Basic Information | |
---|---|
Family ID | F028677 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 190 |
Average Sequence Length | 47 residues |
Representative Sequence | MNAPDPPHWTLNSCFGVFCTIWVHLGPFGCLTKLGAKRAELVQKFVPQ |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 190 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 66.67 % |
% of genes near scaffold ends (potentially truncated) | 15.26 % |
% of genes from short scaffolds (< 2000 bps) | 15.26 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.474 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (45.789 % of family members) |
Environment Ontology (ENVO) | Unclassified (84.211 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (81.053 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.47 % |
All Organisms | root | All Organisms | 0.53 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 45.79% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 33.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.32% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 4.74% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.63% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.58% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.05% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028052 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028149 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028463 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032548 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070668_1002245782 | 3300005347 | Switchgrass Rhizosphere | MTNAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGEKRAELVQKFVPRSHVGVFRD |
Ga0070668_1017535891 | 3300005347 | Switchgrass Rhizosphere | PPYGTLNSCFGVFRTIWVHLVPFGYLTKLGAKRAEVVQKFVP* |
Ga0070668_1017595941 | 3300005347 | Switchgrass Rhizosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSCIG |
Ga0070705_1001775251 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | FTMNTLDPPHWILNSYFGVICTIWLHLGLFGCLTKLRAKWAEVVQKFVP* |
Ga0070686_1002587202 | 3300005544 | Switchgrass Rhizosphere | ATIAPDPPHWTLNSCFGAFHTIWMHLGLFGCLAKLGAKRAELVQKFVP* |
Ga0070686_1006165091 | 3300005544 | Switchgrass Rhizosphere | NAPDPPHWTLNSCFGVFHTIWAHLVTFGYLTKLGAKRAEVVQKFVP* |
Ga0070665_1024008351 | 3300005548 | Switchgrass Rhizosphere | MPNPPHWTLNGCFGAFCTIWVHLGPFGCLTKLGAKRAELVQK |
Ga0070704_1002632601 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTLDPPHWILNTYFGVFCTIWVHLGLFGCLTKLRAKRAEVVQKFVP* |
Ga0070702_1012836001 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | HWTLNSCFGAFHTIWMHLGLFGCLAKLGAKRAELVQKFVP* |
Ga0068859_1006411651 | 3300005617 | Switchgrass Rhizosphere | MSAPDPPHWILNTCFGVFRTICVHLGPLGCLTKLGAKRSELVQKFVRRSR |
Ga0068859_1018720021 | 3300005617 | Switchgrass Rhizosphere | MSSAPDPPHWTVNSHFVAFRTIWEHLGPFGCLTKLGAKRAELVQKFVP |
Ga0068859_1021870441 | 3300005617 | Switchgrass Rhizosphere | SCCGVFCTIWVHLVPFGYLTKLGAKQADVVQNFVP* |
Ga0068863_1007007971 | 3300005841 | Switchgrass Rhizosphere | MNTPDPPHCSLNYRFAAFRTICVHLGPFGCLPKLGTKRAELVQKFVPRS |
Ga0068863_1010884012 | 3300005841 | Switchgrass Rhizosphere | MNAPDPPHWTLNSCFGTFRTIWMHLGPFGCLMKLGAKRAELVQKFVPRSRVGFF |
Ga0068863_1017433181 | 3300005841 | Switchgrass Rhizosphere | WTLNSCFGAFRTILVHLGPFGCLTKLDAKQAEQMQKFVP* |
Ga0068858_1012559031 | 3300005842 | Switchgrass Rhizosphere | MKAPDPPHWNLNSCFGVFRTIWVHLGPLCCHMKLGAKRAELVQKFVPRS |
Ga0068858_1018264811 | 3300005842 | Switchgrass Rhizosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPR |
Ga0068860_1014269431 | 3300005843 | Switchgrass Rhizosphere | MNAPEPPHFTLNSRFAAFCTIWVHLGPFGCLTKLDAKRVELVQKF |
Ga0068860_1021990661 | 3300005843 | Switchgrass Rhizosphere | NPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ* |
Ga0105137_1058281 | 3300009972 | Switchgrass Associated | MNAPNPPHWTLNSCFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPR |
Ga0105129_1021123 | 3300009975 | Switchgrass Associated | MNAPDPPHWILNSCFGVFCTIWMHLGPFGCRTKLGAKRAEVVQKFVPRSR |
Ga0105135_1055671 | 3300009980 | Switchgrass Associated | VSEFYATNAPDPPHWTLNGRFGVFHTIRVHSGPFGCLTKLGTKRAELVQKFVPRSRV* |
Ga0105132_1273331 | 3300009990 | Switchgrass Associated | MNAPDPPHWPLNSRFGVFRTLWMHLGPFGCRKKLGAK |
Ga0105120_10413242 | 3300009992 | Switchgrass Associated | PDPPHWTLNSCFGVFCTIWVHLVPFGYLTKLGAERAEVVQNFMP* |
Ga0105028_1393741 | 3300009993 | Switchgrass Associated | MNAPDPPHWTLNSCFGVYCTIWMYLEPFGCLTKLGAKRAEVV |
Ga0105126_10035741 | 3300009994 | Switchgrass Associated | MTNAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGEKRAELVQK |
Ga0105139_10763821 | 3300009995 | Switchgrass Associated | MNAPNPPHWTLNRRLGVFHTIWVHSGLFYCLAKLGAKRAELVQKFVPRSRVG |
Ga0105139_10783551 | 3300009995 | Switchgrass Associated | MKAPDPPHWTLNSCFGVFLTIWMHLGPFGCLTKLSAKWVERVQKFVP |
Ga0134125_105792781 | 3300010371 | Terrestrial Soil | MINAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKVGAKRAELVQKFVPRS |
Ga0134126_126821821 | 3300010396 | Terrestrial Soil | MNAPDPPHGTLNSCFVVFCTIWLHLGPFGGHTKLSAKRAEVVQKFVPRSRVRI |
Ga0134124_121725601 | 3300010397 | Terrestrial Soil | MTNAPDPPHWTQISCFGAFHTIWVHLGPFGCLTKLGAKRAELV |
Ga0134122_123233991 | 3300010400 | Terrestrial Soil | KWAKFLATNARDPPHWTLNSYFGVFFSIWMHLGPFGCLTKLGSKRAKVVQKFMP* |
Ga0134122_131461121 | 3300010400 | Terrestrial Soil | APDPAHWTLNSCFGAFHTIWMHLGLFGCLAKLGAKRAELVQKFVP* |
Ga0157379_124985641 | 3300014968 | Switchgrass Rhizosphere | MNALDPPHWILNSYFGVFCTIWVHLGLFGCLTTLRAKRAEVVQKFVPRSRVRMFCNEH |
Ga0182102_10275261 | 3300015273 | Switchgrass Phyllosphere | MKAPDPTHWTLNSRFCVFRTIWVHLGLFGCRTTLSAKRV |
Ga0182102_10417361 | 3300015273 | Switchgrass Phyllosphere | MNTLDPPHWILNSYFGVFCTIWVHPGLFGCLTKLRAKRAE |
Ga0182100_10473771 | 3300015280 | Switchgrass Phyllosphere | MNTPDPPHWTLNYHFAAFRTIYVHLGPFGCLTKLGAKRAELVQK |
Ga0182101_10408431 | 3300015284 | Switchgrass Phyllosphere | MNAPDPPHWPLNSRFGVFRTLWMHLGPFGCRTKLGAKRAEVVQKFV |
Ga0182103_10040831 | 3300015293 | Switchgrass Phyllosphere | KVALDFFTTNAPNPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ* |
Ga0182103_10705241 | 3300015293 | Switchgrass Phyllosphere | CHEVALEFFAMNAPDPPHWTLNSRFGAFRTILVHLGPFGCLTKLSAKRAEVVQKFLP* |
Ga0182104_10601301 | 3300015297 | Switchgrass Phyllosphere | TLNSCFGVFCTIWVHLVLFGYLTKLGAKRAEVVQNFVP* |
Ga0182104_10833751 | 3300015297 | Switchgrass Phyllosphere | MKAPDPPHWTLNSCFGVFRTIWVHLGPLCCHMKLGAKRAELVQKFVPRSRVRI |
Ga0182104_11188981 | 3300015297 | Switchgrass Phyllosphere | MNAPDPPHWTLNSCFGVFCTIWVHLGPFGCLTKLGAKRAELVQKFVPQ |
Ga0182184_10054071 | 3300015301 | Switchgrass Phyllosphere | APNPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ* |
Ga0182184_10188702 | 3300015301 | Switchgrass Phyllosphere | MNALDPPHWTLNSCFSVFRTILVYLGPFGCLTNLRAKRSRVG |
Ga0182180_10074481 | 3300015306 | Switchgrass Phyllosphere | FATNTPDPTHWILNWRFGAFHTFWVHLGPFGCLTKLGAKRAELV* |
Ga0182098_10686911 | 3300015309 | Switchgrass Phyllosphere | LDPPYWTLTSFFGAFHTIWVHLGPFGCLTKIGAKRAEMVQKFVP* |
Ga0182182_10416661 | 3300015311 | Switchgrass Phyllosphere | MNAPNPPHWPLNSRFGVFRTLWMHLGPFGCRTKLGAKRAEV |
Ga0182182_10875341 | 3300015311 | Switchgrass Phyllosphere | MMNAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGAKRAELVQKFV |
Ga0182168_10100751 | 3300015312 | Switchgrass Phyllosphere | QATIAPDPPHWTLNSCFGAFHTIWMHLRPFGCLAKLGAKRAELVQKFVP* |
Ga0182168_10670921 | 3300015312 | Switchgrass Phyllosphere | APNPPHWNLNSCFGVFCTIWMHLDRFVALQKLNAKRAELVQ* |
Ga0182168_10730152 | 3300015312 | Switchgrass Phyllosphere | MNTPDPPHWTLKYHFAAFCTIWLHLGLFGCLTKLSAKRAELVQKFVPR |
Ga0182168_10823131 | 3300015312 | Switchgrass Phyllosphere | VSEYFATNATDPPHWTLNSCFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVLRSRIEIFRN |
Ga0182168_11040841 | 3300015312 | Switchgrass Phyllosphere | MKAPDPLHWTLNSCFGEFRTNWVHLGQFGCLKKLGAKRSEL |
Ga0182168_11059201 | 3300015312 | Switchgrass Phyllosphere | MTNAPDPPHWTLISWFGAFHTICVHLEPFGCLTKLGAKRAELVQKFVPRS |
Ga0182168_11098781 | 3300015312 | Switchgrass Phyllosphere | RVGIFLKNAPDPPHWTLNSYFGVSCIIWMHLGPFGCLTKLSAKQAELKQNYMP* |
Ga0182164_11289221 | 3300015313 | Switchgrass Phyllosphere | SEFFATNAPDPPHWTQNSYFCLFHTILVQLGLFGWLVKLDGKWAELV* |
Ga0182121_10918091 | 3300015316 | Switchgrass Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSCIGVF |
Ga0182121_10977761 | 3300015316 | Switchgrass Phyllosphere | APDPPHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKLAEVVQMFVP* |
Ga0182181_10228814 | 3300015318 | Switchgrass Phyllosphere | MNAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGAKRA |
Ga0182181_10243752 | 3300015318 | Switchgrass Phyllosphere | PHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKRAEVVQKFVP* |
Ga0182181_10311741 | 3300015318 | Switchgrass Phyllosphere | PDPPHWTLNSCFGVFCTIWVHLVPFGYITKLGAKRAEVVQNFVP* |
Ga0182130_11088701 | 3300015319 | Switchgrass Phyllosphere | MNAPDPPQWTLNLRFAVFCTVWVHLGPFGCVTKLGAKRAELVQKFVPQSCIGVF |
Ga0182165_10972861 | 3300015320 | Switchgrass Phyllosphere | MNTPDPPHWTLNSCFGVFCTIWVHLGPLCCLTKLGAKWAELVQKFVPRSRI |
Ga0182134_10983882 | 3300015324 | Switchgrass Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQ |
Ga0182148_10730491 | 3300015325 | Switchgrass Phyllosphere | EFFVMNAPDPPHWPLNSRFGVFRTLWMHLGPFGCRTKLGAKLAEVVQKFVP* |
Ga0182166_10744931 | 3300015326 | Switchgrass Phyllosphere | MNALHPPHWTLNRRFGVFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSHIGIFRI |
Ga0182166_10918261 | 3300015326 | Switchgrass Phyllosphere | NAPDPPYGTLNSGFGVFRTIWVHLVPFGYLTKLGTKRAEVVQKFVP* |
Ga0182166_11043641 | 3300015326 | Switchgrass Phyllosphere | MNAIDKPHCTLNRRFGVFPTIWVHLGLFGCLTKLGAKR |
Ga0182114_10326331 | 3300015327 | Switchgrass Phyllosphere | MINAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGAKRAELVQKFVPRSRVGVFR |
Ga0182114_10626802 | 3300015327 | Switchgrass Phyllosphere | AHDPPHWTLNSCFGVFHTIWVHLVPFGYLTKLSAKWAEVVQKLVPRSRVRIF* |
Ga0182153_10933031 | 3300015328 | Switchgrass Phyllosphere | MNVLDPPHWTLNRRFGVFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSHIGIFR |
Ga0182152_10115801 | 3300015330 | Switchgrass Phyllosphere | MNAPDPTHWTLNSCFGAFRTILVHLGPFGCLTKLDAKRTEQVQKF |
Ga0182152_10281551 | 3300015330 | Switchgrass Phyllosphere | MNAPEPPHFTLNSRFAAFCTIWVHLGPFGCLTKLDAKRVELVQK |
Ga0182152_11300901 | 3300015330 | Switchgrass Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSCIGV |
Ga0182152_11314981 | 3300015330 | Switchgrass Phyllosphere | MMNASDPPHWTQNSCFVAFRTIWVQLGPFGCLTKLGAKRAELVQKFVPRSR |
Ga0182131_11510541 | 3300015331 | Switchgrass Phyllosphere | MNAPDPPHWTLNSRFGALHTIRVHLGPFGCLTKLSAKRAEVVQKF |
Ga0182117_10405001 | 3300015332 | Switchgrass Phyllosphere | TMNTLDPPHWILNSYFGVFCTIWLHPGLFGCLTKLRAKRAEVVQKFVS* |
Ga0182147_10394091 | 3300015333 | Switchgrass Phyllosphere | PDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGEKRAEVVQKFVP* |
Ga0182132_11296051 | 3300015334 | Switchgrass Phyllosphere | MNAPDPPHWTLNSCFGAFHTIWVHLGPFGCLTKLGAKPAELV |
Ga0182150_11324741 | 3300015336 | Switchgrass Phyllosphere | VTNAPDPPHWTLNTCFGAFRTIWVHLGPFGCLTKLGAKRAEVLQNFM |
Ga0182150_11534631 | 3300015336 | Switchgrass Phyllosphere | MINAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGAKRAELVQKF |
Ga0182151_10228271 | 3300015337 | Switchgrass Phyllosphere | HWTLNTYFGAFHTIWVHLGPLGYLTKLGAKRSELVQKIVRRSRVE* |
Ga0182151_10690581 | 3300015337 | Switchgrass Phyllosphere | MNTLDPPHWILISYFGVFCTIWVHSGLFGCLTKLRAKRAEVGQKFVPRSRVEIFCN |
Ga0182149_11056791 | 3300015339 | Switchgrass Phyllosphere | MPDPPHWTLNSCFGVFCTIWMHLGPFGCLTKLGAKRAEV |
Ga0182149_11156021 | 3300015339 | Switchgrass Phyllosphere | VSEFFEMNAPDPPHWTLNSRFGAFRTIRVHLGPFGCLTKLGAKRAEVMQKFVPWS |
Ga0182149_11241781 | 3300015339 | Switchgrass Phyllosphere | HWTINSRFGVFRTIRVHLGAFGCLTKLSTKRAEVVQKFVL* |
Ga0182133_11334811 | 3300015340 | Switchgrass Phyllosphere | PNPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ* |
Ga0182115_11040021 | 3300015348 | Switchgrass Phyllosphere | LDFFTTNAPNPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ* |
Ga0182115_12949291 | 3300015348 | Switchgrass Phyllosphere | ATIAPDPPHWTLNSCFGAFNTIWMHLGPFGCLVKLDAKRAELVQKSVS* |
Ga0182185_12178601 | 3300015349 | Switchgrass Phyllosphere | MTNAPDPPHWTLISCFGAFHTIWVHLGPFGCLTKLGAKWAEL |
Ga0182185_12670842 | 3300015349 | Switchgrass Phyllosphere | MNEPDPPHCTLNSRFVVFCTIWVHLVPFGYLTKLGAKRAEV |
Ga0182163_11804621 | 3300015350 | Switchgrass Phyllosphere | WTLNSCFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSRVGVFRDERT* |
Ga0182163_12194211 | 3300015350 | Switchgrass Phyllosphere | MKAPDLPHWTLNSCFGVFRTIWVQLGPLCCHMKLGAKRADLVQKFVPRSRVRIFR |
Ga0182169_12440751 | 3300015352 | Switchgrass Phyllosphere | HWTLNSCFGVFHTIWVHLVSFGYLTKLGAKRAELVQKFVP* |
Ga0182179_13179891 | 3300015353 | Switchgrass Phyllosphere | MNTPDPPHWTLNSCFGVFCTIWVHLGPLCCLTKLGAKWAEL |
Ga0182167_12947021 | 3300015354 | Switchgrass Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLDAKRAELVQKFVPRSCIGVF |
Ga0182167_13523951 | 3300015354 | Switchgrass Phyllosphere | MKAPYPPHWTLNSCFGVFRTIWVHLGPLCCHMKLGAKRAELVQKF |
Ga0182199_11258371 | 3300017412 | Switchgrass Phyllosphere | MKAPDLPHWTLNSCFGVFRTIWVHLGPLCCHMKLGAKRAELV |
Ga0182195_10474811 | 3300017414 | Switchgrass Phyllosphere | MNALDPPHWILNSYFGVFCTIWVHLGLFGCLTKLRAKRAEV |
Ga0182201_10840311 | 3300017422 | Switchgrass Phyllosphere | VASEFQATIAPDPPHWTLNSCFGAFHTIWMHLRPFGYLAKLGAKRAELVQKFVT |
Ga0182201_11060351 | 3300017422 | Switchgrass Phyllosphere | EFFAMNAPDPPHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKLAEVVQKFVP |
Ga0182196_10424471 | 3300017432 | Switchgrass Phyllosphere | APDPPHWTLNSCFGVFRTIWVDWLLFGSLTKLGAKRREVVQKLVS |
Ga0182196_10938851 | 3300017432 | Switchgrass Phyllosphere | MNAPDPPHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKLAEVVQMFVP |
Ga0182200_11245381 | 3300017439 | Switchgrass Phyllosphere | MKAPDPPHSTLNSCFREFHTIWVRLGPFGCLTKLGAKRAELVQKFVP |
Ga0182214_10777151 | 3300017440 | Switchgrass Phyllosphere | HEIESEFFAMNTLDPPHWILNTYFGVFCTIWVHLGLFGCLTKLRAKPAEVVQKFVP |
Ga0182214_10984391 | 3300017440 | Switchgrass Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSCVG |
Ga0182215_11272521 | 3300017447 | Switchgrass Phyllosphere | MNALDPPHWTLNRHFGAFNTIWVHSGPFGCLTKLGAKRAELVQKFVPRSRIGICRN |
Ga0182212_10679481 | 3300017691 | Switchgrass Phyllosphere | MNAPDPPHWTLNSCFGVSCTIWVHLVPFGYLTKLGAKRAEVVQNFV |
Ga0182216_10956611 | 3300017693 | Switchgrass Phyllosphere | HWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ |
Ga0182216_11211571 | 3300017693 | Switchgrass Phyllosphere | MNAPDPPQWTLNSRFGAFRTIRVHLGPFGCLTKLSAKRAEVVQK |
Ga0182211_11512651 | 3300017694 | Switchgrass Phyllosphere | MNAPDPPHWTLNSHFGAFRTIRVHLGPFGCLTKLSAKRAEVVQKFV |
Ga0163161_106274381 | 3300017792 | Switchgrass Rhizosphere | MNAPDPPHWTLNSRFGAFRTILVHLGPFGCLTKLSAKRAEVVQKF |
Ga0182178_10019451 | 3300020023 | Switchgrass Phyllosphere | MKAPDPPHWTLNSCFGVFRTIWVHLGPLCCHMKLGAKRAELVQKT |
Ga0182146_1010421 | 3300020033 | Switchgrass Phyllosphere | NPPHWTLNSCFGAFHTIWVHLGQFGFHTKLGEKRAELVQ |
Ga0182118_1011221 | 3300020223 | Switchgrass Phyllosphere | NAPDPPHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKLAEVVQKFVP |
Ga0207712_118488112 | 3300025961 | Switchgrass Rhizosphere | MNALDPPQWTLNSRFGAFCTIRVHLGPFGCLTKLSAKRAEVVQKFL |
Ga0207668_113705041 | 3300025972 | Switchgrass Rhizosphere | MNAPDPPHWILNSCFGVFCTIWMHLGPFGCRTKLGAKRAEVVQK |
Ga0207703_118420851 | 3300026035 | Switchgrass Rhizosphere | MNALDPPHWTLNRRFGVFHTIWVHLGPFGCLTKLGAKRAELVQKFV |
Ga0207641_111349432 | 3300026088 | Switchgrass Rhizosphere | SQFLITNAPDPPHLTLNSCFGVFRTILVHLVPFGYLRKLGAKWAEVLQNFVP |
Ga0268322_10062161 | 3300028049 | Phyllosphere | FFTTNAPNPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ |
Ga0268322_10084281 | 3300028049 | Phyllosphere | MNAPDPPHWTLNSYFGVFRTIWVQLGQFGCLTNLGGNRAKLGQKFM |
Ga0268322_10101641 | 3300028049 | Phyllosphere | MKAPDPPHSTLNSCFREFHTIWMRLGPFGCLTKLGAKRAELVQMFVPRSRIGIFR |
Ga0268322_10409101 | 3300028049 | Phyllosphere | MSAPDPPHWILNTCFGVFRTIYVHLGPFGCLTKLEAKRSELVQKFVRRSR |
Ga0268344_10062211 | 3300028051 | Phyllosphere | MKAPDPPHWTLNSCFGVFRTIWVHLGPLCCHMKLGAKRPELVQK |
Ga0268344_10183241 | 3300028051 | Phyllosphere | MNAPDPPHWTLNRRFGAFHTWVHSGPFGCPSKLGAKRAELVQKF |
Ga0268300_10020581 | 3300028052 | Phyllosphere | NPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ |
Ga0268300_10061281 | 3300028052 | Phyllosphere | MNAPDPTHGTLNSCFGVFCTIWMHLGPFGCLSKLSAKQAELV |
Ga0268346_10002992 | 3300028053 | Phyllosphere | MNAPDPPHWPLNLHFGVFRTLWMHLGPFGCRTKLGAKLAEVVQKFVP |
Ga0268306_10187991 | 3300028054 | Phyllosphere | DPPHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKWAEVVQKFVP |
Ga0268338_10004541 | 3300028055 | Phyllosphere | MTAPDPAHWTLNSCFGAFHTIWMHLGLFGCLAKLGAKRAELVQKFVP |
Ga0268330_10269552 | 3300028056 | Phyllosphere | WTLNSCFGVFCTIWVHLVPFGYLTKLGAKRAEVVQKFVP |
Ga0268330_10620622 | 3300028056 | Phyllosphere | MSAPDPPHWILNTCFGVFRTICVHLGPLGCLTKLGAKRSEL |
Ga0268332_10002354 | 3300028058 | Phyllosphere | MKAPDPPHWTLNSCFGVFRTIWVHLGPLCCHMKLGAKRAELVQKFVPR |
Ga0268332_10688621 | 3300028058 | Phyllosphere | CHEVALEFFATDALDPPHWTLNSCFGEFHTIWVHLGQFGCLTKLGAKLAKLVQKVVP |
Ga0268314_10048862 | 3300028061 | Phyllosphere | MNTPDPPHWPLNSRFGVFRTLWMHLGPFGCRTKLGAKLAEVVQK |
Ga0268314_10177731 | 3300028061 | Phyllosphere | MKAPDPPHSTLNSCFREFHTIWVRLGPFGCLPKLGAKRAELVQK |
Ga0268314_10435382 | 3300028061 | Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSCI |
Ga0268314_10511271 | 3300028061 | Phyllosphere | MNAPNPPHWTLNSCFVVFPTIWVHLGPFGCLTKLSTKGAKLVQK |
Ga0268342_10022511 | 3300028062 | Phyllosphere | TNTPNPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ |
Ga0268342_10076623 | 3300028062 | Phyllosphere | NAPDPPRWTLNSCFGAFRTIWVHLVPFRYLTNLGAKRAEVVQKFVP |
Ga0268342_10203902 | 3300028062 | Phyllosphere | MNTPDPPHWTLNYRFAAFRTICVHLGPFGCLPKLGAKRAELVQK |
Ga0268340_10617261 | 3300028064 | Phyllosphere | MKAPDPPHWTLNSCFGVFRTIWVHLGPLCCHMKLGAKRAELVQKF |
Ga0268340_10834551 | 3300028064 | Phyllosphere | PPYGTLNSGFGVFRTIWVHLVPFGYLTKLGAKRAEVVQKFVP |
Ga0268355_10115802 | 3300028139 | Phyllosphere | MNAPDPTHGTLNSCFGVFCTIWMHLGPFGCLSKLSAKQAELVQK |
Ga0268326_10039631 | 3300028141 | Phyllosphere | MSAPDPPHWILNTCFGVFRTICVHLGPLGCLTKLGAKRSELVQKFVRRSRV |
Ga0268326_10121071 | 3300028141 | Phyllosphere | MSTPDPPHWPLNSRFGVFRTLWMHLGPFGCRTKLGAKRAEVVQKFV |
Ga0268326_10129061 | 3300028141 | Phyllosphere | MNAPDPPHWISCFGAFHTIWVHFGPFGCLTKLGAKRAKLVQKFVPQSCVGVF |
Ga0268347_10001291 | 3300028142 | Phyllosphere | MNAPDPPHFTLNSRFPAFRTIWVHLGPFGCLTKLGAKQAELFKKFVPRSCI |
Ga0268347_10014611 | 3300028142 | Phyllosphere | EVASEFFATNATDPPHWTLNSCFGVFRTIWMHLGPFGCLTKLGAKRAEVVQKKFMP |
Ga0268348_10251211 | 3300028143 | Phyllosphere | MNTPDPPHWTLKYHFAAFCTIWLHLGLFGCLTKLSAKRAELVQKFVPRICFG |
Ga0268353_1198022 | 3300028149 | Phyllosphere | MNAPDPPHWTLNSRLGAFRTIRVHLGPFGCLTKLSAKRA |
Ga0268343_10021811 | 3300028150 | Phyllosphere | MKAPDPPHWTLNSCFGVFRTIWVHLGPLCCHMKLGAKRAELVQK |
Ga0268343_10082422 | 3300028150 | Phyllosphere | FTTNAPDPPYGTLNSGFGVFRTIWVHLVPFGYLTKLGAKRAEVVQKFVP |
Ga0268308_10053211 | 3300028151 | Phyllosphere | MNAPDPPHWTLNYRFAAFRTICVHLGPFGCLPKLGTKRAELV |
Ga0268308_10295231 | 3300028151 | Phyllosphere | MINAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGAKRAELV |
Ga0268341_10012672 | 3300028154 | Phyllosphere | NAHDPPHRTLNSCFGVFRTIWVHLVPFGYLTKLGAKRAEVVQKFVP |
Ga0268341_10217682 | 3300028154 | Phyllosphere | MNTPDPPHWTLNYHFAAFRTIWMHLGLFGCLTILGAKQAELVQKF |
Ga0268312_10199271 | 3300028248 | Phyllosphere | MTNAPDPPHWTLNTCFGAFHTIWVHLGPFGCLTKLDAKRAKLVQKFVPRSRVRVFRDERT |
Ga0268324_10006411 | 3300028251 | Phyllosphere | WTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ |
Ga0268324_10016181 | 3300028251 | Phyllosphere | MNAPNPPHWTLNSCFGAFHTIWVHLGQFGFHTKLGEKRAELVQ |
Ga0268324_10031192 | 3300028251 | Phyllosphere | VASEFFTTNAPDPPYGTLNSGFGVFRTIWVHLVPFGYLTKLGAKRAEVVQKFVP |
Ga0268316_10037611 | 3300028253 | Phyllosphere | MNAPNPPHWTLNSCFGAFHTIWVHLGKFGFHTKLGEKRAELVQ |
Ga0268304_10137591 | 3300028256 | Phyllosphere | MMNAPDPPHWILKSYFVAFHTIWVHLGPFGCLTKLGAKWAELVQKF |
Ga0268304_10151331 | 3300028256 | Phyllosphere | MNAPDPPHWPLNSRFGVFRTLWMHLGPFGCRTKLGA |
Ga0268310_10042591 | 3300028262 | Phyllosphere | DRPHWTLNSCFGVFRTIWVHLVPFGYLTKLGVKWAEVVQKFVP |
Ga0268325_1005561 | 3300028463 | Phyllosphere | MNTPDPPHWTLNYRFAAFCTIWVHLGLFGCLTKLGAKRAELVQKFVPRS |
Ga0268333_10045871 | 3300028467 | Phyllosphere | DPPHWTLNSCFGVFRTIWMHLGPFGCLTKLGAKRAEVVQKKFMP |
Ga0268323_10216362 | 3300028471 | Phyllosphere | MNAPDPPHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKLAD |
Ga0268315_10119681 | 3300028472 | Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSCVRVFRDE |
Ga0268319_10112371 | 3300028473 | Phyllosphere | MINAPDPPHWTLNSCFVAFRTIWVHLGPFGCLTKLGAKRAELVQKFVQRSRVRVFRD |
Ga0268319_10234301 | 3300028473 | Phyllosphere | MNAPDPPHWTLNCRFGVFHTIWVHSELFGCFTKLDAKRAELVQKFVPRSR |
Ga0268331_10115961 | 3300028474 | Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLGAKRAELVQKFVPRSCIGVFHDE |
Ga0268331_10274492 | 3300028474 | Phyllosphere | MNAPDPPHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKLA |
Ga0268309_10004981 | 3300028477 | Phyllosphere | NAPNPPHWTLNSCFGAFHTIWVHLGQFGCLTKLGEKRAELVQ |
Ga0268309_10013792 | 3300028477 | Phyllosphere | MPDPPHWTLNRRFGMFHIIWAPLGPFGFLTEFGAKRAELVQKF |
Ga0268309_10169502 | 3300028477 | Phyllosphere | MNTPDPPHWSLNSCFGAFRTNLVHLGPFGCLTKLEAKWAELVQKFV |
Ga0268313_10083152 | 3300028523 | Phyllosphere | MKAPDPPHSTLNSCFREFHTIWVRLGPFGCLTKLGAKRAELVQMFVPRSRI |
Ga0268313_10178791 | 3300028523 | Phyllosphere | FETNAPDALQWTLNTCFGVFRTIWVHLVPFGFLTKLGAKWAEVVQKFVP |
Ga0268305_1002332 | 3300028525 | Phyllosphere | TSEFFTMNTLDPPHWILNSYFGVICTIWLHLGLFGCLTKLRAKWAEVVQKFVP |
Ga0268339_10008941 | 3300028526 | Phyllosphere | VASEFFTTNALDPPHWTLNLCFVASHTTWVHLGPLGCLTKLSAKRAELVQK |
Ga0268339_10094812 | 3300028526 | Phyllosphere | EFFAMNAPDPPHWTLNSRFGAFRTIRVHLGPFGCLTKLSAKLAEVVQMFVP |
Ga0268339_10110381 | 3300028526 | Phyllosphere | APNPPYRNLTRRFGAFRTIWVHLGPFGCHTELGAKRAELVQKIVP |
Ga0268335_10135412 | 3300028527 | Phyllosphere | MTNAPDPPHWTLISWFGAFHTIWVHLGPFGCLTKLDAKRAELVQKFVPRSRFG |
Ga0214490_10730291 | 3300032502 | Switchgrass Phyllosphere | LDPPHWILNTYFGVFCTIWVHFGLFGCLTKLRAKPAEVVQKFVP |
Ga0214490_11283751 | 3300032502 | Switchgrass Phyllosphere | MNTPDPPHCPLNSRFCVFRTLWMHLGPFGCRKKLGAKLAEVVQKL |
Ga0214483_10626401 | 3300032548 | Switchgrass Phyllosphere | MNKPDPPHWNLNSCFGAFHTIWVLLRPFGCLTKLREKRFELV |
Ga0214501_12412601 | 3300032625 | Switchgrass Phyllosphere | MNAPDPPHWHLNSRFDVFRTLWMHLGPFRCPKKVGAKRAEVVQKFV |
Ga0214485_11060141 | 3300032698 | Switchgrass Phyllosphere | MNAPNPPHSTLNLRFGTFCTIRVHLGPFGCFTELGAKRAELVQKFVPRSRVGI |
Ga0314741_11254251 | 3300032934 | Switchgrass Phyllosphere | MSEFFATNTPDPPHWTLNSGFGTCRTVWMLLGPFRCLTKLGAKWAETV |
⦗Top⦘ |