEWVGSIRYEKLQNDFMAQTCALIAPVQPVLHRVSCSNETLPNGPKHYEMHQN |
Ga0182164_11152281 | 3300015313 | Switchgrass Phyllosphere | MEWVGSIRYEKLQNDFMAQTCALIAPVQPVLHRVSCSNE |
Ga0182120_10694031 | 3300015315 | Switchgrass Phyllosphere | MEWVRCIRCEKVKNDFMAQTCALIATVQPVLQRVSCSNEILPN |
Ga0182120_10772601 | 3300015315 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTFALIAPVQPILHQASCINETI |
Ga0182120_11344971 | 3300015315 | Switchgrass Phyllosphere | MEWVGCGRCEKFQNDFMAQTYALIAPVQPVLQQVSCSNETLPN |
Ga0182121_10743761 | 3300015316 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNA |
Ga0182121_10983611 | 3300015316 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMTQTCALIAPVQPILHRVLCSNETLPNGPKHYETHQNMS |
Ga0182136_10296761 | 3300015317 | Switchgrass Phyllosphere | EWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVS* |
Ga0182136_10639491 | 3300015317 | Switchgrass Phyllosphere | MEWVGGIRCEKYQNDFMAQTCALIAPVQPVLHRVSCSNETLPNA |
Ga0182130_10663401 | 3300015319 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLHRVSCSNETLPN |
Ga0182134_10326771 | 3300015324 | Switchgrass Phyllosphere | MEWIVCVHCEKFQDDFMAQTCALIAPVQPILQRVSCSN |
Ga0182134_10706021 | 3300015324 | Switchgrass Phyllosphere | MEWVGSIRCEKVQNDFMAQTCALIAPVQPVLQRVSCSNETLPNASKH |
Ga0182148_11011341 | 3300015325 | Switchgrass Phyllosphere | MEWVGSIRYEKLQNDFMAQTCALIAPVQPVLHRVS |
Ga0182148_11291891 | 3300015325 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMTQTCALIAPVQPILHRVL |
Ga0182166_10032111 | 3300015326 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNAPKHYET |
Ga0182166_10342802 | 3300015326 | Switchgrass Phyllosphere | MEWVGCIHCEKFQIDFMAQTCALIAPVQPILHRVSRSNET |
Ga0182166_10877501 | 3300015326 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALITPVQPVLQRVTCS |
Ga0182166_11260911 | 3300015326 | Switchgrass Phyllosphere | MEWVRCVPCEKFKNDFMAQTCALIAPVHPVWHQASCINETIQNAHKHYETQQCM |
Ga0182166_11376571 | 3300015326 | Switchgrass Phyllosphere | MEWVGCIRGEKFQNDFLAQTCALIAPVQPVLYRVSCSNETLPN |
Ga0182166_11390291 | 3300015326 | Switchgrass Phyllosphere | MEWVGCIRFEKFQNDFMAQTCALIAPVKPVLHRVSCSNETLPNAPKYYETHQN |
Ga0182153_10407731 | 3300015328 | Switchgrass Phyllosphere | MEWVGCIRGEKFQNDFMAQTCALIAPVQPVLYRVSCSNETLPNAPKHYET |
Ga0182153_10680731 | 3300015328 | Switchgrass Phyllosphere | MEWAGCIHYEKFENDFMAQTCALIAPVQPVLHRVSCS |
Ga0182153_11196981 | 3300015328 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCPIIAPVQPVLQRVSCSNETLLNASKQYE |
Ga0182153_11433141 | 3300015328 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNEFMAQTFALFAPVHPILHQASCINETIQ |
Ga0182135_10105351 | 3300015329 | Switchgrass Phyllosphere | MEWVGCIHCEKFQIDFMAQTCALIAPVQPILHRVSRSNE |
Ga0182135_10800061 | 3300015329 | Switchgrass Phyllosphere | MGGIGCVRFEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLP |
Ga0182135_10864541 | 3300015329 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSC |
Ga0182135_11091131 | 3300015329 | Switchgrass Phyllosphere | MEWAGCIRCEKFQNDVMAQTCALIAPVQPVLHRVSCSNEILPNAPK |
Ga0182152_10837931 | 3300015330 | Switchgrass Phyllosphere | MEWVRCVPCEIFKNDFMAQTCALIAPVQPVLQRVSCSNETLPNAPKHYE |
Ga0182117_10543501 | 3300015332 | Switchgrass Phyllosphere | MEWVGCIRYEKFQNDFMAQTCALSAPVQPVLQRVSCSNETLPNAP |
Ga0182117_11424471 | 3300015332 | Switchgrass Phyllosphere | MEWVGCFRCEKFQNDFMAQTCALIAPVQPVLKRVSCSNET |
Ga0182147_11376471 | 3300015333 | Switchgrass Phyllosphere | MEWVRCIRCKKFQNDFMAQTCALIAPVQHILQRVSCSNETLPNAPKHYETHQNMSLG |
Ga0182116_10214412 | 3300015335 | Switchgrass Phyllosphere | MEWVGCIRSEKIKNDFMAQTCALIAPVQPVLQRVSCSNETLPN |
Ga0182116_11179991 | 3300015335 | Switchgrass Phyllosphere | MEWVGCIHGEKFQNDFMAQTCAFIAPVQPVLHRVSGCKETLPNAPTYYET |
Ga0182116_11438881 | 3300015335 | Switchgrass Phyllosphere | MGWISCVRCEKFQNDFMAQTCVLIAPVQPVLQRVSCSNETLPNAPKHYETHT |
Ga0182116_11712651 | 3300015335 | Switchgrass Phyllosphere | MEWFGSIRCEKFQNNFMAQTCTLIAPVQPVLQRDSCSNE |
Ga0182137_11156671 | 3300015338 | Switchgrass Phyllosphere | MESVGCIRCEEFQNDFMVQTCTIIAPVQPVLQRVSCSNETLPNEPKHYE |
Ga0182149_11372011 | 3300015339 | Switchgrass Phyllosphere | MERIGCIRSEKFQNDFMTQTCALIAPVQPVLHRVSCSNETLPNA |
Ga0182149_11694151 | 3300015339 | Switchgrass Phyllosphere | MERVGCIRGEKFQNDIMAQTCALIAPVQPILYRVSCSNETLPNAPKHYETH |
Ga0182133_11261522 | 3300015340 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALITPVQPVLQRVSCSNETL |
Ga0182133_11551372 | 3300015340 | Switchgrass Phyllosphere | MEWVVCVLCEKFHNEFMAQTCALIAPVQPVLQRVSCSNEILPNAPKHYETH |
Ga0182115_11160132 | 3300015348 | Switchgrass Phyllosphere | MEWVRCIRCEKFQNDFMAQTCALIAPIQPVLHRVSCSNETLPNA |
Ga0182115_12395412 | 3300015348 | Switchgrass Phyllosphere | MEWVVCVLCEKFHNEFMAQTCALIAPVQPVLQRVSCS |
Ga0182163_11286902 | 3300015350 | Switchgrass Phyllosphere | CEKFQNDFMAQTCALIAPVQPILHPVSGCNETLQNAP* |
Ga0182163_11521461 | 3300015350 | Switchgrass Phyllosphere | MERIGCIRCEKFQNDFMTQTFALIAPVHHVLHQASCINETIQNAPKHYETQ |
Ga0182163_12446101 | 3300015350 | Switchgrass Phyllosphere | MEWVGCIRSEKFQNDFMAQTCALIAPVQPVLQRVSSSNETLPNAP |
Ga0182163_12892821 | 3300015350 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNEFMAQTFALIAPVHPVLHQASCINETI |
Ga0182169_10242102 | 3300015352 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDLMTQTCALIAPVQPVLHRVSCSNETMPNAP |
Ga0182169_11421701 | 3300015352 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMTQTCALIAPVQPILHRVLCSNE |
Ga0182179_11406051 | 3300015353 | Switchgrass Phyllosphere | MGWISSVRCEKFQNDFMAQTCVLIAPVQPILQRVS |
Ga0182167_11935351 | 3300015354 | Switchgrass Phyllosphere | MEWVGSIRCEKFQNYFMAQTCALIAPVQPILQRVSCSNETLP |
Ga0182197_11497141 | 3300017408 | Switchgrass Phyllosphere | MEWVGCIRGEKFQNDFMAQTCALIAPVQPILYRVSCS |
Ga0182199_10200511 | 3300017412 | Switchgrass Phyllosphere | MEWVGCIRGEKFQNDFMAQTCALIAPVQPILYRVSCSNETLPNAPKHYETHQNM |
Ga0182199_10874401 | 3300017412 | Switchgrass Phyllosphere | MGWIVCVHCEKFQDDFMAQTCALIAPVQPILQRVSCSNETLPNASKHYEAH |
Ga0182199_11478451 | 3300017412 | Switchgrass Phyllosphere | MEWVGSIRYEKLQNDFMAQTCALIAPVQPVLHRVSCSNETLPNAPKHY |
Ga0182195_11399611 | 3300017414 | Switchgrass Phyllosphere | MEWVGCICCEKFQNDFMAQTCALIAPVQPVLQRVS |
Ga0182213_12111561 | 3300017421 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNAHKH |
Ga0182201_10255502 | 3300017422 | Switchgrass Phyllosphere | MEWVRCVRCEKFKNDFMAQTCALIAPVQPVLQRVLCSNETLPNAPKH |
Ga0182201_10555881 | 3300017422 | Switchgrass Phyllosphere | MESVGCIRCEEFQNDFMVQTCTIIAPVQPVLQRVSCSNETLPN |
Ga0182194_10182671 | 3300017435 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNATKHY |
Ga0182194_10613971 | 3300017435 | Switchgrass Phyllosphere | MEWVGCIRCEKFHNKFMAQTCALIAPVQPFVHRVSCSNETLPNAPKN |
Ga0182200_10511971 | 3300017439 | Switchgrass Phyllosphere | MESVGCIRCEEFQNDFMVQTCTIIAPVQPVLQRVSCSNETLPNEPK |
Ga0182200_11010581 | 3300017439 | Switchgrass Phyllosphere | MEWVGCIRCEKLQNNFMAQTCALIAPVQPVLQRVS |
Ga0182214_11261771 | 3300017440 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLHRVSCSNETLPNAPK |
Ga0182198_10172361 | 3300017445 | Switchgrass Phyllosphere | MESVGCIRCEEFQNDFMVQTCTIIAPVQPVLQRVSCSNETLPNEPKHYETHQNIC |
Ga0182198_10203711 | 3300017445 | Switchgrass Phyllosphere | MEWVRCIRCEKFQNDFMAQTCALIAPVQPILQQVLCSNETL |
Ga0182198_10311602 | 3300017445 | Switchgrass Phyllosphere | MEWVGSIRYEKLQNDFMAQTCALIAPVQPILRRVSCSNETLPNAPKH |
Ga0182198_10587251 | 3300017445 | Switchgrass Phyllosphere | MEWVRCIRCKKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNAPKHY |
Ga0182198_10943151 | 3300017445 | Switchgrass Phyllosphere | MGWIECVRCEKFQCDLMAQTCPLIAPAQPILQRVL |
Ga0182198_11729481 | 3300017445 | Switchgrass Phyllosphere | MEWVGCIRREKFQNNFMAQTCALIAPVQPILHRLPCSIETLPNALKHE |
Ga0182198_12031341 | 3300017445 | Switchgrass Phyllosphere | MEWVGCIRGENFQNDFMAQTCALIAPVQPILYRVSC |
Ga0182217_10777501 | 3300017446 | Switchgrass Phyllosphere | MEWVGCIRCEKFHNKFMAQTCALIAPVQPFVHRVSCSNETLPNAPK |
Ga0182216_11459841 | 3300017693 | Switchgrass Phyllosphere | MGGIGCVRCEKFQNDFMAQTCALIAPVQTVLQRVSCSNETLPNAPK |
Ga0182216_11922141 | 3300017693 | Switchgrass Phyllosphere | MESVRCIRGEKFQNDFLAQTSALIAPVQPILYRVSCSNETLPNA |
Ga0182216_11980541 | 3300017693 | Switchgrass Phyllosphere | MECVRCIRCEKFQNDFMTQTCALIATVQPVLQRVSCSNETLPNAPKHYEMHQNMSLW |
Ga0182211_11320971 | 3300017694 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFIAQTCALIAPVQPALHRVLC |
Ga0182211_11326361 | 3300017694 | Switchgrass Phyllosphere | MESVGCIRCEEFQNDFMVQTCTIIAPVQPVLQRVSCSNETLPNE |
Ga0182211_11769361 | 3300017694 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIALVQPVLQRVSCSNEILPNAPKHYE |
Ga0182178_10024231 | 3300020023 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIASVQPVLQRVSCSNET |
Ga0182146_1059621 | 3300020033 | Switchgrass Phyllosphere | MEWVGSICGEKFQNDFMAQICALIAPVQPVLYRVS |
Ga0207680_104051102 | 3300025903 | Switchgrass Rhizosphere | MEWVRCVRCEKFKNDFMAQTCALIAPVQPVLHRVSCINETLPNAPKHY |
Ga0207680_105041771 | 3300025903 | Switchgrass Rhizosphere | MESVGCIRCEEFQNDFMVQTCTIIAPVQPVLQRVSCSNETLPNEPKHYETHQN |
Ga0207662_110951971 | 3300025918 | Switchgrass Rhizosphere | MEWVRCIRCEKFQNDFMAQTCALIAPVQPILQQVL |
Ga0207650_119100891 | 3300025925 | Switchgrass Rhizosphere | MEWVGCILCDKFQNDFMAQTCALIAPVQLVLQRVSCSNETLPNAPKHYET |
Ga0207668_115804241 | 3300025972 | Switchgrass Rhizosphere | MEWVRCIRCEKFQNDFMAQTCALIAPVQHILQRVSCSNETLPNAP |
Ga0207641_121087621 | 3300026088 | Switchgrass Rhizosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNAPKH |
Ga0207676_105764802 | 3300026095 | Switchgrass Rhizosphere | PMECVGCIRCEKFQNDFMAQTCALIALVQPVLQRVSCSNEILPNAPKHYEMH |
Ga0268322_10048401 | 3300028049 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNATKHYET |
Ga0268328_10207781 | 3300028050 | Phyllosphere | MESFRCIRGEKLQNDFMARTSALIAQVHPVLYRVSCSNETLPNAPKYYETHQ |
Ga0268328_10338621 | 3300028050 | Phyllosphere | MEWVRCIRCEKFQNDFMAQTCALIAPVQPVLQRDSCSNETLPNAPKHYE |
Ga0268328_10435821 | 3300028050 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLP |
Ga0268346_10130391 | 3300028053 | Phyllosphere | MEWVGSIRCEKVQNDFMAQTCALIAPVQPVLQRVSCSNETL |
Ga0268346_10270481 | 3300028053 | Phyllosphere | MEWVGCIHCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNA |
Ga0268306_10035071 | 3300028054 | Phyllosphere | MGWISCVRCEKFQNDFMAQTCVLIATVLPVLQRVLCSIETLPNAPKHYETHTNM |
Ga0268306_10103451 | 3300028054 | Phyllosphere | MEWVGCIRGEKFQNDFMAQTCALIALVQPVLHRVSCSNETLPNAPKHY |
Ga0268306_10265211 | 3300028054 | Phyllosphere | MEWVGCIRGEKFQNDFMAQTCALIAPVEPVLYRVSCSNETLPNAPKHNK |
Ga0268338_10003773 | 3300028055 | Phyllosphere | MVWVRCFRCEKFQNDFMAQTCALIAPVQPVLQRDSCSNETL |
Ga0268338_10051601 | 3300028055 | Phyllosphere | MEWVGCIRCEKFQNDFIAQTCALIAPVQPALHRVL |
Ga0268338_10315461 | 3300028055 | Phyllosphere | MESVGCIRGEKFQNDFLAQTCALIAPVQPVLYRVSCSNETLPNAPKHYEMHQNMS |
Ga0268330_10022141 | 3300028056 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTFALIAPVQPILHQAS |
Ga0268330_10114781 | 3300028056 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNATKH |
Ga0268330_10431791 | 3300028056 | Phyllosphere | MEWVGSIRYEKLQNDFMAQTCALIAPVQPVLHRVSCSNETLP |
Ga0268330_10494261 | 3300028056 | Phyllosphere | MEGVTCVRCEKFKNDFMAQTCALIAPVQPVLQRVSCSNETL |
Ga0268352_10162151 | 3300028057 | Phyllosphere | MGLVGCICREKFQNEFMAQTCALIAHVQPILDRVSCSNETLPNAPK |
Ga0268352_10254211 | 3300028057 | Phyllosphere | MGWISCVRCEKFQNDFMAQTCVLIATVLPVLQRVLCSIETLPNAPKHYGTHTNM |
Ga0268332_10089771 | 3300028058 | Phyllosphere | MGWIGCVPCEKFQYDFMAQTCALNAPVYPVLPRVS |
Ga0268332_10097901 | 3300028058 | Phyllosphere | MEWVGCIHCEKFQIDFMEQICALIAPVHPILHRVSCSNETLPNAPKHYKT |
Ga0268332_10197221 | 3300028058 | Phyllosphere | MEWVGCIRGEKFQNDFMAQTCALIAPVQTVLYRVSCSNETLPN |
Ga0268332_10402551 | 3300028058 | Phyllosphere | MEWVGCIRCEIFQNDVMAQTCALIAPVQPVLRRVSCSNEIL |
Ga0268332_10464611 | 3300028058 | Phyllosphere | MEWVGCICCEKFQNDFMAQTCALIAPVQPVLQQVSCSNEKLPNA |
Ga0268332_10483381 | 3300028058 | Phyllosphere | MEWVRSIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNALKH |
Ga0268314_10062331 | 3300028061 | Phyllosphere | MEWVGCIRYKKFQNDFMAQTCALIAPVQPVLQQALCSYKTIQNASKHYE |
Ga0268342_10111581 | 3300028062 | Phyllosphere | MVWVRCFRCEKFQNDFMAQTCALIAPVQPVLQRDSCSNETLPNAP |
Ga0268342_10137851 | 3300028062 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETL |
Ga0268342_10147911 | 3300028062 | Phyllosphere | MEWVGCIHCEKFQIDFMAQTCALIAPGQPILHRVWRS |
Ga0268342_10392671 | 3300028062 | Phyllosphere | MEWVRCIRCEKFQNDFMAQTCALIAPVQHILQRVSCSNETLPNAPK |
Ga0268342_10425481 | 3300028062 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTYALIAIVQPVLQRVSCSNEILPN |
Ga0268340_10215572 | 3300028064 | Phyllosphere | MEWVGCIRCEKFQNDFMTQTCALIAPVQPILHRVLCSNETL |
Ga0268355_10088971 | 3300028139 | Phyllosphere | MKWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNET |
Ga0268334_10141361 | 3300028140 | Phyllosphere | MEWVRCIRCEKVKNDFMAQTCALIATVQPVLQRVSCSNEILPNA |
Ga0268326_10077762 | 3300028141 | Phyllosphere | MEWIGCVHCEKFRCDIVAQTCALIAPFQPVLHLALSINETLPNAPKHYETHQNR |
Ga0268348_10058131 | 3300028143 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTFALIASVQPVLQRVSCSN |
Ga0268348_10237611 | 3300028143 | Phyllosphere | MEWVGSIRCEKFQNYFMAQTCALIAPVQTILQRVSCSNETLPSAPKHYETHQNMSLGSNG |
Ga0268345_10211841 | 3300028144 | Phyllosphere | CIRCEKFQNDFMAHTCALIAPVQPVLQRVSCSNET |
Ga0268343_10119681 | 3300028150 | Phyllosphere | MEWVGCICCEKFQNDFMAQTCALIAPVQPVLQRVSCSNEKLPN |
Ga0268308_10156241 | 3300028151 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCGLIAPVQPVLHRVSCSNETLP |
Ga0268320_10221681 | 3300028153 | Phyllosphere | MEWVRYIRCKKFQNDFMAQTCALIAPVQPILQRVSCSA |
Ga0268320_10241571 | 3300028153 | Phyllosphere | MEWVGSIRYEKLQNDFMAQTCALIAPIQPVLHRVSCSNE |
Ga0268341_10317441 | 3300028154 | Phyllosphere | MEWVGCIRGEKFQNDFMAQTCALIAPVQPVLHRVSGSNETLPNAPKH |
Ga0268312_10380701 | 3300028248 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSCSNETLPNATKHYETHKNLSLG |
Ga0268324_10191691 | 3300028251 | Phyllosphere | MEWVGCIRGEKFQNDFMAQTCALIAPVKPVLHRVSCSNETLP |
Ga0268316_10055281 | 3300028253 | Phyllosphere | MEWFGGIRCEKFQNDFMTQTCALIAPAQPNLHQVSCSNETLPNAPKHYETHQ |
Ga0268310_10164541 | 3300028262 | Phyllosphere | MGWIVCVHCEKFQDDFMAQTCALIAPVQPILQRVSCSNETLPNASKH |
Ga0268264_117470931 | 3300028381 | Switchgrass Rhizosphere | MEWVGCIRCEKFQNGFMAQTCALIALVQPVLQRVS |
Ga0268302_1010101 | 3300028464 | Phyllosphere | MEWVGCIHCEKFQIDFMAQTCALIAPVQPILHRVSCINET |
Ga0268302_1021391 | 3300028464 | Phyllosphere | MEWVECIRCEKFQNDFMAQTCALIAPVQPILQRVS |
Ga0268302_1044791 | 3300028464 | Phyllosphere | MECVRCIRCENFQNDFMAQTCALIATVQPVLQRVSCSNETLPNAPKHYEMHQNM |
Ga0268317_10021441 | 3300028468 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQHVLQRVS |
Ga0268337_10014981 | 3300028469 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQRVSSS |
Ga0268307_10068321 | 3300028470 | Phyllosphere | MEWVGCIRCEKFQNDFMTQTCALIAPVQPVLQRVSC |
Ga0268307_10090571 | 3300028470 | Phyllosphere | MEWVGCISCEKFQNDFMAQTCALIAPVQPILHRVSRSNETLPNAPKHYE |
Ga0268315_10075351 | 3300028472 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALNAPVQPVLQRVSCSNETLPN |
Ga0268315_10228661 | 3300028472 | Phyllosphere | MEWVGCIHGEKFQNDFMAQTCALIALVQPVLHRVSCSNETLPNAPKHYERHQNMSLWSN |
Ga0268327_10147601 | 3300028475 | Phyllosphere | MEWVGCIRCEKFQNDIMAQTSALIAPVQPILHQVSCS |
Ga0268309_10008411 | 3300028477 | Phyllosphere | MEWVGCIRGEKFQNDIMAQTCALIALVQPVLYRVSCSNETLPNA |
Ga0268313_10005671 | 3300028523 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLHRVSCSNETLPNAPEHYETHQNMSLW |
Ga0268313_10140941 | 3300028523 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIAPVQPVLHRVLCSNETLPSAPK |
Ga0268339_10205321 | 3300028526 | Phyllosphere | MEWVGSICGEKFQNDFMAQFCALIAPVQPVLYRVS |
Ga0268335_10017961 | 3300028527 | Phyllosphere | MSIGPMEWVGCIRCEKFQNDFMAQTCALIAPVQPVLQLVS |
Ga0268335_10155121 | 3300028527 | Phyllosphere | MEWVGCIRCEKFQNDFMAQTCALIELVQPVLQRVSC |
Ga0268311_10066141 | 3300028529 | Phyllosphere | MEWVGCIHCEKFQIDFMAQTCALIAPVQPILHRVSRSNETLPNAPK |
Ga0268311_10293882 | 3300028529 | Phyllosphere | MGWIVCVRCKQFQCDFMAQTCALILPFQPTLHRVLCSDETIQNAPKHYKTHQNMSLR |
Ga0214493_11681621 | 3300032465 | Switchgrass Phyllosphere | MEWVGCIRCEKFQNDFMAQTCSLIAPVQPVLQRVSCSNETLPNATKH |
Ga0214488_11147301 | 3300032467 | Switchgrass Phyllosphere | EKFHNKFMAQTCALIAPVQPFVHRVSCSNETLPNAPKN |
Ga0214483_10648601 | 3300032548 | Switchgrass Phyllosphere | MEWVGCIRCENFQNDFMAQTCALIAPVQPILQQVLCSNETLPNAPKHYETHQN |
Ga0314768_13412292 | 3300033523 | Switchgrass Phyllosphere | MSLVPMGWIECVLCEKFRYDFMAQTCALIALVQPVLHRVDKC |
⦗Top⦘ |