NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028879

Metagenome / Metatranscriptome Family F028879

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028879
Family Type Metagenome / Metatranscriptome
Number of Sequences 190
Average Sequence Length 45 residues
Representative Sequence EPYLMALVLLVATPRRYLSWPYLGMIAACVLPALLVVARRRTLYM
Number of Associated Samples 161
Number of Associated Scaffolds 190

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 5.79 %
% of genes near scaffold ends (potentially truncated) 95.79 %
% of genes from short scaffolds (< 2000 bps) 92.11 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (57.895 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.684 % of family members)
Environment Ontology (ENVO) Unclassified
(20.526 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.895 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 0.00%    Coil/Unstructured: 50.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 190 Family Scaffolds
PF01370Epimerase 10.00
PF16363GDP_Man_Dehyd 6.32
PF03721UDPG_MGDP_dh_N 1.05
PF00248Aldo_ket_red 0.53
PF00535Glycos_transf_2 0.53
PF13546DDE_5 0.53
PF00171Aldedh 0.53
PF03720UDPG_MGDP_dh_C 0.53
PF01571GCV_T 0.53
PF00528BPD_transp_1 0.53
PF02770Acyl-CoA_dh_M 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 190 Family Scaffolds
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.05
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.05
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.05
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 1.05
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 1.05
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.53
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.53
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.53
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A57.89 %
All OrganismsrootAll Organisms42.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111022|2221194595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1305Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100859977Not Available501Open in IMG/M
3300003219|JGI26341J46601_10071441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1049Open in IMG/M
3300004091|Ga0062387_100373475Not Available950Open in IMG/M
3300004091|Ga0062387_101768431Not Available504Open in IMG/M
3300005103|Ga0066813_1015343Not Available516Open in IMG/M
3300005336|Ga0070680_100024054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4862Open in IMG/M
3300005344|Ga0070661_100210135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1489Open in IMG/M
3300005363|Ga0008090_14908830Not Available508Open in IMG/M
3300005435|Ga0070714_100529428Not Available1126Open in IMG/M
3300005436|Ga0070713_100928996All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300005437|Ga0070710_11389586Not Available524Open in IMG/M
3300005439|Ga0070711_100069688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola2474Open in IMG/M
3300005445|Ga0070708_101517778Not Available624Open in IMG/M
3300005537|Ga0070730_10803260Not Available593Open in IMG/M
3300005537|Ga0070730_10964194Not Available533Open in IMG/M
3300005549|Ga0070704_100367037Not Available1219Open in IMG/M
3300005564|Ga0070664_100430491Not Available1209Open in IMG/M
3300005577|Ga0068857_100350741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1366Open in IMG/M
3300005587|Ga0066654_10841559Not Available523Open in IMG/M
3300005591|Ga0070761_10625871Not Available671Open in IMG/M
3300005602|Ga0070762_10294579Not Available1021Open in IMG/M
3300005840|Ga0068870_10353593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium943Open in IMG/M
3300006102|Ga0075015_100866896Not Available546Open in IMG/M
3300006175|Ga0070712_100731580Not Available845Open in IMG/M
3300006176|Ga0070765_100407328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-021270Open in IMG/M
3300006176|Ga0070765_102246381Not Available508Open in IMG/M
3300006358|Ga0068871_101200684All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300006755|Ga0079222_10077127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1665Open in IMG/M
3300006755|Ga0079222_11115996Not Available695Open in IMG/M
3300006903|Ga0075426_11413591All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300006904|Ga0075424_101095412Not Available849Open in IMG/M
3300006914|Ga0075436_100948728All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300007076|Ga0075435_101700962All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300007788|Ga0099795_10650270Not Available504Open in IMG/M
3300009521|Ga0116222_1039940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2057Open in IMG/M
3300009553|Ga0105249_11755820All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300009698|Ga0116216_10318294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola947Open in IMG/M
3300009700|Ga0116217_10289536Not Available1055Open in IMG/M
3300010152|Ga0126318_11037539All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300010329|Ga0134111_10509454Not Available529Open in IMG/M
3300010341|Ga0074045_10618440Not Available690Open in IMG/M
3300010373|Ga0134128_10634969Not Available1187Open in IMG/M
3300010373|Ga0134128_10846189Not Available1013Open in IMG/M
3300010379|Ga0136449_100414599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2382Open in IMG/M
3300010396|Ga0134126_10910343Not Available989Open in IMG/M
3300010397|Ga0134124_10306743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1481Open in IMG/M
3300010876|Ga0126361_10990656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1092Open in IMG/M
3300010880|Ga0126350_10077948Not Available914Open in IMG/M
3300012176|Ga0153952_1113316Not Available595Open in IMG/M
3300012207|Ga0137381_10554961Not Available1001Open in IMG/M
3300012210|Ga0137378_11149891Not Available691Open in IMG/M
3300012349|Ga0137387_11150938Not Available550Open in IMG/M
3300012357|Ga0137384_10148276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1964Open in IMG/M
3300012481|Ga0157320_1004628All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300012961|Ga0164302_11082573Not Available631Open in IMG/M
3300013105|Ga0157369_11215220Not Available769Open in IMG/M
3300014168|Ga0181534_10383712Not Available774Open in IMG/M
3300014201|Ga0181537_10390522Not Available955Open in IMG/M
3300014201|Ga0181537_11158459Not Available522Open in IMG/M
3300016319|Ga0182033_11061818Not Available722Open in IMG/M
3300016319|Ga0182033_12101217All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300016387|Ga0182040_10996760Not Available698Open in IMG/M
3300016422|Ga0182039_10989818All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300017926|Ga0187807_1041074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1432Open in IMG/M
3300017930|Ga0187825_10282759Not Available614Open in IMG/M
3300017943|Ga0187819_10519111Not Available679Open in IMG/M
3300017946|Ga0187879_10038078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola2878Open in IMG/M
3300017946|Ga0187879_10080340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1884Open in IMG/M
3300017955|Ga0187817_10719391Not Available637Open in IMG/M
3300017959|Ga0187779_10276136Not Available1069Open in IMG/M
3300017970|Ga0187783_10922901Not Available629Open in IMG/M
3300017972|Ga0187781_10460523Not Available911Open in IMG/M
3300017972|Ga0187781_11498771Not Available500Open in IMG/M
3300017975|Ga0187782_11662979Not Available505Open in IMG/M
3300018034|Ga0187863_10222723Not Available1049Open in IMG/M
3300018037|Ga0187883_10641637Not Available552Open in IMG/M
3300018043|Ga0187887_10892451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae526Open in IMG/M
3300018046|Ga0187851_10816621Not Available524Open in IMG/M
3300018060|Ga0187765_10879285Not Available605Open in IMG/M
3300018085|Ga0187772_10172799Not Available1440Open in IMG/M
3300018085|Ga0187772_10375404Not Available986Open in IMG/M
3300018085|Ga0187772_10909625Not Available640Open in IMG/M
3300020082|Ga0206353_10170175All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300020582|Ga0210395_10489530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium925Open in IMG/M
3300021088|Ga0210404_10560651Not Available648Open in IMG/M
3300021181|Ga0210388_10058141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3237Open in IMG/M
3300021388|Ga0213875_10165652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1037Open in IMG/M
3300021402|Ga0210385_10298475Not Available1194Open in IMG/M
3300021403|Ga0210397_11015194All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300021405|Ga0210387_11436078Not Available592Open in IMG/M
3300021405|Ga0210387_11527005Not Available571Open in IMG/M
3300021406|Ga0210386_11358009Not Available597Open in IMG/M
3300021420|Ga0210394_10173099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1879Open in IMG/M
3300021474|Ga0210390_10637692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae891Open in IMG/M
3300021477|Ga0210398_10652847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02853Open in IMG/M
3300021478|Ga0210402_10043543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3909Open in IMG/M
3300021559|Ga0210409_10211527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1763Open in IMG/M
3300021559|Ga0210409_11337528All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300021560|Ga0126371_11105467Not Available932Open in IMG/M
3300021560|Ga0126371_12521271Not Available622Open in IMG/M
3300024249|Ga0247676_1018316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1100Open in IMG/M
3300024283|Ga0247670_1044023All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300025898|Ga0207692_10545603Not Available740Open in IMG/M
3300025900|Ga0207710_10367494Not Available735Open in IMG/M
3300025906|Ga0207699_10683561Not Available751Open in IMG/M
3300025912|Ga0207707_11156002Not Available628Open in IMG/M
3300025916|Ga0207663_10622147Not Available850Open in IMG/M
3300025918|Ga0207662_10671601Not Available725Open in IMG/M
3300025929|Ga0207664_10841059Not Available825Open in IMG/M
3300025932|Ga0207690_11147235All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300026023|Ga0207677_10585333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium977Open in IMG/M
3300026879|Ga0207763_1030418Not Available506Open in IMG/M
3300026999|Ga0207949_1004462Not Available1253Open in IMG/M
3300027080|Ga0208237_1041940Not Available687Open in IMG/M
3300027545|Ga0209008_1044404Not Available1018Open in IMG/M
3300027570|Ga0208043_1153647Not Available599Open in IMG/M
3300027570|Ga0208043_1173901Not Available553Open in IMG/M
3300027583|Ga0209527_1063888Not Available829Open in IMG/M
3300027698|Ga0209446_1085955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola805Open in IMG/M
3300027824|Ga0209040_10540691Not Available509Open in IMG/M
3300027853|Ga0209274_10746207Not Available504Open in IMG/M
3300027867|Ga0209167_10515658Not Available654Open in IMG/M
3300027911|Ga0209698_10602410Not Available844Open in IMG/M
3300028047|Ga0209526_10242448Not Available1236Open in IMG/M
3300028742|Ga0302220_10187038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia776Open in IMG/M
3300028759|Ga0302224_10064068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1387Open in IMG/M
3300028768|Ga0307280_10013449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola2263Open in IMG/M
3300028773|Ga0302234_10153611Not Available1002Open in IMG/M
3300028775|Ga0302231_10311213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300028808|Ga0302228_10008296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5919Open in IMG/M
3300029999|Ga0311339_10636890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1054Open in IMG/M
3300030399|Ga0311353_10108994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus2685Open in IMG/M
3300030399|Ga0311353_10988758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300030509|Ga0302183_10307799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300030741|Ga0265459_11363448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia795Open in IMG/M
3300031027|Ga0302308_10098636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1997Open in IMG/M
3300031028|Ga0302180_10140233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1349Open in IMG/M
3300031525|Ga0302326_10845521Not Available1311Open in IMG/M
3300031525|Ga0302326_13352267Not Available536Open in IMG/M
3300031543|Ga0318516_10373054Not Available823Open in IMG/M
3300031544|Ga0318534_10143626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1376Open in IMG/M
3300031544|Ga0318534_10161647Not Available1294Open in IMG/M
3300031681|Ga0318572_10835164All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300031708|Ga0310686_100491696Not Available1038Open in IMG/M
3300031708|Ga0310686_106245528All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031708|Ga0310686_112450903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300031713|Ga0318496_10238570Not Available1002Open in IMG/M
3300031713|Ga0318496_10410367Not Available749Open in IMG/M
3300031724|Ga0318500_10203754Not Available949Open in IMG/M
3300031747|Ga0318502_10052208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola2155Open in IMG/M
3300031770|Ga0318521_10068470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1884Open in IMG/M
3300031770|Ga0318521_10223959Not Available1092Open in IMG/M
3300031778|Ga0318498_10154003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1046Open in IMG/M
3300031781|Ga0318547_10598993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300031819|Ga0318568_10045565All Organisms → cellular organisms → Bacteria → Terrabacteria group2513Open in IMG/M
3300031833|Ga0310917_10611597All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300031858|Ga0310892_11221171All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031859|Ga0318527_10374287Not Available607Open in IMG/M
3300031879|Ga0306919_10123280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1858Open in IMG/M
3300031896|Ga0318551_10232296Not Available1027Open in IMG/M
3300031897|Ga0318520_10941272Not Available545Open in IMG/M
3300031912|Ga0306921_11867935Not Available644Open in IMG/M
3300031959|Ga0318530_10176163Not Available874Open in IMG/M
3300031959|Ga0318530_10262450Not Available712Open in IMG/M
3300031962|Ga0307479_10039601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4523Open in IMG/M
3300032008|Ga0318562_10813168Not Available535Open in IMG/M
3300032009|Ga0318563_10267758Not Available924Open in IMG/M
3300032009|Ga0318563_10651984Not Available566Open in IMG/M
3300032063|Ga0318504_10432388Not Available629Open in IMG/M
3300032063|Ga0318504_10598541All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300032066|Ga0318514_10201192Not Available1043Open in IMG/M
3300032068|Ga0318553_10355708Not Available767Open in IMG/M
3300032076|Ga0306924_10463508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1447Open in IMG/M
3300032076|Ga0306924_11032009Not Available901Open in IMG/M
3300032089|Ga0318525_10618795Not Available552Open in IMG/M
3300032091|Ga0318577_10064364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1668Open in IMG/M
3300032180|Ga0307471_100480196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1388Open in IMG/M
3300032261|Ga0306920_100300606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola2390Open in IMG/M
3300032261|Ga0306920_100785615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1398Open in IMG/M
3300032261|Ga0306920_101851692Not Available850Open in IMG/M
3300032782|Ga0335082_11050296Not Available680Open in IMG/M
3300032783|Ga0335079_10414944Not Available1449Open in IMG/M
3300032805|Ga0335078_11367839All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300032892|Ga0335081_10481947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1567Open in IMG/M
3300032895|Ga0335074_10205983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola2388Open in IMG/M
3300032895|Ga0335074_10934909Not Available778Open in IMG/M
3300033004|Ga0335084_11659941Not Available629Open in IMG/M
3300033158|Ga0335077_11603254Not Available619Open in IMG/M
3300034199|Ga0370514_040964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1158Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.68%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.21%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.16%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.16%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.11%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.11%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.11%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.58%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.58%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.05%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.05%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.05%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.05%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.53%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.53%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.53%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.53%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.53%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.53%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005103Soil and rhizosphere microbial communities from Laval, Canada - mgLAAEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012176Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaGHost-AssociatedOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300026999Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22220141592209111022Grass SoilMALVLLVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
INPhiseqgaiiFebDRAFT_10085997723300000364SoilLIEPYLMALVLMVSTPRSSLSWRYLGMIAACVLPALAVVARRRILYM*
JGI26341J46601_1007144113300003219Bog Forest SoilLIEPYLMALVLLVATPRRYLNWPYLGLIAACVLPALLVVARRRILYM*
Ga0062387_10037347513300004091Bog Forest SoilRSLIEPYLMALILLLATPRQYLNWRYFALIVASAAPALAVVARRRILYM*
Ga0062387_10176843113300004091Bog Forest SoilTSTFGEGRSLIEPYLMALVLLVATPRHYLNWRYLGMIAACVLPALAVVARRRILYM*
Ga0066813_101534323300005103SoilIEPYLMALVLLVSTPRRALSWPYLGMIAACVLPALAVVARRRILYM*
Ga0070680_10002405423300005336Corn RhizosphereMALVLMVSTPRSSLSWRYLGTFAACVLPALAVVARRRILYM*
Ga0070661_10021013513300005344Corn RhizosphereMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0008090_1490883013300005363Tropical Rainforest SoilEPYLMALILLLATPRQYLSWRYLGLITACVLPALLVVARRRILYM*
Ga0070714_10052942823300005435Agricultural SoilDGRSLIEPYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM*
Ga0070713_10092899623300005436Corn, Switchgrass And Miscanthus RhizospherePYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0070710_1138958633300005437Corn, Switchgrass And Miscanthus RhizosphereIEPYLMALIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM*
Ga0070711_10006968833300005439Corn, Switchgrass And Miscanthus RhizosphereSLIEPYLMALIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM*
Ga0070708_10151777813300005445Corn, Switchgrass And Miscanthus RhizosphereMALVLMVSTPRRSLSWAYLGTVAACVLPALAVVARRRTLYM*
Ga0070730_1080326013300005537Surface SoilEPYLMALVLLLATPRRYLSWPYLGMICACVLPALAVVARRRTLYM*
Ga0070730_1096419423300005537Surface SoilVLLLATPRRSINWAYLGMITACVLPALAVVARRRTLYM*
Ga0070704_10036703723300005549Corn, Switchgrass And Miscanthus RhizosphereRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0070664_10043049133300005564Corn RhizosphereMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRIL
Ga0068857_10035074113300005577Corn RhizosphereSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0066654_1084155913300005587SoilSLIEPYLMALVLLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM*
Ga0070761_1062587113300005591SoilFGDGRSLIEPYLLALILLLATPRQYLSWRYLGLITACVAPALLVVARRRILYM*
Ga0070762_1029457913300005602SoilEPYLMALILLLATPRHYLSWRYLGLIVACVAPALAVVARRRILYM*
Ga0068870_1035359313300005840Miscanthus RhizosphereVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0075015_10086689613300006102WatershedsMALVLLVATPRRYLNWPYLGLIVACVVPALLVVARRRILYM*
Ga0070712_10073158013300006175Corn, Switchgrass And Miscanthus RhizosphereGDGRSLIEPYLMALVLMVSTPRRSLSWAYLGTIAAFVLPALAVVARRRTLYM*
Ga0070765_10040732823300006176SoilSLIEPYLMALILLLATPRRYLSGRYLSLIAAWAIPALVVVARRRILYM*
Ga0070765_10224638113300006176SoilFGEGRSLIEPYLMALILLLATPRHYLSWRYLGLIVACVAPALAVVARRRILYM*
Ga0068871_10120068423300006358Miscanthus RhizosphereVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0079222_1007712723300006755Agricultural SoilMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM*
Ga0079222_1111599623300006755Agricultural SoilMALILLVSTPKRFLSWPYLAMIATCVLPALAVEARRRILYM*
Ga0075426_1141359123300006903Populus RhizosphereLVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0075424_10109541223300006904Populus RhizosphereYLLALIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM*
Ga0075436_10094872823300006914Populus RhizosphereLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0075435_10170096213300007076Populus RhizosphereYLMALVLMVSTPRNSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0099795_1065027023300007788Vadose Zone SoilLIEPYLMALILLLATPRQYLSWRYLSLIAACAGPALLVVARRRILYM*
Ga0116222_103994023300009521Peatlands SoilMALILLLATPRKYLSWRYLGPITACVIPALLVVARRRILYM*
Ga0105249_1175582013300009553Switchgrass RhizosphereGRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0116216_1031829423300009698Peatlands SoilMALVLLVATPRRYLNWPYLGLIAACVMPALLVVARRRILYM*
Ga0116217_1028953623300009700Peatlands SoilLATPRRYLSSLNLTLILAWVLPALLVVARRRALYM*
Ga0126318_1103753913300010152SoilSTPRHSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0134111_1050945423300010329Grasslands SoilTSTFGEGRSLIEPYLMALVVLVSTPRRSLPWPYLAMIAACVLPALAVVARRRTLYM*
Ga0074045_1061844023300010341Bog Forest SoilGRSLIEPYLMALVLLVATPRRYLNWPYLGLIAACVMPALLVVARRRILYM*
Ga0134128_1063496923300010373Terrestrial SoilFGEGRSLIEPYLMALVLLVSTPRSSLSWRYLGMIAACVLPALAVVARRRILYM*
Ga0134128_1084618923300010373Terrestrial SoilFGEGRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0136449_10041459933300010379Peatlands SoilLMALILLLATPRQYLSWRYLGPITACVIPALLVVARRRILYM*
Ga0134126_1091034323300010396Terrestrial SoilLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM*
Ga0134124_1030674323300010397Terrestrial SoilLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM*
Ga0126361_1099065613300010876Boreal Forest SoilMALVLLMATPRRYLSWRYLSLIAAFAVPALLVVARRRALFM*
Ga0126350_1007794823300010880Boreal Forest SoilALILLLATPRHYLSWRYLGLIVACAAPALAIVARRRILYM*
Ga0153952_111331613300012176Attine Ant Fungus GardensILLLATPRHYLSWRYLGLIVACAAPALAIVARRRILYM*
Ga0137381_1055496113300012207Vadose Zone SoilIEPYLMALVLLVSTPRRSLSRRYLGMIAACVLPALAVVARRRILYM*
Ga0137378_1114989113300012210Vadose Zone SoilLLALVLLVATPRRYLSWPYLGMIAACAIPALLVAARRRILYM*
Ga0137387_1115093813300012349Vadose Zone SoilEPYLMALVLLVATPRRYLSWPYLGMIAACVLPALLVVARRRTLYM*
Ga0137384_1014827613300012357Vadose Zone SoilLVLLVSTPRRSLPWPYIATIAACVLPALAVVARRRILYM*
Ga0157320_100462813300012481Arabidopsis RhizosphereEIWTSTFGEGRSLIEPYLMALVLMVSTPRSSLSWRYLGMIAACVLPALAVVARRRILYM*
Ga0164302_1108257313300012961SoilMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM*
Ga0157369_1121522023300013105Corn RhizosphereMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILY
Ga0181534_1038371213300014168BogIEPYLMALVLMLATPRRYLSWRYLGPIVAVAVPALVVVARRRILYM*
Ga0181537_1039052223300014201BogMALVLLLATPQRYMSRRYLGLVVACIVPALVVVARRRILYM*
Ga0181537_1115845923300014201BogLFATPRRYLSWPYLGMIVACAVPALLVVARRRSLYM*
Ga0182033_1106181813300016319SoilLILLLATPRQYLSWRYLGPIAACVLPALAVVARRRILYM
Ga0182033_1210121723300016319SoilQIWTSTFGEGRSLIEPYLMALVLLVSTPKRVLSWRYLVMIAACVLPALAVVARRRILYM
Ga0182040_1099676013300016387SoilTFGEGRSLIEPYLMALILLLATPRQYLSWRYLGLITACVLPVLVVVARRRIMYM
Ga0182039_1098981823300016422SoilGEGRSLIEPYLMALVLLVSTPKRYLSWPYLGVIAACVLPALAVVARRRILYM
Ga0187807_104107413300017926Freshwater SedimentFGDGRSLIEPYLLALILLLATPKRYLSWPYLGLIVACALPALLVVARRRILYM
Ga0187825_1028275933300017930Freshwater SedimentYLMALILLLATPRQYLSWRYLGLITACALPVLAVVARRRILYM
Ga0187819_1051911123300017943Freshwater SedimentTFGDGRSLIEPYLLALILLLATPKRYLSWPYLGLIMACVMPALLVVARRRILHM
Ga0187879_1003807833300017946PeatlandIEPYLMALILLFATPQRYLSWRYLSLMAAWAVPALVVVARRRILYM
Ga0187879_1008034023300017946PeatlandSLIEPYLMALVLLLATPRRYLNWPYLGMIVACAMPALLVVARRRALYM
Ga0187817_1071939113300017955Freshwater SedimentLVLLLATPRQYLSWRYLGLITACVVPALLVVARRRILYM
Ga0187779_1027613613300017959Tropical PeatlandFGEGRSLIEPYLMALVLLLATPRQYLSWRYLGLITACVLAALAVVARRRILYM
Ga0187783_1092290113300017970Tropical PeatlandMALILLLATPRRYLSSRYLGLIAACVIPALLVVARRRILYM
Ga0187781_1046052323300017972Tropical PeatlandLILLLATPRQYLNWRYLGFIMACMAPALALVARRRILNM
Ga0187781_1149877123300017972Tropical PeatlandSLIEPYLMALILLLATPRQYLNWRYLGLIAACVLPALAVVARRRILYM
Ga0187782_1166297923300017975Tropical PeatlandTFGDGRSLIEPYLMALILLLATPRQYLSWRYLGPVIACVLPALAVVARRRILYM
Ga0187863_1022272323300018034PeatlandYLMALILLFATPQRYLSWRYLSLMAAWAVPALVVVARRRILYM
Ga0187883_1064163713300018037PeatlandPYLMALVLLLATPRRYMSWTYLAMIVACVLPALAIVIRRRTLYM
Ga0187887_1089245123300018043PeatlandSLIEPYLMALILLFATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM
Ga0187851_1081662123300018046PeatlandDGRSLIEPYLMALILLFATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM
Ga0187765_1087928523300018060Tropical PeatlandMALILLLATPRQYLSWRYLGLITAFVLPALAVVARRRILYM
Ga0187772_1017279923300018085Tropical PeatlandEGRSLIEPYLMALVLLVSTPRRYVNWPYIGMIVACVLPALAVVARRRILYM
Ga0187772_1037540423300018085Tropical PeatlandPYLMALILLLATPRRYLSWRYLGLITAFAFPVLAVVARRRILYM
Ga0187772_1090962523300018085Tropical PeatlandGRSLIEPYLMALILLLATPRQYLSWRYLGLITACILPALAVVARRRILYM
Ga0206353_1017017523300020082Corn, Switchgrass And Miscanthus RhizosphereMALVLMVSTPRSSVSWRYLGTIAACVLPALAVVARRRILYM
Ga0210395_1048953013300020582SoilEPFLMALVLLLATPRHYLSGRYLGLLMACTVPALLVIARLRILNM
Ga0210404_1056065113300021088SoilWTSTFGEGRSLIEPYLMALVLLVATPRHYLNWRYLGMIAACVLPALAVVARRRILYM
Ga0210388_1005814113300021181SoilLVLLLATPRRYLSGRYLGLLVACTVPALLVIARLRILNM
Ga0213875_1016565233300021388Plant RootsPYLLALVLLLATPRRYINWAYLGMITACVLPALAVVARRRTLYM
Ga0210385_1029847523300021402SoilRSLIEPYLMALVLLIATPRRYLDWRYLGLIAACAGPALLVVARRRALYM
Ga0210397_1101519413300021403SoilLMALVVLVSTPRRSLPWPYLAMIAACVLPALAVVARRRILYM
Ga0210387_1143607823300021405SoilGRSLIEPYLMALILLLATPRHYLSWRYLGLIMACAAPALAIVARRRILYM
Ga0210387_1152700513300021405SoilRSLIEPYLLALVLLVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM
Ga0210386_1135800913300021406SoilTSTFGDGRSLIEPYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM
Ga0210394_1017309913300021420SoilVLMVSTPRRSLSWAYLGTIAAFALPALAVVARRRTLYM
Ga0210390_1063769223300021474SoilMALILLLATPRRYLSGRYLSLIAAWAIPALVVVARRRILYM
Ga0210398_1065284723300021477SoilVLLLATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM
Ga0210402_1004354313300021478SoilLIEPYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM
Ga0210409_1021152713300021559SoilIWTSTFGDGRSLIEPYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM
Ga0210409_1133752813300021559SoilSLIEPYLMALVVLVSTPRRSLPWPYLAMIAACVLPALAVVARRRILYM
Ga0126371_1110546723300021560Tropical Forest SoilSLIEPYLMALVLLFATPRRYFSWLYLGPILACGVPALLVVARRRTLYM
Ga0126371_1252127123300021560Tropical Forest SoilGEGRSLIEPYLMALVLLVSTPKRLLSWPYLAMIAACVLPALAVVARRRILYM
Ga0247676_101831613300024249SoilMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
Ga0247670_104402323300024283SoilRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
Ga0207692_1054560323300025898Corn, Switchgrass And Miscanthus RhizosphereVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
Ga0207710_1036749413300025900Switchgrass RhizosphereMALVLMVSTPRSSLSWRYLGTFAACVLPALAVVARRRILYM
Ga0207699_1068356113300025906Corn, Switchgrass And Miscanthus RhizosphereYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
Ga0207707_1115600213300025912Corn RhizosphereTFGEGRSLIEPYLMALVLLVSTPRRLLSWPYLGMIAACVLPALAVVARRRILYM
Ga0207663_1062214723300025916Corn, Switchgrass And Miscanthus RhizosphereYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM
Ga0207662_1067160123300025918Switchgrass RhizosphereMVSTPRSSVSWRYLGTIAACVLPALAVVARRRILYM
Ga0207664_1084105913300025929Agricultural SoilMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVAR
Ga0207690_1114723523300025932Corn RhizosphereLVLMVSTPRSSLSWRYLGTFAACVLPALAVVARRRILYM
Ga0207677_1058533313300026023Miscanthus RhizosphereVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
Ga0207763_103041823300026879Tropical Forest SoilLLLATPKRYLSWPYLSLIAACALPALLVVARRRILHM
Ga0207949_100446223300026999Forest SoilLATPRHYLSWRYLGLIVACVAPALAVVARRRILYM
Ga0208237_104194013300027080Forest SoilLMALVLLVATPRHYLNWRYLGMIAVCVLPALAVVARRRILYM
Ga0209008_104440423300027545Forest SoilEPYLMALILLLATPRHYLSWRYLSLIVACVAPALAVVARRRILYM
Ga0208043_115364713300027570Peatlands SoilYLMALILLLATPRKYLSWRYLGPITACVIPALLVVARRRILYM
Ga0208043_117390123300027570Peatlands SoilMALILLLATPRRYLSSLNLTLILAWVLPALLVVARRRALYM
Ga0209527_106388823300027583Forest SoilSTFGEGRSLIEPYLLALILLLATPRHYLSWRYLGLIVACVAPALAIVARRRILYM
Ga0209446_108595513300027698Bog Forest SoilMALVLLLATPRRYLNWPYLGMIVACAMPALLVVARRRILYM
Ga0209040_1054069123300027824Bog Forest SoilTFGEGRSLIEPYLMALVLLVATPRRYLNWPYLGLIAACVLPALLVVARRRILYM
Ga0209274_1074620713300027853SoilIEPYLMALVLLLATPQRYLSRRNLGLVVACVVPALLVVARRRILYM
Ga0209167_1051565813300027867Surface SoilLLLATPRQYLSWRYLSLITACALPALLIVARRRILYM
Ga0209698_1060241013300027911WatershedsYLMAVVLLVATPRRYLNWPYLGMIAACVMPALLVVARRRALYM
Ga0209526_1024244823300028047Forest SoilYLLALVLLVATPRRYLSWPYLGMIAACVLPALLVVARRRALYM
Ga0302220_1018703823300028742PalsaFGDGRSLIEPYLMALILLFATPRRYLSWRYLSLIAACAVPALLVVTRRRTLYM
Ga0302224_1006406813300028759PalsaGRSLIEPYLMALVLLLATPRRYLCWRYLSLIAACAVPALLVVTRRRTLYM
Ga0307280_1001344913300028768SoilSTFGEGRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
Ga0302234_1015361123300028773PalsaPYLLALILLLATPRQYLSWRYLGLITACVAPALLVVARRRILYM
Ga0302231_1031121313300028775PalsaFATPRRYLSWRYLSLIAACAVPALLVVTRRRTLYM
Ga0302228_1000829663300028808PalsaLFATPRRYLSWRYLSLIAACAVPALLVVTRRRTLYM
Ga0311339_1063689013300029999PalsaLILLFATPRRYLSWRYLSLIAACAAPALLVVARRRILYM
Ga0311353_1010899433300030399PalsaLVLLLATPRRYLCWRYLSLIAACAVPALLVVARRRTLYM
Ga0311353_1098875823300030399PalsaMALILLFATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM
Ga0302183_1030779913300030509PalsaEPYLMALVLLLATPRRYLSWRYLSLIAACAVPALLVVARRRTLYM
Ga0265459_1136344823300030741SoilEPYLMALVLLFATPRRYLSWHYLSLIAACAAPALLVVARRRTLYM
Ga0302308_1009863633300031027PalsaFATPRRYLSWRYLSLIAACAAPALLVVARRRILYM
Ga0302180_1014023313300031028PalsaPYLMALILLFATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM
Ga0302326_1084552123300031525PalsaALILLLATPKRYLNTYRLAAITAVALPALAVVVRRRILYM
Ga0302326_1335226723300031525PalsaTFGDGRSLIEPFLMALILLFATPRRYLSWPYLGMIVACAVPALLVVARRRSLYM
Ga0318516_1037305423300031543SoilLIEPYLMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM
Ga0318534_1014362623300031544SoilRSLIEPYLMALVLLVSTPRRSLPWAYLGMIAACVLPALAVVARRRILYM
Ga0318534_1016164713300031544SoilPYLMALVLLVATPRRYLSGPYLGMIAAYVLPALLVVARRRALYM
Ga0318572_1083516423300031681SoilIWTSTFGEGRSLIEPYLMALVLLVSTPKRYLSWPYLGVIAACVLPALAVVARRRILYM
Ga0310686_10049169623300031708SoilGDGRSLIEVYLMALILLLATPRRYLSSRNLTVIAACVLPALLVVARRRALYM
Ga0310686_10624552813300031708SoilFLMALVLLLATPRQYLSGRYLGLLVACTVPALLVIARLRILNM
Ga0310686_11245090323300031708SoilDGRSLIEPYLMALVLLFATPRRYLSWRYLSLIAACAVPALLVVARRRTLYM
Ga0318496_1023857013300031713SoilAGRSLIEPYLMALILLLATPRQYLSWRYLGPIAACVLPALAVVARRRILYM
Ga0318496_1041036723300031713SoilLIEPYLMALIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM
Ga0318500_1020375423300031724SoilFGDGRSLIEPYLMALILLLATPRLYLSWRYLGLITACVLPALVVVARRRIMYM
Ga0318502_1005220813300031747SoilASTFGDGRSLIEPYMLALILLLATPRRYLSWPYLGLIAACAVPALLVVARRRILYM
Ga0318521_1006847023300031770SoilLVLLVSTPRRYLSWPYLGMIAACVLPALAVVARRRILYM
Ga0318521_1022395923300031770SoilMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM
Ga0318498_1015400313300031778SoilLVSTPKRYLSWPYLGVIAACVLPALAVVARRRILYM
Ga0318547_1059899323300031781SoilLILLLATPRRYLSSRYLGLIAACVVPALLVVARRRILYM
Ga0318568_1004556513300031819SoilPYLMALIMLLATPRQYLSWRYLGLITACALPVLAVVARRRILYM
Ga0310917_1061159713300031833SoilVSTPKRYLSWPYLGMIVACVLPALAVVARRRILYM
Ga0310892_1122117113300031858SoilLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
Ga0318527_1037428713300031859SoilLVATPRRYLNWPYLAMIVACVLPALAVVARRRILYM
Ga0306919_1012328013300031879SoilYLMALIMLLATPRQFLSWRYLGLITACVLPALAVVARRRILYM
Ga0318551_1023229613300031896SoilRSLIEPYLMALVLLVSTPRRYLSWPYLGMIVACVMPALLVVARRRALYM
Ga0318520_1094127223300031897SoilIWTSTFGEGRSLIEPYLMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM
Ga0306921_1186793513300031912SoilIWTSTFGEGRSLIEPYLMALVLLVSTPRRSLPWAYLGMIAACVLPALAVVARRRILYM
Ga0318530_1017616313300031959SoilSLIEPYLMALILLLATPRLYLSWRYLGLITACVLPALVVVARRRIMYM
Ga0318530_1026245023300031959SoilLLVSTPRRYLSWPYLGMIAACVLPALAVVARRRILYM
Ga0307479_1003960153300031962Hardwood Forest SoilVFGDGRSMIEVYLLALILLIATPKRYLNVYWLGAITACCGPALYVVARRRILYM
Ga0318562_1081316823300032008SoilYLMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM
Ga0318563_1026775813300032009SoilALILLLATPRQYLSWRYLGLITACVLPVLAVVARRRILYM
Ga0318563_1065198413300032009SoilGRSLIEPYLMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM
Ga0318504_1043238823300032063SoilSTFGDGRSLIEPYLMALVLLVATPRRYLSWPYLGMIVACVLPALLVVARRRALYM
Ga0318504_1059854113300032063SoilVLLVSTPKRYLSWPYLGVIAACVLPALAVVARRRILYM
Ga0318514_1020119213300032066SoilPYVMALVLLVSTPRRYLSWPYLGMIAACVLPALAVVARRRILYM
Ga0318553_1035570813300032068SoilRSLIEPYLMALVLLVATPRRYLSGPYLGMIAACVLPALLVVARRRALYM
Ga0306924_1046350833300032076SoilLIEPYLMALIMLLATPRQFLSWRYLGLITACVLPALAVVARRRILYM
Ga0306924_1103200923300032076SoilLLATPRQYLSWRYLGLIMACVLPALAVVARRRILYM
Ga0318525_1061879513300032089SoilSLIEPYLMALILLLATPRQYLSWRYLGLIMACVLPALAVVARRRILYM
Ga0318577_1006436413300032091SoilLLATPKRYLSWPYLSLMAACALPALLVVARRRILHM
Ga0307471_10048019623300032180Hardwood Forest SoilEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM
Ga0306920_10030060613300032261SoilGDARSLIEPYLLALILLLATPKRYLSWPYLSLMAACALPALLVVARRRILHM
Ga0306920_10078561533300032261SoilRSLIEPYLMALIMLLATPRQFLSWRYLGLITACVLPALAVVARRRILYM
Ga0306920_10185169223300032261SoilLLLATPRQYLSWRYLGLITACVLPVLAVVARRRILYM
Ga0335082_1105029623300032782SoilLIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM
Ga0335079_1041494413300032783SoilIEPYLMALVLLVATPRRYLSGPYLGMIAAWVLPALLVVARRRALYM
Ga0335078_1136783923300032805SoilGEGRSLIEPYLMALVLLVSTPKRLLSWPYLVMIAACVLPALAVVARRRILYM
Ga0335081_1048194713300032892SoilALVLLVATPRRYLSWPYLGMIAACVLPALAVVARRRTLYM
Ga0335074_1020598313300032895SoilLMALILLLATPRQYLNWRYLGLIVACAAPVLAVVARRRILYM
Ga0335074_1093490923300032895SoilLLLATPQRYLSRRYLGLVVACVVPALLVVARRRILYM
Ga0335084_1165994113300033004SoilEGRSLIEPYLMSLVLLVSTPKRYLSWPYLGMIAAWVLPALAVVARRRILYM
Ga0335077_1160325413300033158SoilLLVATPRRYLSGPYLGMIAACVLPALLVVARRRALYM
Ga0370514_040964_1038_11573300034199Untreated Peat SoilLVLLCATPRRYLSWRYLSLIAACAVPALLVVARRRTLYM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.