Basic Information | |
---|---|
Family ID | F028116 |
Family Type | Metagenome |
Number of Sequences | 192 |
Average Sequence Length | 46 residues |
Representative Sequence | MKPVDLAKKLRRDAAFEPAALDRGKAVLMAAIRQEVQPMRRPTIVPRL |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 192 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.48 % |
% of genes from short scaffolds (< 2000 bps) | 94.79 % |
Associated GOLD sequencing projects | 149 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.875 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (10.938 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.146 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.16% β-sheet: 0.00% Coil/Unstructured: 61.84% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 192 Family Scaffolds |
---|---|---|
PF08281 | Sigma70_r4_2 | 86.46 |
PF07883 | Cupin_2 | 1.56 |
PF00817 | IMS | 1.56 |
PF03447 | NAD_binding_3 | 1.04 |
PF12840 | HTH_20 | 1.04 |
PF01699 | Na_Ca_ex | 0.52 |
PF09084 | NMT1 | 0.52 |
PF00891 | Methyltransf_2 | 0.52 |
PF01695 | IstB_IS21 | 0.52 |
PF13458 | Peripla_BP_6 | 0.52 |
PF07238 | PilZ | 0.52 |
PF02538 | Hydantoinase_B | 0.52 |
PF12695 | Abhydrolase_5 | 0.52 |
PF01569 | PAP2 | 0.52 |
PF00892 | EamA | 0.52 |
PF02653 | BPD_transp_2 | 0.52 |
PF00528 | BPD_transp_1 | 0.52 |
PF04542 | Sigma70_r2 | 0.52 |
COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
---|---|---|---|
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 1.56 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.04 |
COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.52 |
COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.52 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.52 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.52 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.52 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.52 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.52 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.52 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.88 % |
Unclassified | root | N/A | 3.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004157|Ga0062590_100048915 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
3300004633|Ga0066395_10093349 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300005166|Ga0066674_10249063 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 842 | Open in IMG/M |
3300005168|Ga0066809_10153164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
3300005174|Ga0066680_10366600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
3300005178|Ga0066688_10261976 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300005332|Ga0066388_100674571 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
3300005332|Ga0066388_100975944 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300005338|Ga0068868_100525849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1039 | Open in IMG/M |
3300005339|Ga0070660_100778511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
3300005347|Ga0070668_102122481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
3300005450|Ga0066682_10173508 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300005450|Ga0066682_10206245 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300005467|Ga0070706_100106563 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
3300005467|Ga0070706_101360078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
3300005471|Ga0070698_101629067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
3300005530|Ga0070679_100862169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 849 | Open in IMG/M |
3300005545|Ga0070695_101842673 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005558|Ga0066698_10497445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 828 | Open in IMG/M |
3300005568|Ga0066703_10468152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
3300005568|Ga0066703_10588708 | Not Available | 649 | Open in IMG/M |
3300005576|Ga0066708_10361191 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300005713|Ga0066905_100451821 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300005718|Ga0068866_11155650 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300005764|Ga0066903_100392793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2276 | Open in IMG/M |
3300005764|Ga0066903_105501366 | Not Available | 668 | Open in IMG/M |
3300005842|Ga0068858_101377234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 695 | Open in IMG/M |
3300005844|Ga0068862_100394254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1294 | Open in IMG/M |
3300006046|Ga0066652_100831001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 883 | Open in IMG/M |
3300006049|Ga0075417_10036370 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300006797|Ga0066659_11696892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300006845|Ga0075421_102074555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
3300006845|Ga0075421_102431188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
3300006846|Ga0075430_101436169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
3300006852|Ga0075433_10531696 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300006881|Ga0068865_100577023 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300006904|Ga0075424_102580198 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300006969|Ga0075419_10388497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 954 | Open in IMG/M |
3300007004|Ga0079218_12062173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
3300007076|Ga0075435_101340038 | Not Available | 627 | Open in IMG/M |
3300007255|Ga0099791_10416393 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
3300009090|Ga0099827_10571111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 974 | Open in IMG/M |
3300009098|Ga0105245_11335090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 766 | Open in IMG/M |
3300009100|Ga0075418_11322645 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 781 | Open in IMG/M |
3300009137|Ga0066709_102958058 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300009148|Ga0105243_11318558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
3300009157|Ga0105092_10787802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300009176|Ga0105242_13051346 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009176|Ga0105242_13267516 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300009792|Ga0126374_10555492 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 839 | Open in IMG/M |
3300009792|Ga0126374_11550959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
3300009797|Ga0105080_1045097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300009808|Ga0105071_1013215 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1115 | Open in IMG/M |
3300009813|Ga0105057_1082754 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300009820|Ga0105085_1071375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
3300009820|Ga0105085_1089249 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300010046|Ga0126384_10986393 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300010304|Ga0134088_10355632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 711 | Open in IMG/M |
3300010322|Ga0134084_10171456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 743 | Open in IMG/M |
3300010329|Ga0134111_10240337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
3300010336|Ga0134071_10231917 | Not Available | 916 | Open in IMG/M |
3300010358|Ga0126370_10373006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1162 | Open in IMG/M |
3300010358|Ga0126370_10871389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
3300010358|Ga0126370_11869000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
3300010360|Ga0126372_10216940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1610 | Open in IMG/M |
3300010360|Ga0126372_10452904 | Not Available | 1190 | Open in IMG/M |
3300010360|Ga0126372_12201339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
3300010360|Ga0126372_12688940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
3300010360|Ga0126372_12736312 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300010361|Ga0126378_12960167 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300010362|Ga0126377_12374998 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
3300010362|Ga0126377_13029804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300010376|Ga0126381_102171385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
3300010397|Ga0134124_12798344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300010398|Ga0126383_12141494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
3300012040|Ga0137461_1258530 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300012207|Ga0137381_10783823 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 827 | Open in IMG/M |
3300012211|Ga0137377_10334105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1451 | Open in IMG/M |
3300012351|Ga0137386_10218270 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300012357|Ga0137384_10278484 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300012358|Ga0137368_10345274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 991 | Open in IMG/M |
3300012361|Ga0137360_11112747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
3300012532|Ga0137373_10763120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
3300012685|Ga0137397_10230046 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300012685|Ga0137397_10364789 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300012918|Ga0137396_10342748 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300012922|Ga0137394_10173507 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
3300012927|Ga0137416_10574478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
3300012927|Ga0137416_11432495 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
3300012944|Ga0137410_10238631 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300012944|Ga0137410_10276511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1324 | Open in IMG/M |
3300012948|Ga0126375_10886550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
3300012971|Ga0126369_10048230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3623 | Open in IMG/M |
3300012971|Ga0126369_10110562 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
3300012971|Ga0126369_11591573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
3300012971|Ga0126369_13722519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300014877|Ga0180074_1077673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
3300015359|Ga0134085_10082480 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300015373|Ga0132257_100752096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1214 | Open in IMG/M |
3300016294|Ga0182041_10231945 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300016404|Ga0182037_10162209 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300016422|Ga0182039_10230308 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300016445|Ga0182038_11746491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
3300018051|Ga0184620_10148560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
3300018052|Ga0184638_1033322 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
3300018068|Ga0184636_1333980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
3300018071|Ga0184618_10034129 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300018076|Ga0184609_10511917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
3300018422|Ga0190265_10340936 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
3300018422|Ga0190265_11166343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
3300018422|Ga0190265_13165541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
3300019356|Ga0173481_10719835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300019487|Ga0187893_10081119 | All Organisms → cellular organisms → Bacteria | 2986 | Open in IMG/M |
3300019878|Ga0193715_1098065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
3300019883|Ga0193725_1092410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 724 | Open in IMG/M |
3300019886|Ga0193727_1071938 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300020220|Ga0194119_10607161 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300021170|Ga0210400_11520504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
3300025906|Ga0207699_11376598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300025910|Ga0207684_10672460 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 881 | Open in IMG/M |
3300025912|Ga0207707_11252488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
3300025913|Ga0207695_11264853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
3300025927|Ga0207687_10205827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1541 | Open in IMG/M |
3300025931|Ga0207644_10575373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 934 | Open in IMG/M |
3300025936|Ga0207670_10609781 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300025981|Ga0207640_10602696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 930 | Open in IMG/M |
3300026023|Ga0207677_11267080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 676 | Open in IMG/M |
3300026041|Ga0207639_11604162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
3300026067|Ga0207678_10829109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300026309|Ga0209055_1187075 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
3300026314|Ga0209268_1063754 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300026318|Ga0209471_1116429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1141 | Open in IMG/M |
3300026333|Ga0209158_1332722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300026335|Ga0209804_1298505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300026360|Ga0257173_1061802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300026371|Ga0257179_1021693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
3300026376|Ga0257167_1008127 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
3300026469|Ga0257169_1004025 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
3300026481|Ga0257155_1040620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
3300026523|Ga0209808_1304208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300026532|Ga0209160_1343854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
3300026550|Ga0209474_10165009 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
3300027018|Ga0208475_1031839 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300027765|Ga0209073_10361511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
3300027873|Ga0209814_10151834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 994 | Open in IMG/M |
3300027875|Ga0209283_10231361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1227 | Open in IMG/M |
3300027882|Ga0209590_10174730 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300027907|Ga0207428_10067552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2814 | Open in IMG/M |
3300028381|Ga0268264_10677718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
3300028381|Ga0268264_11414159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 706 | Open in IMG/M |
3300028715|Ga0307313_10111127 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 836 | Open in IMG/M |
3300028792|Ga0307504_10414276 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300028828|Ga0307312_10561493 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
3300030006|Ga0299907_11318356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300030336|Ga0247826_11648091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
3300030620|Ga0302046_11162141 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1096693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
3300031229|Ga0299913_11950947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
3300031538|Ga0310888_11044276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300031681|Ga0318572_10199924 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1167 | Open in IMG/M |
3300031720|Ga0307469_10638185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 957 | Open in IMG/M |
3300031720|Ga0307469_10641141 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300031720|Ga0307469_10804720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 862 | Open in IMG/M |
3300031720|Ga0307469_11220084 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 711 | Open in IMG/M |
3300031740|Ga0307468_100642695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 875 | Open in IMG/M |
3300031740|Ga0307468_100707775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 843 | Open in IMG/M |
3300031744|Ga0306918_10924289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
3300031765|Ga0318554_10090053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1718 | Open in IMG/M |
3300031819|Ga0318568_10765250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
3300031820|Ga0307473_10023814 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2549 | Open in IMG/M |
3300031820|Ga0307473_11192515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
3300031820|Ga0307473_11257880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
3300031847|Ga0310907_10314020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
3300031879|Ga0306919_10098623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2051 | Open in IMG/M |
3300031890|Ga0306925_10282888 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
3300031942|Ga0310916_10465347 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1077 | Open in IMG/M |
3300031945|Ga0310913_10287071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1159 | Open in IMG/M |
3300031946|Ga0310910_10511928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 953 | Open in IMG/M |
3300031981|Ga0318531_10281598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
3300032012|Ga0310902_11039060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300032076|Ga0306924_10765894 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1079 | Open in IMG/M |
3300032180|Ga0307471_100797015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1112 | Open in IMG/M |
3300032180|Ga0307471_101670209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
3300032180|Ga0307471_102795477 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
3300032180|Ga0307471_103548048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
3300032205|Ga0307472_100570014 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 992 | Open in IMG/M |
3300032205|Ga0307472_100901945 | Not Available | 818 | Open in IMG/M |
3300032205|Ga0307472_101370879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
3300033289|Ga0310914_10947069 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 761 | Open in IMG/M |
3300034354|Ga0364943_0207823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
3300034417|Ga0364941_087588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
3300034692|Ga0373917_0031952 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 748 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.60% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.08% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.08% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.08% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.04% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.04% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.04% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.04% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.52% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
3300034692 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3 | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062590_1000489154 | 3300004157 | Soil | MKPLDPVRKLRRDAAFEPAALDRGKALLMAAIRQGVEPQRQPAIVPQ |
Ga0066395_100933493 | 3300004633 | Tropical Forest Soil | MKPVDLARKLRRDAAFEPAALDRGKAALMTAIRQEGERRRRPTIVPQIPYQD |
Ga0066674_102490632 | 3300005166 | Soil | MKPVDLARKLRREAALDPAALDRGKAVLMAAIRQEVEPTRRPTI |
Ga0066809_101531642 | 3300005168 | Soil | MRPVDLVRKLRREAAVKPAALDRGKAALMAAIRQEVQPMRRPTIVPRLPYE |
Ga0066680_103666001 | 3300005174 | Soil | MKPVDLVRNLRREAAFEPAALDRGKEMLMATIRQEVEPRRRPTIVPQLP |
Ga0066688_102619763 | 3300005178 | Soil | MKPADLVKKLRRDAAFDPAALDRGKEVLMAAIRREVQPTRRPTIVPQ |
Ga0066388_1006745713 | 3300005332 | Tropical Forest Soil | MKPVDLVKALRRDAAFAPVALDRGKAALMATIRRDVDATRRPTIIPQLPYADIRAA |
Ga0066388_1009759441 | 3300005332 | Tropical Forest Soil | MNPVDLAKKLRREATYDPAALDRGKAALMTVIRQESEPRRLSTIIPQLPYADIRA |
Ga0068868_1005258491 | 3300005338 | Miscanthus Rhizosphere | MKPVDLVRKLRREAAVKPAALDRGRAVLMAAIREEVQPMRRPTIVPRLPYEDVGAALSFL |
Ga0070660_1007785111 | 3300005339 | Corn Rhizosphere | MKPVDLVRKLRREAAVKPAALDRGRAVLMAAIREEVQPMRRPTIVPRLPYEDVG |
Ga0070668_1021224812 | 3300005347 | Switchgrass Rhizosphere | MKPVNLVRKLRRDAAFEPAALDRGKEQLMAAIRQEVAPRRRPAIVPQLPY |
Ga0066682_101735081 | 3300005450 | Soil | MKPVDLARKLRREAAVKPAALVRGKAVLMAAIRQEVQPMRRP |
Ga0066682_102062451 | 3300005450 | Soil | MKPVNLVRKLRRDAAFEPAALDRGKEQLMAAIRQEVAPRRRPAIVPQLPYQDIAAAI |
Ga0070706_1001065634 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEVQPMRRPTIIPRLPYENVGA |
Ga0070706_1013600781 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPVDLARKLRREAAFEPAALDRGKEMLMATIRQEVEPRRRPT |
Ga0070698_1016290671 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEVQPMRRPTIIPRLPYENVGAA |
Ga0070679_1008621691 | 3300005530 | Corn Rhizosphere | MKPVDLARKLRREAAFEPAALDRGKEALMAAIRQEVQPRRRPTIVPRLPYEDVGAA |
Ga0070695_1018426732 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPVNLVRKLRRDAAFEPAALDRGKEQLMAAIRQEVAPRRRPAIVPQ |
Ga0066698_104974451 | 3300005558 | Soil | MKPLDLARKLRREAAFEPAALDRGKAVLMAAIRQEVEP |
Ga0066703_104681521 | 3300005568 | Soil | MKPVDLAKKLRRDAAFEPAVLDRGKAALMAAIQQEAL |
Ga0066703_105887081 | 3300005568 | Soil | MKPVDLARKLRREAAFEPAALDRGKAVLMAAIRQEVEPTRGP |
Ga0066708_103611913 | 3300005576 | Soil | MKPVDLARKLRREAAFEPAALDRGKAVLMAAIRQQVAPRRRPTIVPQVPYED |
Ga0066905_1004518213 | 3300005713 | Tropical Forest Soil | MRPIDLTKQLRRDAAFHPAALERGKVALMAMIQQEVQPM |
Ga0068866_111556501 | 3300005718 | Miscanthus Rhizosphere | MKPVDLARMLRREATFDPAALDRGKETLMAAIRQEVQPVRRPTIVPRLP |
Ga0066903_1003927931 | 3300005764 | Tropical Forest Soil | MKPIDLTRKLRRDAEFDPAVLERGKAAFMAMIQQEVQPMRRPTIIPRLPYENVG |
Ga0066903_1055013661 | 3300005764 | Tropical Forest Soil | MRPTELVKKLRREAAVDPAVLERGKAVLMATIQQEVQPTRRPTIIPRLP |
Ga0068858_1013772341 | 3300005842 | Switchgrass Rhizosphere | MKPVDLARKLRREAAFEPAALERGKAVLMAAIRQASAPRRWPAITPQVPYQD |
Ga0068862_1003942541 | 3300005844 | Switchgrass Rhizosphere | MKPVDLAKKLRRDAAFEPAALDRGKAVLMAAIRQEVQPMRRPTIVPRL |
Ga0066652_1008310011 | 3300006046 | Soil | MKPVNLVRKLRRDAAFEPAALDRGKEQLMAAIRQEVAPRRR |
Ga0075417_100363701 | 3300006049 | Populus Rhizosphere | MKPVDLARKVRREAVFEPAALERGKAVLMAAIRQEVESRSAPTIIPQVPYL |
Ga0066659_116968922 | 3300006797 | Soil | MKPVDLARKLRREAAFEPAALDRGKAVLMAAIRQEVQPKRGPTIVPQVPYEDV |
Ga0075421_1020745552 | 3300006845 | Populus Rhizosphere | MKPVDLARKLRREAAFEPAALERGKAALMLAIRREAESRRRPTIVPQVPYQDISAA |
Ga0075421_1024311881 | 3300006845 | Populus Rhizosphere | MKPVELARKLRRDAAFEPAALDRGKAALMAAIRQEVEPRSRPTIVPQ |
Ga0075430_1014361691 | 3300006846 | Populus Rhizosphere | MKPVDLARKLRREAALDPAALDRGKAVLMAAIQQAVPPRRRPTIMPQLPYEDIRAAL |
Ga0075433_105316963 | 3300006852 | Populus Rhizosphere | MKPEELARKLRREPVFGPAALERGKEALMAAIRHEVER |
Ga0068865_1005770233 | 3300006881 | Miscanthus Rhizosphere | MKPLDLARKLRREAAFDAAALDRGKAVLMAAIRQEVQPMRRPTIVPRLPYEDVGA |
Ga0075424_1025801982 | 3300006904 | Populus Rhizosphere | MKPVDLARTLRREATFDPAALDRGKAALMAAIRKEVQPMRRPTIVPRLPYEDV |
Ga0075419_103884972 | 3300006969 | Populus Rhizosphere | MKPVDLAKKLRREAAFDSAALDRGKALLMAAIRQEVEPRRRP |
Ga0079218_120621731 | 3300007004 | Agricultural Soil | MKPVDLAKKLRRDVEFEPATLERGKAALMAAIRQEI |
Ga0075435_1013400381 | 3300007076 | Populus Rhizosphere | MKPVDLVRKLRREAALDPAGLDRGKAALMMAIRQEAQPARRPTII |
Ga0099791_104163931 | 3300007255 | Vadose Zone Soil | MKPVDLARKLRREAAFAPAALDRGKEMLMARIRQEV |
Ga0099827_105711111 | 3300009090 | Vadose Zone Soil | MKPVDLARTLRREAALKPAALDQGKAVLMAAIRQEVEPTRRPTIVP |
Ga0105245_113350902 | 3300009098 | Miscanthus Rhizosphere | MKPVDLARKLRREAAFEPAALERGKAVLMAAIRQASAPRRWP |
Ga0075418_113226452 | 3300009100 | Populus Rhizosphere | MKPVDLARKLRREAAFEPAALDRGKAVLMAAIRQEGQPKRGPTIVPQVPY |
Ga0066709_1029580582 | 3300009137 | Grasslands Soil | MKPVDLARKLRREAAFEPAALDRGKAVLMAAIRQEVDPKR* |
Ga0105243_113185582 | 3300009148 | Miscanthus Rhizosphere | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRREVQPMRRPTII |
Ga0105092_107878021 | 3300009157 | Freshwater Sediment | MKPVDLARKLRREAAFDPAALDRGKALLMAAIRQEVAPARGPTIVPQ |
Ga0105242_130513462 | 3300009176 | Miscanthus Rhizosphere | MKPVDLARKLRREAAFKPAALGRGKAVLMAAIRQEVKPMRRPTIVPRVPYED |
Ga0105242_132675161 | 3300009176 | Miscanthus Rhizosphere | MKPVDLVRKLRREAALDPAALDRGKAALMMAIRQEAQPARRPTIIPRVPYEN |
Ga0126374_105554921 | 3300009792 | Tropical Forest Soil | MKPVDLAKKLRREATFDPAALDRGKAVLMAAIRQEVGPRRRPTI |
Ga0126374_115509592 | 3300009792 | Tropical Forest Soil | MKPLDLAKKLRRDAAFDPAALDRGRAALMAAIRQEVAPRRRPTIVPQ |
Ga0105080_10450972 | 3300009797 | Groundwater Sand | MKPVDLARKLRRDAAFEPAALDRGKAVLMAAIRQEVEPKRRPTIVPQVPY |
Ga0105071_10132151 | 3300009808 | Groundwater Sand | MKPVDLARKLRREAAFEPAALDRGKAVLMAAIRQAVEPRRRPTIVPQLPYEDIGAALS |
Ga0105057_10827541 | 3300009813 | Groundwater Sand | MKPMDLVRKLRRDAAFEPSALARGKETLMATIRQEVETQRRPSIVPQ |
Ga0105085_10713751 | 3300009820 | Groundwater Sand | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEV |
Ga0105085_10892492 | 3300009820 | Groundwater Sand | MKPVDLARKLRRDAAFEPAALDRGKEALMAAIRQEVEPARRPA |
Ga0126384_109863931 | 3300010046 | Tropical Forest Soil | MRPIDLTKQLRRDAAFHPAALERGKVALMDLIQQTVQPIRRPTIVPRLPYED |
Ga0134088_103556321 | 3300010304 | Grasslands Soil | MKPVDLVRKLRRDAAFEPAALDRGKELLMAAIRQEVGPQRRPSIVPQLPYQDIA |
Ga0134084_101714562 | 3300010322 | Grasslands Soil | MKPVDLARKLRREAAFEPAALNRGKAVLMAAIRREAEPKRRPTIVPQVPYQ |
Ga0134111_102403372 | 3300010329 | Grasslands Soil | MKPVDLARKLRREAAVKPAALDRGKAVLMTAIRQEVQPMRRPTIVPRLPYEDVGAA |
Ga0134071_102319171 | 3300010336 | Grasslands Soil | MKPVDLVRKLRREAAVDPAALGRGKAELMAAIRQEVQPMRRPTI |
Ga0126370_103730061 | 3300010358 | Tropical Forest Soil | MKPVDLVRKLRREAAVTPAALDRGKAVLMAAIRQEVQPMRRPTIVPRLPYEDV |
Ga0126370_108713892 | 3300010358 | Tropical Forest Soil | MNPIDLTKALRRDAAFDPAALERGKAALMAMIQQEVQPMRRPTIVP |
Ga0126370_118690002 | 3300010358 | Tropical Forest Soil | MKPVDLAKKLRREAAFEPALLDRGKATLMAAIQQEALSTRRPTIIPQLPY |
Ga0126372_102169403 | 3300010360 | Tropical Forest Soil | MKPVDLAKKLRREAAFKPTALDRGKETLMAAIRQE |
Ga0126372_104529041 | 3300010360 | Tropical Forest Soil | MKPADLARKLRREAAFRPAALERGKAVLMAAIRHEVEPMRRATIVPQ |
Ga0126372_122013391 | 3300010360 | Tropical Forest Soil | MTPVDLAKKLRRDAAFEPAVLDRGKEALMAAIRQEVEPTRRPTI |
Ga0126372_126889402 | 3300010360 | Tropical Forest Soil | MKPVDLVRKLRREAAFEPEALDRGKEALMAAIRQEVAPARRPTIIPQLPYADI |
Ga0126372_127363121 | 3300010360 | Tropical Forest Soil | MKPVDLARKLRRDAAFEPAALDRGKETLMAAISQEVEPA |
Ga0126378_129601673 | 3300010361 | Tropical Forest Soil | MKPVDLAKKLRCDAAFDPSALNRGKAVLMAAIRREVEPRREPTIVP |
Ga0126377_123749981 | 3300010362 | Tropical Forest Soil | MKPVELARKLRREAVLEPAALDRGKAVLMAAIRREVESRSGPTI |
Ga0126377_130298042 | 3300010362 | Tropical Forest Soil | MKPADLARKLRREAVFDPAALDRGKAVLMTAIRREVEPRRGPTIIPQVPYQ |
Ga0126381_1021713851 | 3300010376 | Tropical Forest Soil | MKPIDLTRKLRRDAAFDPAVLERGKAAFMAMIQQEVQPMRRPTIIPRLPYEN |
Ga0134124_127983441 | 3300010397 | Terrestrial Soil | MRPLDLAKRLRRDAAFEPAALERGKAVLMAAIRQAAEPRRRPTIIP |
Ga0126383_121414942 | 3300010398 | Tropical Forest Soil | MKPVDLARKLRRAAAFKPTALDRGKATLMAAIRQEV |
Ga0137461_12585302 | 3300012040 | Soil | MKPVDLVRKLRREAAFEPGALDRGKAELMVAIRQEVEPRRRPTIIPRLP |
Ga0137381_107838232 | 3300012207 | Vadose Zone Soil | MKPVNLVKKLRRDAAFEPAALGRGKEQLMAAIRQEVAPRRRPAIVPQLPYQDIAAAI |
Ga0137377_103341053 | 3300012211 | Vadose Zone Soil | MKPVDLAKKLRREAAFEPAVLDRGKVALMAAIRQEVQP |
Ga0137386_102182701 | 3300012351 | Vadose Zone Soil | MKPVDLARKLRRDAALDPAALDRGKAVLMAAIRQEVQPM |
Ga0137384_102784841 | 3300012357 | Vadose Zone Soil | MKPVNLVKKLRRDAAFEPAALGRGKEQLMAAIRQEVA |
Ga0137368_103452741 | 3300012358 | Vadose Zone Soil | MKPVDLARKLRREAAVKPAALDRGKAVLMAAIRQEVQPMRRPTIVPRLPYEDVG |
Ga0137360_111127471 | 3300012361 | Vadose Zone Soil | MKPVDLARKLRREATFDPAALDRGKAVLMAAVRQEVEPMRRPTIVPQLP |
Ga0137373_107631201 | 3300012532 | Vadose Zone Soil | MKPVDLARKLRREAALDPAALDRGKAVLMAAIRQEVEPRRRPTIVPQV |
Ga0137397_102300463 | 3300012685 | Vadose Zone Soil | MKPVDLARKLRREATLDPAALDRGKAVLMAAIRQEVQPMRRPTIVPRLPYEDV |
Ga0137397_103647891 | 3300012685 | Vadose Zone Soil | MKPVDLARKLRREAAFDPAALDRGKAVLMAAVRQEV |
Ga0137396_103427481 | 3300012918 | Vadose Zone Soil | MKPVDLARKLRQEATFEPAVLDRGKAVLMAAIRQEVQPK |
Ga0137394_101735071 | 3300012922 | Vadose Zone Soil | MKPVDLARKLRREATLDPAALDRGKAVLMAAIRQEVQPMRRPTIVPRLP |
Ga0137416_105744783 | 3300012927 | Vadose Zone Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMTAIRQEVQPTRRPTIIPRLPYENVG |
Ga0137416_114324951 | 3300012927 | Vadose Zone Soil | MKPVDLARKLRREAAVKPAALERGKAVLMAAIRQEVQPMRRPTIVPRLPYEDVG |
Ga0137410_102386313 | 3300012944 | Vadose Zone Soil | MKPMDLARKLRREAALGPAALDRGKAVLMAAIRQEVEPRRQPTIVPQLPYEDIGA |
Ga0137410_102765113 | 3300012944 | Vadose Zone Soil | MKPMDLVRKLRRDAAFEPAALDRGKELLMAAIRQEAEPRRRRSIVPQ |
Ga0126375_108865501 | 3300012948 | Tropical Forest Soil | MKPVDLARKLRREAAFKPTALDRGKETLMAAIQQEVEPRRRPTVIPQLPYADIRAA |
Ga0126369_100482301 | 3300012971 | Tropical Forest Soil | MKPIDLTRKLRRDAEFDPAVLERGKAAFMAMIQQEVQPMRRPTIIPRLPYENVGA |
Ga0126369_101105621 | 3300012971 | Tropical Forest Soil | MKPVDLAKKLRRDAAFEAAALDRGKAEFMAAIRQEGE |
Ga0126369_115915731 | 3300012971 | Tropical Forest Soil | MKPVDLARKLRRDAAFEPAVLGRGKEALMAAIRQEVEPRNRPTVIP |
Ga0126369_137225192 | 3300012971 | Tropical Forest Soil | MKPIDLTRKLRRDAAFDPAVLERGKAAFMAMIQQEVQPMRRPTIIPRLPYENVGA |
Ga0180074_10776732 | 3300014877 | Soil | MKPVDLARKLRREAAFDPAALDRGKAVLMAAIRQEVAPARGPTIV |
Ga0134085_100824803 | 3300015359 | Grasslands Soil | MKPVDLARKLRREAALDPAALDRGKAVLMAAIRQEVEPTRRPTIV |
Ga0132257_1007520964 | 3300015373 | Arabidopsis Rhizosphere | MNPLALVKKVRRDAELDPAALDRGKAMLMAAIGHEAEPRRRPTIVPQIPYGDVVAALAF |
Ga0182041_102319451 | 3300016294 | Soil | MNPIDLTKALRRDAAFDPAALERGKAALMTMIQQEVQPMRRPTIVPRLPYENVGAA |
Ga0182037_101622093 | 3300016404 | Soil | MNPIDLTKALRRDAAFDPAALERGKAALMTMIQQEVQPMRRPTIVPRLPYENVGAALSFL |
Ga0182039_102303081 | 3300016422 | Soil | MNPIDLTKALRRDAAFDPAALERGKAALMTMIQQEVQPMRRPTIVPRLPYENVGAALS |
Ga0182038_117464911 | 3300016445 | Soil | MNPVDLARRLRREAALTPTALARGKEALMAAIRQETEPRR |
Ga0184620_101485602 | 3300018051 | Groundwater Sediment | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEVQPMRRPTIIPR |
Ga0184638_10333223 | 3300018052 | Groundwater Sediment | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEVQPMRRPTIIPRV |
Ga0184636_13339802 | 3300018068 | Groundwater Sediment | MKPVDLARKLRRETALEPAALDRGKAVLMAAIRQEVEPRRRPTIVPQ |
Ga0184618_100341293 | 3300018071 | Groundwater Sediment | MRPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQGVQPMRRP |
Ga0184609_105119172 | 3300018076 | Groundwater Sediment | MKPVDLARKLRREAACGPAALDRGKAVLMAAIRQEVEP |
Ga0190265_103409363 | 3300018422 | Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEVQPMR |
Ga0190265_111663431 | 3300018422 | Soil | MKPEDLARNLRREAVFTPAALDRGKAVLMAAIRQEAQPMRRPTIVPRLPYENV |
Ga0190265_131655411 | 3300018422 | Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQE |
Ga0173481_107198352 | 3300019356 | Soil | MKPVDLARKLRREAAFEPAALERGRAVLMVAIRRE |
Ga0187893_100811191 | 3300019487 | Microbial Mat On Rocks | MKPVDLVRALRREAAVKPVTLDRGRTALMAAIRQEVQPMRRPTI |
Ga0193715_10980652 | 3300019878 | Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEVQ |
Ga0193725_10924102 | 3300019883 | Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEVQPM |
Ga0193727_10719381 | 3300019886 | Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMATIRQE |
Ga0194119_106071611 | 3300020220 | Freshwater Lake | MKPVDLARKLRREPAVDPSALERGKAVLMAAIRREVERTRRPMIV |
Ga0210400_115205042 | 3300021170 | Soil | MKPVDLAKKLRRDAAFEPAVLDRGKAALMAAIQQEALPTRRP |
Ga0207699_113765981 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPVDLVRKLRREAALDPAGLDRGKAALMMAIRQEAQPARRSTIIPRVPYENVGA |
Ga0207684_106724601 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPVDLVRKLRREAAFEPAALDRGKGMLMATIRLEIE |
Ga0207707_112524881 | 3300025912 | Corn Rhizosphere | MKPVDLVRKLRREAAVKPAALDRGKTALMAAIRQEVQPMRRPTIVPRLP |
Ga0207695_112648532 | 3300025913 | Corn Rhizosphere | MKPVDLVRKLRREAAVKPAALDRGRAVLMAAIREEVQPMRRPTI |
Ga0207687_102058271 | 3300025927 | Miscanthus Rhizosphere | MKPVDLVRKLRREAAVKPAALDRGRAVLMAAIREEVQPMRRPTIVPRLPYE |
Ga0207644_105753732 | 3300025931 | Switchgrass Rhizosphere | MKPVDLARKLRREAAFEPAALDRGKEALMAAIRQEVQPRRR |
Ga0207670_106097811 | 3300025936 | Switchgrass Rhizosphere | MRPVDLARKLRREAAFEPAALERGKAVLMAAIRQASAPRRWPAITPQ |
Ga0207640_106026962 | 3300025981 | Corn Rhizosphere | MKPVDLAKKLRRDAAFEPAALDRGKAVLMTAIQQEVQPMRRP |
Ga0207677_112670801 | 3300026023 | Miscanthus Rhizosphere | MKPVDLARKLRREAAFEPAALDRGKEALMAAIRQEVQ |
Ga0207639_116041621 | 3300026041 | Corn Rhizosphere | MKPVDLVRKLRREAAVKPAALDRGRAVLMAAIREEVQPMRRPTIVPRLPYED |
Ga0207678_108291091 | 3300026067 | Corn Rhizosphere | MKPVDLARKLRREAAFEPAALDRGKAELMAAIRQEVESRRRP |
Ga0209055_11870752 | 3300026309 | Soil | MKPVDLVRKLRRDAAFEPAALDRGKELLMAAIRQEVGPQRRPSIVPQLPY |
Ga0209268_10637541 | 3300026314 | Soil | MKPVDLARKLRREAAFEPAALDRGKAVLMAAIRQEVEPTR |
Ga0209471_11164292 | 3300026318 | Soil | MKPVDLVRKLRRDAAFEPAALDRGKELLMAAIRQEV |
Ga0209158_13327222 | 3300026333 | Soil | MKPVDLVRKLRRDAAFEPAALDRGKELLMAAIRQEVGPQRRPSIVPQ |
Ga0209804_12985052 | 3300026335 | Soil | MKPVDLVRKLRRDAAFEPAALDRGKELLMAAIRQEVGPQRRPSIVPQLPYQDIAAAI |
Ga0257173_10618022 | 3300026360 | Soil | MKPVDLARKLRREAALEPAALDRGKAVLMAAIRQAAE |
Ga0257179_10216932 | 3300026371 | Soil | MKPVDLARKLRREAALEPAALDRGKAVLMAAIRQAVEPRRRPTIVPQLPYEDIG |
Ga0257167_10081273 | 3300026376 | Soil | MKPVDLARKLRREAALEPAALDRGKAVLMAAIRQAVEPRRRPTIV |
Ga0257169_10040253 | 3300026469 | Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRQEVQPMRGPTII |
Ga0257155_10406201 | 3300026481 | Soil | MKPVDLAKKLRREAAFEPAVLNRGKAALMATIRQEVQPM |
Ga0209808_13042082 | 3300026523 | Soil | MKPVDLARKLRREAAFEPAALDRGKAVLMAAIRQQVAPRRRPTIVPQ |
Ga0209160_13438542 | 3300026532 | Soil | MKPVDLVRKLRRDAAFEPAALDRGKELLMAAIRQE |
Ga0209474_101650091 | 3300026550 | Soil | MKPVDLARKLRREATFEPAALDRGKAVLMAAIRQEVQPK |
Ga0208475_10318391 | 3300027018 | Soil | MKPMDLVKKLRREPAVAPAALERGKAVLMATIQQEVQPRRRPTIVPRLPYE |
Ga0209073_103615112 | 3300027765 | Agricultural Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMAMIQQEAPPA |
Ga0209814_101518343 | 3300027873 | Populus Rhizosphere | MKPVDLARKVRREAVFEPAALERGKAVLMAAIRQEVESRSAPTIIPQVPYLD |
Ga0209283_102313611 | 3300027875 | Vadose Zone Soil | MKPVDLVRKLRRDAAYEPAALDRGKELLMAAIRQEVGPQHRPSIVPQLPYQDIAAAIA |
Ga0209590_101747303 | 3300027882 | Vadose Zone Soil | MKPVDLTRKLRREAAFEPAALDRGKAALMAAIRQEVAPKRRPTIVPQVP |
Ga0207428_100675521 | 3300027907 | Populus Rhizosphere | MKPVDLVRKLRREAAVKPAALDRGKEMLMATIRQEVQPMRRPTIVPR |
Ga0268264_106777181 | 3300028381 | Switchgrass Rhizosphere | MKPVDLAKKLRREAAFEPAVLDRGRAALMAAIRQEVQPMRRPTI |
Ga0268264_114141591 | 3300028381 | Switchgrass Rhizosphere | MKPVNLVRKLRRDAAFEPAALDRGKEQLMAAIRQEVA |
Ga0307313_101111271 | 3300028715 | Soil | MKLLDLARKLRREAAFDAAALDRGKAVLMAAIRQEVQPMRRPTI |
Ga0307504_104142761 | 3300028792 | Soil | MKPMDLVRKLRQEAEFEPAALERGKAALMAAIRQQAAPRRAPAIVPQVPYQDIR |
Ga0307312_105614931 | 3300028828 | Soil | MKPLDLARKLRREAVFDAAALDRGKAVLMAAIRQEVQPMRRPTIVPRLPYEDVGAA |
Ga0299907_113183562 | 3300030006 | Soil | MRPLDLARKLRREAAFEPAALDRGKAVLMAAIRQEVAPTR |
Ga0247826_116480912 | 3300030336 | Soil | MKPVDLARKLRRDAAFEPAALDRGKAVLMAAIRQEVKPRRGPTI |
Ga0302046_111621411 | 3300030620 | Soil | MKPVDLARKLRREAALEPAALDRGKAVLMAAIRQAV |
(restricted) Ga0255311_10966931 | 3300031150 | Sandy Soil | MKPVDLARKLRREAAVKPAALERGKAVLMAAIRQE |
Ga0299913_119509472 | 3300031229 | Soil | MRPVDLARKLRREAAFEPAALDRGKAVLMAAIRQEVAPTRRP |
Ga0310888_110442762 | 3300031538 | Soil | MKPVDLARKLRREAAFEPAALERGRAVLMVAIRREAEPTRR |
Ga0318572_101999241 | 3300031681 | Soil | MKPVDLARKLRREAAFKPAALDRGKETLMAVIQQEVEPRRRPTVI |
Ga0307469_106381851 | 3300031720 | Hardwood Forest Soil | MTPANLVRKLRRDAAFEPAALDRGKEQLMAAIRQEVAPRRRPAIVPQLPYQDIAAAIA |
Ga0307469_106411413 | 3300031720 | Hardwood Forest Soil | MKPVDLARKLRRDAAFEPAVLGRGKEALMAAIRQEVEPRPR |
Ga0307469_108047203 | 3300031720 | Hardwood Forest Soil | MKPVDLARKLRREAAIDPAALDRGKETLMAAIRQQV |
Ga0307469_112200841 | 3300031720 | Hardwood Forest Soil | MKPVDLARKLRREAAFDPAALDRGKAVLMAAVRQEVEPKRRPTIVPQVPYEDIHAAL |
Ga0307468_1006426952 | 3300031740 | Hardwood Forest Soil | MKPVDLVKKLRREAAFGPAALDRGKAELMTAIQQEVQPMRRPTIVPRLP |
Ga0307468_1007077751 | 3300031740 | Hardwood Forest Soil | MKPVDLAKKLRRDAAFEPAALDRGKAMLMAAIRQEVQPMRRPTIVPRLPY |
Ga0306918_109242892 | 3300031744 | Soil | MNPIDLTKALRRDAAFDPAALERGKAALMTMIQQEVQPMRRPTIVP |
Ga0318554_100900531 | 3300031765 | Soil | MNPVDLARKLRREAAFEPTALARGKEALMAAIRQEVEPRRRPTIIPQLPYENVGAAL |
Ga0318568_107652501 | 3300031819 | Soil | MNPIDLTKALRRDAAFDPAALERGKAALMTMIQQEVQPMRRPTIVPRLPYENVGA |
Ga0307473_100238144 | 3300031820 | Hardwood Forest Soil | MKPVDLARKLRREAAFEPAVIDRGKAVLMAAIRQAVEPRRQPTIVPQLPYEDIGAAL |
Ga0307473_111925151 | 3300031820 | Hardwood Forest Soil | VKPVDLARKLRREAAFEPAVLDRGKERLMATIQQEATIRQEVEPRR |
Ga0307473_112578801 | 3300031820 | Hardwood Forest Soil | MKPLDLVKKVRRDAAFDAAALERGKAVLMAAIRREVAPRR |
Ga0310907_103140201 | 3300031847 | Soil | MKPVELARKLRRDAAFEPAALDRGKAALMAAIRQEVEPRSRPTIVPQVPYE |
Ga0306919_100986231 | 3300031879 | Soil | MNPIDLTKALRRDAAFDPAALERGKAALMTMIQQEVQPMRRPTIVPRLP |
Ga0306925_102828883 | 3300031890 | Soil | MKPVDLARKLRREAAFKPAALDRGKETLMAVIQQEVEPRRRPTVIPQLPYA |
Ga0310916_104653473 | 3300031942 | Soil | MKPVDLARKLRREAAFKPAALDRGKETLMAVIQQEVEPRRRPTVIPQLPYADIRA |
Ga0310913_102870713 | 3300031945 | Soil | MKPVDLARKLRREAAFKPAALDRGKETLMAVIQQEVEPRRRPTVIPQLP |
Ga0310910_105119281 | 3300031946 | Soil | MKPMDLVKKLRREPTVYPTALERGKGTLMATIQHEIQPMRRPTIVPRVPY |
Ga0318531_102815981 | 3300031981 | Soil | MNPIDLTKALRRDAAFDPAALERGKAALMTMIQQEVQ |
Ga0310902_110390601 | 3300032012 | Soil | MKPVELARKLRRDAAFEPAALDRGKAALMAAIRQE |
Ga0306924_107658941 | 3300032076 | Soil | MNPVDLARKLRREAAFEPTALARGKEALMAAIRQEVEPRRRPTIIPQLPYE |
Ga0307471_1007970151 | 3300032180 | Hardwood Forest Soil | MKPVDLARKLRREAAFDPAALDRGKEPLMAAIRQEVQPMRRPTIVPR |
Ga0307471_1016702092 | 3300032180 | Hardwood Forest Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRREVQPMRRPTIIPRLPYENVGAAL |
Ga0307471_1027954772 | 3300032180 | Hardwood Forest Soil | MKPVDLARKLRREAAYKPAALDRGKAVLMAAIRQEVQP |
Ga0307471_1035480481 | 3300032180 | Hardwood Forest Soil | MRPVDLVRKLRRDDTFEPAALDRGKDVLMAAIRREVAPARRPA |
Ga0307472_1005700142 | 3300032205 | Hardwood Forest Soil | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRREVQPMRRPTIIPRLPYENV |
Ga0307472_1009019451 | 3300032205 | Hardwood Forest Soil | MKPVDLARKLRREAAVTPAALEGGKAVLMAAIRKEVQPMRR |
Ga0307472_1013708791 | 3300032205 | Hardwood Forest Soil | MRPVDLLRKLRREAAVEPTALERGKAVLMKAIRQETAVQQEAAPARRRTIVPQLPYENIHAALT |
Ga0310914_109470691 | 3300033289 | Soil | MNPVDLARKLRREAAFEPTALARGRETLMAAIRQEVEPRR |
Ga0364943_0207823_606_722 | 3300034354 | Sediment | MKPVDLAKKLRREAAFEPAVLDRGKAALMAAIRKEVQPM |
Ga0364941_087588_602_736 | 3300034417 | Sediment | MKPVDLARKLRREAAFEPAALDRGKEALMAAIRQEVEPARRPTII |
Ga0373917_0031952_3_170 | 3300034692 | Sediment Slurry | MKPVDLVRKLRREAAVKPAALDRGKAVLMAVIRQEVQPMRRPTIVPRLPYENVGAA |
⦗Top⦘ |