Basic Information | |
---|---|
Family ID | F028953 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 190 |
Average Sequence Length | 39 residues |
Representative Sequence | MSVILTFASKWVRWYRVLRYAKAFSFFASVRYGLWLARS |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 190 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.60 % |
% of genes near scaffold ends (potentially truncated) | 24.21 % |
% of genes from short scaffolds (< 2000 bps) | 59.47 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.263 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.526 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.263 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.053 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 190 Family Scaffolds |
---|---|---|
PF02954 | HTH_8 | 28.95 |
PF08281 | Sigma70_r4_2 | 9.47 |
PF13581 | HATPase_c_2 | 8.42 |
PF04542 | Sigma70_r2 | 6.32 |
PF00158 | Sigma54_activat | 3.16 |
PF13590 | DUF4136 | 3.16 |
PF13185 | GAF_2 | 2.63 |
PF13620 | CarboxypepD_reg | 1.58 |
PF13419 | HAD_2 | 1.58 |
PF00589 | Phage_integrase | 1.05 |
PF02321 | OEP | 1.05 |
PF10431 | ClpB_D2-small | 1.05 |
PF00072 | Response_reg | 0.53 |
PF00582 | Usp | 0.53 |
PF00196 | GerE | 0.53 |
PF01564 | Spermine_synth | 0.53 |
PF03551 | PadR | 0.53 |
PF05598 | DUF772 | 0.53 |
PF00440 | TetR_N | 0.53 |
PF10677 | DUF2490 | 0.53 |
PF07944 | Glyco_hydro_127 | 0.53 |
PF13701 | DDE_Tnp_1_4 | 0.53 |
PF00378 | ECH_1 | 0.53 |
PF01850 | PIN | 0.53 |
PF01381 | HTH_3 | 0.53 |
PF12645 | HTH_16 | 0.53 |
PF09424 | YqeY | 0.53 |
PF11026 | DUF2721 | 0.53 |
PF07730 | HisKA_3 | 0.53 |
PF04366 | Ysc84 | 0.53 |
PF00884 | Sulfatase | 0.53 |
PF08530 | PepX_C | 0.53 |
PF01047 | MarR | 0.53 |
PF13492 | GAF_3 | 0.53 |
COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 6.32 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 6.32 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 6.32 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 6.32 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.11 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.53 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.53 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.53 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.53 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.53 |
COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.53 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.53 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.53 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.53 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.26 % |
Unclassified | root | N/A | 14.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2040502001|FACENC_GAMC6GA01AYWKI | Not Available | 504 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105429585 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300000789|JGI1027J11758_11762659 | Not Available | 519 | Open in IMG/M |
3300001471|JGI12712J15308_10218257 | Not Available | 504 | Open in IMG/M |
3300001593|JGI12635J15846_10068960 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100082762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2982 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100152435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2184 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100515221 | Not Available | 1073 | Open in IMG/M |
3300003218|JGI26339J46600_10009845 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
3300003351|JGI26346J50198_1000143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3729 | Open in IMG/M |
3300004080|Ga0062385_10174946 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300004152|Ga0062386_100614059 | Not Available | 889 | Open in IMG/M |
3300004152|Ga0062386_100986092 | Not Available | 698 | Open in IMG/M |
3300004633|Ga0066395_10388281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300004635|Ga0062388_100485987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
3300005332|Ga0066388_100576212 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
3300005332|Ga0066388_101449920 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300005332|Ga0066388_101789870 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300005332|Ga0066388_102142604 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300005332|Ga0066388_102325165 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300005343|Ga0070687_100156110 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300005437|Ga0070710_10118854 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300005437|Ga0070710_11398706 | Not Available | 523 | Open in IMG/M |
3300005467|Ga0070706_101038284 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300005537|Ga0070730_10003248 | All Organisms → cellular organisms → Bacteria | 14643 | Open in IMG/M |
3300005602|Ga0070762_10014238 | All Organisms → cellular organisms → Bacteria | 4050 | Open in IMG/M |
3300005764|Ga0066903_100991752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1534 | Open in IMG/M |
3300006041|Ga0075023_100196879 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300006047|Ga0075024_100847205 | Not Available | 515 | Open in IMG/M |
3300006059|Ga0075017_100991858 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300006059|Ga0075017_101060805 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300006059|Ga0075017_101437693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300006163|Ga0070715_10411226 | Not Available | 754 | Open in IMG/M |
3300006172|Ga0075018_10065830 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
3300006173|Ga0070716_100190528 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
3300006174|Ga0075014_100842932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300006175|Ga0070712_100154716 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
3300006176|Ga0070765_100482742 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300006852|Ga0075433_10423666 | Not Available | 1174 | Open in IMG/M |
3300009698|Ga0116216_10987513 | Not Available | 503 | Open in IMG/M |
3300009792|Ga0126374_10664562 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300010048|Ga0126373_10005034 | All Organisms → cellular organisms → Bacteria | 10200 | Open in IMG/M |
3300010048|Ga0126373_10110875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2552 | Open in IMG/M |
3300010048|Ga0126373_12309802 | Not Available | 598 | Open in IMG/M |
3300010339|Ga0074046_10000375 | All Organisms → cellular organisms → Bacteria | 40506 | Open in IMG/M |
3300010339|Ga0074046_10031249 | All Organisms → cellular organisms → Bacteria | 3632 | Open in IMG/M |
3300010339|Ga0074046_10052953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2690 | Open in IMG/M |
3300010339|Ga0074046_10102541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1846 | Open in IMG/M |
3300010341|Ga0074045_10006316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 10198 | Open in IMG/M |
3300010341|Ga0074045_10009783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8010 | Open in IMG/M |
3300010341|Ga0074045_10010551 | All Organisms → cellular organisms → Bacteria | 7655 | Open in IMG/M |
3300010341|Ga0074045_10056608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2816 | Open in IMG/M |
3300010343|Ga0074044_10004804 | All Organisms → cellular organisms → Bacteria | 11120 | Open in IMG/M |
3300010343|Ga0074044_10112733 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
3300010361|Ga0126378_11786228 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300010376|Ga0126381_100075009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4234 | Open in IMG/M |
3300010376|Ga0126381_100081727 | All Organisms → cellular organisms → Bacteria | 4067 | Open in IMG/M |
3300010376|Ga0126381_100278352 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
3300010376|Ga0126381_100355341 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
3300010376|Ga0126381_101680967 | Not Available | 917 | Open in IMG/M |
3300010379|Ga0136449_100024459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15072 | Open in IMG/M |
3300010398|Ga0126383_10483065 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300010880|Ga0126350_11103920 | Not Available | 1161 | Open in IMG/M |
3300012971|Ga0126369_11428379 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300014164|Ga0181532_10114081 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300016294|Ga0182041_10631698 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300017822|Ga0187802_10010740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2952 | Open in IMG/M |
3300017822|Ga0187802_10023102 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
3300017926|Ga0187807_1131629 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300017933|Ga0187801_10021466 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
3300017933|Ga0187801_10371418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300017942|Ga0187808_10408402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300017955|Ga0187817_10145053 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300017955|Ga0187817_10260273 | Not Available | 1105 | Open in IMG/M |
3300017959|Ga0187779_10044590 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
3300017972|Ga0187781_10029134 | All Organisms → cellular organisms → Bacteria | 3815 | Open in IMG/M |
3300017975|Ga0187782_11521214 | Not Available | 527 | Open in IMG/M |
3300018006|Ga0187804_10425736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300018088|Ga0187771_10146080 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
3300019887|Ga0193729_1035598 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
3300020580|Ga0210403_10141262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-13 | 1966 | Open in IMG/M |
3300020580|Ga0210403_10313319 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300020580|Ga0210403_10594923 | Not Available | 894 | Open in IMG/M |
3300020581|Ga0210399_10046577 | All Organisms → cellular organisms → Bacteria | 3479 | Open in IMG/M |
3300020581|Ga0210399_10059308 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
3300020583|Ga0210401_10138248 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
3300020583|Ga0210401_11531871 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300021168|Ga0210406_10001149 | All Organisms → cellular organisms → Bacteria | 33515 | Open in IMG/M |
3300021168|Ga0210406_10064386 | All Organisms → cellular organisms → Bacteria | 3169 | Open in IMG/M |
3300021170|Ga0210400_10000207 | All Organisms → cellular organisms → Bacteria | 74783 | Open in IMG/M |
3300021171|Ga0210405_10004786 | All Organisms → cellular organisms → Bacteria | 12581 | Open in IMG/M |
3300021181|Ga0210388_10251045 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
3300021401|Ga0210393_10071940 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
3300021407|Ga0210383_10437904 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300021407|Ga0210383_11623356 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300021432|Ga0210384_10011133 | All Organisms → cellular organisms → Bacteria | 9121 | Open in IMG/M |
3300021433|Ga0210391_10237411 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300021444|Ga0213878_10329284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300021474|Ga0210390_10325083 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300021478|Ga0210402_10011326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7700 | Open in IMG/M |
3300021478|Ga0210402_10213794 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
3300021478|Ga0210402_10463822 | Not Available | 1176 | Open in IMG/M |
3300021479|Ga0210410_10058012 | All Organisms → cellular organisms → Bacteria | 3378 | Open in IMG/M |
3300021559|Ga0210409_10033230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4944 | Open in IMG/M |
3300021560|Ga0126371_10058475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3710 | Open in IMG/M |
3300021560|Ga0126371_10163846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2295 | Open in IMG/M |
3300021560|Ga0126371_10515168 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300021560|Ga0126371_10550162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1303 | Open in IMG/M |
3300021560|Ga0126371_11669599 | Not Available | 762 | Open in IMG/M |
3300021560|Ga0126371_11989844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300021560|Ga0126371_12771219 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300025910|Ga0207684_11283029 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300025939|Ga0207665_11143672 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300025941|Ga0207711_10078742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2876 | Open in IMG/M |
3300026088|Ga0207641_10023889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5040 | Open in IMG/M |
3300026845|Ga0207760_100807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2978 | Open in IMG/M |
3300026845|Ga0207760_103200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
3300026872|Ga0207785_1008199 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300026876|Ga0207837_1015061 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300026959|Ga0207852_1006280 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300026959|Ga0207852_1010670 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300027502|Ga0209622_1007372 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
3300027583|Ga0209527_1000049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22537 | Open in IMG/M |
3300027635|Ga0209625_1001635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 5203 | Open in IMG/M |
3300027698|Ga0209446_1000200 | All Organisms → cellular organisms → Bacteria | 14400 | Open in IMG/M |
3300027698|Ga0209446_1022119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1581 | Open in IMG/M |
3300027727|Ga0209328_10036750 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300027812|Ga0209656_10024895 | All Organisms → cellular organisms → Bacteria | 3616 | Open in IMG/M |
3300027812|Ga0209656_10117850 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300027824|Ga0209040_10008181 | All Organisms → cellular organisms → Bacteria | 7471 | Open in IMG/M |
3300027824|Ga0209040_10075210 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
3300027824|Ga0209040_10394448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300027825|Ga0209039_10001053 | All Organisms → cellular organisms → Bacteria | 26797 | Open in IMG/M |
3300027857|Ga0209166_10004289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10023 | Open in IMG/M |
3300027884|Ga0209275_10009787 | All Organisms → cellular organisms → Bacteria | 4075 | Open in IMG/M |
3300028047|Ga0209526_10336673 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300030847|Ga0075405_11083403 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300030991|Ga0073994_12416671 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300031057|Ga0170834_100448602 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
3300031057|Ga0170834_103147521 | All Organisms → cellular organisms → Bacteria | 11547 | Open in IMG/M |
3300031057|Ga0170834_110357933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300031231|Ga0170824_101293039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6821 | Open in IMG/M |
3300031231|Ga0170824_114429517 | Not Available | 1344 | Open in IMG/M |
3300031474|Ga0170818_101536294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8435 | Open in IMG/M |
3300031543|Ga0318516_10596649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300031545|Ga0318541_10193063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1126 | Open in IMG/M |
3300031573|Ga0310915_10316241 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300031573|Ga0310915_10476186 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300031680|Ga0318574_10423615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 778 | Open in IMG/M |
3300031708|Ga0310686_101572528 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300031719|Ga0306917_10504383 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300031744|Ga0306918_11566615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300031753|Ga0307477_10041832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3147 | Open in IMG/M |
3300031753|Ga0307477_10061149 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
3300031754|Ga0307475_10044719 | All Organisms → cellular organisms → Bacteria | 3297 | Open in IMG/M |
3300031754|Ga0307475_10746881 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300031777|Ga0318543_10020824 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
3300031796|Ga0318576_10263618 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300031797|Ga0318550_10512049 | Not Available | 579 | Open in IMG/M |
3300031845|Ga0318511_10232993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 824 | Open in IMG/M |
3300031879|Ga0306919_10496437 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300031890|Ga0306925_10086104 | All Organisms → cellular organisms → Bacteria | 3331 | Open in IMG/M |
3300031894|Ga0318522_10107640 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300031912|Ga0306921_12718789 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300032055|Ga0318575_10396237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 701 | Open in IMG/M |
3300032063|Ga0318504_10435693 | Not Available | 626 | Open in IMG/M |
3300032076|Ga0306924_12078744 | Not Available | 583 | Open in IMG/M |
3300032094|Ga0318540_10016342 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
3300032160|Ga0311301_10018401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 20158 | Open in IMG/M |
3300032160|Ga0311301_10118508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5010 | Open in IMG/M |
3300032205|Ga0307472_100169122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1622 | Open in IMG/M |
3300032261|Ga0306920_100329880 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
3300032770|Ga0335085_10000186 | All Organisms → cellular organisms → Bacteria | 194184 | Open in IMG/M |
3300032782|Ga0335082_10004278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15556 | Open in IMG/M |
3300032783|Ga0335079_10061523 | All Organisms → cellular organisms → Bacteria | 4280 | Open in IMG/M |
3300032783|Ga0335079_10149398 | Not Available | 2622 | Open in IMG/M |
3300032828|Ga0335080_11599086 | Not Available | 642 | Open in IMG/M |
3300032829|Ga0335070_12076155 | Not Available | 510 | Open in IMG/M |
3300032892|Ga0335081_10006384 | All Organisms → cellular organisms → Bacteria | 18764 | Open in IMG/M |
3300032898|Ga0335072_10129824 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
3300032954|Ga0335083_10000402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 67348 | Open in IMG/M |
3300032955|Ga0335076_11062817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300032955|Ga0335076_11099629 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300033158|Ga0335077_11354736 | Not Available | 688 | Open in IMG/M |
3300033289|Ga0310914_10223414 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
3300033402|Ga0326728_10000241 | All Organisms → cellular organisms → Bacteria | 219568 | Open in IMG/M |
3300033405|Ga0326727_10194492 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
3300033405|Ga0326727_10854736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300033805|Ga0314864_0001081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5331 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.53% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.37% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.37% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.32% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 5.26% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.26% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.21% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.68% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.16% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.63% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.11% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.11% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.58% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.05% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.05% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.53% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.53% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.53% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
3300026876 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 58 (SPAdes) | Environmental | Open in IMG/M |
3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCE_1099220 | 2040502001 | Soil | DFAFASKWVRWYRVLRYGKGFSFTDSVRQGIWLARS |
INPhiseqgaiiFebDRAFT_1054295854 | 3300000364 | Soil | MSMTLMFVRKWVRWSRVLRYGKAFSFVDSMRYGLWLARS* |
JGI1027J11758_117626592 | 3300000789 | Soil | MFVILMFARKWVGWYRLLRYRKAFSLASSIRYGLWLA |
JGI12712J15308_102182571 | 3300001471 | Forest Soil | MPECAMSQILLFGRKWVEWYRVLRYGKAFIFADSIRYGLWLARG* |
JGI12635J15846_100689602 | 3300001593 | Forest Soil | MSVILKFARKWVRWYRVLRYHKAFSFADSVRFGLWLAPG* |
JGIcombinedJ26739_1000827622 | 3300002245 | Forest Soil | MSLILRFARTWVRWYRVLRYHKAFSFADSVRYGLWLSLS* |
JGIcombinedJ26739_1001524353 | 3300002245 | Forest Soil | VFARKWVRWYRVLRYGKAFSFADSIRHGLWLARG* |
JGIcombinedJ26739_1005152211 | 3300002245 | Forest Soil | GGFMSLILVFARKWVGWYRLLRYRKVFSFAASIRYGLWLARG* |
JGI26339J46600_100098452 | 3300003218 | Bog Forest Soil | MSMILTFARTWGQWYRVLRCGKGFSFADSVRYGLWLARS* |
JGI26346J50198_10001434 | 3300003351 | Bog Forest Soil | MSLILVFARMWVRWYRVLRYDKAFTFVASVRYGLWLARS* |
Ga0062385_101749462 | 3300004080 | Bog Forest Soil | MSMILTFAGTWGRWYRVLRYAKAFSFVASVRYGLWLARS* |
Ga0062386_1006140592 | 3300004152 | Bog Forest Soil | MSVILMFARKWIRWYRVLRYGKEFSFAASVRYGLWLARG* |
Ga0062386_1009860922 | 3300004152 | Bog Forest Soil | MSLILVFARKGVGWYRVPRYSKAFSFTGSIRYGLWLARG* |
Ga0066395_103882811 | 3300004633 | Tropical Forest Soil | MSVILTVASKWVRWYRVLRYAKAFSFFASVRYGLWLARS* |
Ga0062388_1004859872 | 3300004635 | Bog Forest Soil | MSVIFTFASKWVRWYRVLRYGKGFSLTDSVRHGIWLARS* |
Ga0066388_1005762122 | 3300005332 | Tropical Forest Soil | MSVILRFASKWVQWYCVLRYAKAFSFFASVRYGLWLARS* |
Ga0066388_1014499202 | 3300005332 | Tropical Forest Soil | MSVILTVASRWVRWYRVLRYAKAFSFFASVRYGLWLARS* |
Ga0066388_1017898702 | 3300005332 | Tropical Forest Soil | MSVILTFASKWVRWYGVLRYAKALSFFASVRYGLWLARS* |
Ga0066388_1021426042 | 3300005332 | Tropical Forest Soil | MSLILTFPRKWVRGYRVLRRGYGFSFFDSVRHGLWLARG* |
Ga0066388_1023251652 | 3300005332 | Tropical Forest Soil | MSRILVLVRKWNTYYRVLRHGKGFSFVDSLRHGLWLARG* |
Ga0070687_1001561102 | 3300005343 | Switchgrass Rhizosphere | MSLILTFARKWVRWYRLLRCHKAFSFADSVRYGLWLSLS* |
Ga0070710_101188541 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVILMFVRKWVGWYRVLRYRKAFSLADSIRCGLCLARG* |
Ga0070710_113987062 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVILTFARKWVRWHRVLRYHKAFSFADSVRYGVWLSLS* |
Ga0070706_1010382841 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVTFMFVRKWVRWYRVLRYGKAFSFVDSMDCGLWLARG* |
Ga0070730_1000324811 | 3300005537 | Surface Soil | MSLIFTFASKWVRWYRVLRYGKGFSFTDAVRHGIWLARS* |
Ga0070762_100142383 | 3300005602 | Soil | LGDVMSVILKFAKWVRWYRVLRYRKAFSFADSVRFGLWLSLS* |
Ga0066903_1009917521 | 3300005764 | Tropical Forest Soil | MSVILTFASKWVRWYRVLRYAKAFSFFASVRYGLWLARS* |
Ga0075023_1001968792 | 3300006041 | Watersheds | MSLILIFARTWVRWYRVLRYHKAFSFADSVRFGLWLSLS* |
Ga0075024_1008472052 | 3300006047 | Watersheds | MFVILMFVRKWVGWYRLLRYRKAFSLANSIRYGLWLARG* |
Ga0075017_1009918581 | 3300006059 | Watersheds | MFVILMFAHKWVGWYRVLRYRKAFSLANSIRYGLWLARG* |
Ga0075017_1010608052 | 3300006059 | Watersheds | MSLTFMFVRKWVRWYRVLRYAKAFRFVDSMRYGLWLARS* |
Ga0075017_1014376931 | 3300006059 | Watersheds | MSMILTFARTWGRWYRVLRYGKGFGFADSVRYGLWLARS* |
Ga0070715_104112261 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMTLMFVRKWVRWSRVLRYGKAFGFVDSMRYGLWLARS* |
Ga0075018_100658304 | 3300006172 | Watersheds | MSFILMFARKWVQWHRVLRYGKEFSFAHSIQYGLWLTRG* |
Ga0070716_1001905283 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLILIFARTWVRWYRVLRYHKAFSFADSVRYGLWLSLS* |
Ga0075014_1008429322 | 3300006174 | Watersheds | MSVTFMFVRKWVRWYRVLRYGKAFSFVDSMRCGLWLARG* |
Ga0070712_1001547165 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLILALVRKWAGWYRVLRYGKAFSFVDSIRYDLWLARG* |
Ga0070765_1004827422 | 3300006176 | Soil | MTLILIFARTWVRWYRVLRYHKAFSFADSVRYGLWLSLS* |
Ga0075433_104236661 | 3300006852 | Populus Rhizosphere | MSRILSFVRMWGRWYGVLRHGKDFSIADSVRYSLWLARS* |
Ga0116216_109875131 | 3300009698 | Peatlands Soil | MSVTLTFVHKWVRWYRVLRYGKAFSFVDSMRYGLW |
Ga0126374_106645622 | 3300009792 | Tropical Forest Soil | MSNILSFARTWARWYGVLRYAKEFSFADSVRYGLWLARS* |
Ga0126373_100050347 | 3300010048 | Tropical Forest Soil | MSVILTFTSKWVRWYYVLRYAKALSFFASVRYGLWLARS* |
Ga0126373_101108753 | 3300010048 | Tropical Forest Soil | MSLILTFARKWVRGYRVLRRGNGFSFFDSVRHGLWLARG* |
Ga0126373_123098022 | 3300010048 | Tropical Forest Soil | MSVSLTFASKWVRWYGVLRYAKAFSFVDSVRYGLWLARG* |
Ga0074046_100003759 | 3300010339 | Bog Forest Soil | MSLILAFARKWVGWYRVLRYRKAFSFADSIRYGLWLARG* |
Ga0074046_100312493 | 3300010339 | Bog Forest Soil | MSMIFTFASKWVRWYRVLRYGKGFSFTDSVRHGIWLACS* |
Ga0074046_100529532 | 3300010339 | Bog Forest Soil | MSMILTFARTWGRWYRVLRYGKGFSFADSVRYGLWLARS* |
Ga0074046_101025411 | 3300010339 | Bog Forest Soil | MILTFAHTWGRWYRVLRYGKGFSFGDSVRYGLWLARS* |
Ga0074045_1000631611 | 3300010341 | Bog Forest Soil | MSVTFMFVRKWVRVLRYGKAFSFVDSMRCGLWLARG* |
Ga0074045_100097832 | 3300010341 | Bog Forest Soil | MSMILTFAHTWGRWYRVLRYGKGFSFGDSVRYGLWLARS* |
Ga0074045_100105513 | 3300010341 | Bog Forest Soil | MSVILTFASKWVRWYGVLRYAKAFSLVDSVRYGLWLARS* |
Ga0074045_100566083 | 3300010341 | Bog Forest Soil | MSIILRFARTWARWYGVLRYSKAFSFADSVRFGLWLARG* |
Ga0074044_100048049 | 3300010343 | Bog Forest Soil | MSMILTLARTWGQWYRVLRYGKGFSFPDSVRYGLWLARS* |
Ga0074044_101127333 | 3300010343 | Bog Forest Soil | MSLILVFARKWVRCYRVLRYDKAFTFVASVRYGLWLARS* |
Ga0126378_117862282 | 3300010361 | Tropical Forest Soil | MSLILTFTTKWLRWYRVLRYAKAFSFFASVRYGLWLARS |
Ga0126381_1000750094 | 3300010376 | Tropical Forest Soil | MSLIFTLARKWVRGYRVLRRGNGFSFFDSVRHGLWLARG* |
Ga0126381_1000817274 | 3300010376 | Tropical Forest Soil | MAMILTFARTWGRWYRVLRYGKGFSFADSVRYGLWLAQS* |
Ga0126381_1002783523 | 3300010376 | Tropical Forest Soil | MSKILSFARTWARWYAVLRNAKAFSFADSVRYGLWLALS* |
Ga0126381_1003553412 | 3300010376 | Tropical Forest Soil | MSVILTFASKWVRWYRVLRYAKAFSFFASLRYGLWLARS* |
Ga0126381_1016809671 | 3300010376 | Tropical Forest Soil | ILRFASKWVQWYCVLRYAKAFSFFASVRYGLWLARS* |
Ga0136449_10002445913 | 3300010379 | Peatlands Soil | MSVTLTFVHKWVRWYRVLRYGKAFSFVDSMRYGLWLARS* |
Ga0126383_104830653 | 3300010398 | Tropical Forest Soil | NILSFARTWARWYGVLRYAKAFSFADSVRYGLWLARS* |
Ga0126350_111039202 | 3300010880 | Boreal Forest Soil | MSVILKFARKWVRWYCVLRYHKAFSFADSVRFGLWLSLS* |
Ga0126369_114283791 | 3300012971 | Tropical Forest Soil | MSLILTFTTKWVRWYRVLRYAKAFSFFASVRYGLWLARS* |
Ga0181532_101140813 | 3300014164 | Bog | MSVTLMFVRKWVRWYRVLRYGKAFSFVDSMRYGLWLARG* |
Ga0182041_106316982 | 3300016294 | Soil | LTFARTWGRWYRVLRYGKGFSFADSVRYGLWLAQR |
Ga0187802_100107405 | 3300017822 | Freshwater Sediment | MSLTLMFVRKWVRWYRVLRYGKAFSFVDSMRYGLWLARG |
Ga0187802_100231021 | 3300017822 | Freshwater Sediment | MSVILMFARKWVRWYRVLRYGKAFSFVDSMRYGLWLARG |
Ga0187807_11316292 | 3300017926 | Freshwater Sediment | MSVILMFTRKWARWYRVLRYGKAFSFVDSMRYGLWLARG |
Ga0187801_100214664 | 3300017933 | Freshwater Sediment | SVILMFARKWVGWYRVLRYGKAFSFADSVRYGLWLARS |
Ga0187801_103714182 | 3300017933 | Freshwater Sediment | MILTFTRTWGRWYRVLRCEKGFSFADSVRYGLWLARS |
Ga0187808_104084021 | 3300017942 | Freshwater Sediment | MSLTLMFVRKWVRWYRVLRYGKAFSFVDSMRYGLW |
Ga0187817_101450532 | 3300017955 | Freshwater Sediment | MSLILRFARTWAGWYGVLRYSKAFSFADSVRYGLWLARS |
Ga0187817_102602731 | 3300017955 | Freshwater Sediment | MSIILRFARTWARWYGVLRYSKAFSFADSVRYGLWLAR |
Ga0187779_100445904 | 3300017959 | Tropical Peatland | MSGILTFVRKWVQWYRVLRYAKAFHFVASVRCGLWLARS |
Ga0187781_100291342 | 3300017972 | Tropical Peatland | MPVILTFASKWVRWYGVLRYAKEFSFADSVRYGLWLARS |
Ga0187782_115212141 | 3300017975 | Tropical Peatland | MSGILTFVRKWVQWYRVLRYAKAFHFVASVRCGLWLA |
Ga0187804_104257362 | 3300018006 | Freshwater Sediment | SGVWEISVLGTFASKWARWYRVLRYAKAFSCGAFVRYGLWLARS |
Ga0187771_101460802 | 3300018088 | Tropical Peatland | MSVILTLAGKWVRWHQVLRYDKAFGFVDSVRHGLWLARSL |
Ga0193729_10355982 | 3300019887 | Soil | MSLILVFACKWVGWYRLLRYRKAFSFADSIRFGLWLARG |
Ga0210403_101412623 | 3300020580 | Soil | MSLIFTFASKWVRWYRVLRYGKGFSFTDSMRHGIWLARS |
Ga0210403_103133192 | 3300020580 | Soil | DAMSLILIFARTWVRWYLVLRYHKAFSFADSVRYGLWLSLSYFPSQI |
Ga0210403_105949232 | 3300020580 | Soil | MSLILALVRKWVGWYRVLRYDKAFSFVDSIRYGLWLARG |
Ga0210399_100465771 | 3300020581 | Soil | MSVIFTFASKWVRWYRVLRYGKGFSFTDSVRHGIWLARS |
Ga0210399_100593084 | 3300020581 | Soil | MSLILALVRKWVGWYRVLRYGKAFSFVDSIRYGLWLARG |
Ga0210401_101382483 | 3300020583 | Soil | MTLILTFARKWVRWYSVLRYHNAFSFADSVRYGLWLSLS |
Ga0210401_115318711 | 3300020583 | Soil | LGRVMSLILLFGRKWVDWYRVLRYGRAFRFPDSIRYGLWLARE |
Ga0210406_1000114922 | 3300021168 | Soil | MSLIFTFASKSVRWYRVLRYGKGFSFTDSVRHGIWLARS |
Ga0210406_100643862 | 3300021168 | Soil | MLLILTFARKWVRWYRVLRYHKAFSFADSVRYGLWLARG |
Ga0210400_1000020712 | 3300021170 | Soil | MSLVFTFAGKWARWYRVLRYGKGFSFTDSVRHGIWLARS |
Ga0210405_100047869 | 3300021171 | Soil | MSLILVFVRKWVGWYRLLRYRKAFSFADSIRFGLWLARG |
Ga0210388_102510453 | 3300021181 | Soil | MSVIFRFAPKWVRWYGVLRYHKAFSFADSVRFGLWLSLS |
Ga0210393_100719403 | 3300021401 | Soil | MSVILKFARKWVRWYRVLRYHKAFSFADSVRFGLWLSLS |
Ga0210383_104379043 | 3300021407 | Soil | MSVILKFARKWVRWYRVLRYHKAFSFADSVRFGLW |
Ga0210383_116233562 | 3300021407 | Soil | GDVMSVILKFARKWVRWYRVLRYRKAFSFADSVRFGLWLSLS |
Ga0210384_1001113315 | 3300021432 | Soil | MSVIVTVARKWVRWYRVLRYHKAFSFGDSVRYGLWLSLS |
Ga0210391_102374111 | 3300021433 | Soil | GRVMSLILLLGRKWVDWYRVLRYGKAFSFADSSRYGLWRARG |
Ga0213878_103292842 | 3300021444 | Bulk Soil | MSVILTLASKWVRWYGVLRHAKEFSFVDSVRYGLWLARG |
Ga0210390_103250831 | 3300021474 | Soil | RFLGDVMSLILTFARKWVRWYRVLRYHKAFSFADSVRFGLWLSLS |
Ga0210402_100113267 | 3300021478 | Soil | MSLILALVRKWVGWYCVLRYGKAFSFVDSIWYGMWLARG |
Ga0210402_102137942 | 3300021478 | Soil | MSLFLTFARKGVRWYRVLRYHKAFSFADSVRYGLWLSLS |
Ga0210402_104638222 | 3300021478 | Soil | MSVILKFARKWVRGYRVLRYHKAFSFADSVRFGLWLSLS |
Ga0210410_100580123 | 3300021479 | Soil | MSVILKFACKWVRWYRVLRYHKAFSFADSVRFGLWLSLS |
Ga0210409_100332303 | 3300021559 | Soil | MSLILIFARTCVRWNRVLRYHKAFSFADSVRYVLWLSLS |
Ga0126371_100584754 | 3300021560 | Tropical Forest Soil | MTLLLRFAGKWVRWYRVLRYAKAFSLFGSVRYGLWLARG |
Ga0126371_101638463 | 3300021560 | Tropical Forest Soil | MSLILTFARKWVRGYRVLRRGNGFSFFDSVRHGLWLARG |
Ga0126371_105151682 | 3300021560 | Tropical Forest Soil | MSLILTFASKWVRWYRVLRYAKAFSLFASVRYGLWLARS |
Ga0126371_105501622 | 3300021560 | Tropical Forest Soil | MSVILTFASKWVRWYRVLRYAKAFSFFASVRYGLWLARS |
Ga0126371_116695991 | 3300021560 | Tropical Forest Soil | ILRFASKWVQWYCVLRYAKAFSFFASVRYGLWLARS |
Ga0126371_119898441 | 3300021560 | Tropical Forest Soil | VSLTFASKWVRWYGVLRYAKAFSFVDSVRYGLWLARG |
Ga0126371_127712191 | 3300021560 | Tropical Forest Soil | MSVILTVASRWVRWYRVLRYAKAFSFFASVRYGLWLARS |
Ga0207684_112830291 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TFMFVRKWVRWYRVLRYGKAFSFVDSMDCGLWLARG |
Ga0207665_111436722 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVTFMFVRKWVRWYRVLRYGKAFSFVDSMDCGLRLARG |
Ga0207711_100787425 | 3300025941 | Switchgrass Rhizosphere | MSLILTFARKWVRWYRLLRCHKAFSFADSVRYGLWLSLS |
Ga0207641_100238891 | 3300026088 | Switchgrass Rhizosphere | MSLILTFARKWVRWYRLLRCHKAFSFADSVRYGLWL |
Ga0207723_1134921 | 3300026824 | Tropical Forest Soil | MSGILILARKRVRSYRVLRYAKAFDFVASVRYGQRL |
Ga0207760_1008072 | 3300026845 | Tropical Forest Soil | MSTIFAFATNWLRWYRVLRYAKAFSLVASVRFGLWLARS |
Ga0207760_1032003 | 3300026845 | Tropical Forest Soil | MSVILTLASKWVRWYGVLRYAKEFSFVASVRYGLWLARS |
Ga0207785_10081991 | 3300026872 | Tropical Forest Soil | MSTIFAFATNWLRWYRVLRYAKAFSLVASVRFGLWLA |
Ga0207837_10150612 | 3300026876 | Tropical Forest Soil | MSVILTLASKWVRWYGVLRYAKEFSFVASVRYGQRLAGS |
Ga0207852_10062802 | 3300026959 | Tropical Forest Soil | MSVILTCANKWIRWYGVLRYVKAFSFVDFVRYGLWLARG |
Ga0207852_10106702 | 3300026959 | Tropical Forest Soil | MSVILTLASKWVRWYGVLRYTKEFSFVDSVRYGLWLAR |
Ga0209622_10073723 | 3300027502 | Forest Soil | MSLIFTFANKWVGWYRVLRYRKGLNFADSIRYGLWLARG |
Ga0209527_100004915 | 3300027583 | Forest Soil | MSLILRFARTWVRWYRVLRYHKAFSFADSVRYGLWLSLS |
Ga0209625_10016353 | 3300027635 | Forest Soil | MSLILRFARTWVRWYRVLRYHKAFSFVDSVRYGLWLSLS |
Ga0209446_100020012 | 3300027698 | Bog Forest Soil | MSLILVFARMWVRWYRVLRYDKAFTFVASVRYGLWLARS |
Ga0209446_10221191 | 3300027698 | Bog Forest Soil | MSVTFMFVRKWVRWYRVLRYGKAFSFVDSMRCGLWLARG |
Ga0209328_100367502 | 3300027727 | Forest Soil | MSLILVFARKWVGWYRLLRYRKAFSFADSIRFGLWLARG |
Ga0209656_100248952 | 3300027812 | Bog Forest Soil | MSMILTFPRTWGRWYRVLRYGKGFSFADSVRYGLWLARS |
Ga0209656_101178502 | 3300027812 | Bog Forest Soil | MSLILVFARKWVRCYRVLRYDKAFTFVASVRYGLWLARS |
Ga0209040_100081816 | 3300027824 | Bog Forest Soil | MSLILAFARKWVGWYRVLRYRKAFSFADSIRYGLWLARG |
Ga0209040_100752102 | 3300027824 | Bog Forest Soil | MSMILTFARTWGRWYRVLRYGKGFSFADSVRYGLWLARS |
Ga0209040_103944482 | 3300027824 | Bog Forest Soil | DSHIPRTWGRWYRVLRYGKGFSFADSVRYGLWLARS |
Ga0209039_100010536 | 3300027825 | Bog Forest Soil | MILTFARTWGQWYRVLRCGKGFSFADSVRYGLWLARS |
Ga0209166_100042897 | 3300027857 | Surface Soil | MSLIFTFASKWVRWYRVLRYGKGFSFTDAVRHGIWLARS |
Ga0209275_100097874 | 3300027884 | Soil | MSVILKFAKWVRWYRVLRYRKAFSFADSVRFGLWLSLS |
Ga0209526_103366732 | 3300028047 | Forest Soil | MSLILVFARKWAGWYRLLRYRKAFSFADSIRYGLWLARG |
Ga0075405_110834031 | 3300030847 | Soil | VMSMTLMFVRKWVRWSRVLRYGKAFGFVDSMRYGLWLARS |
Ga0073994_124166711 | 3300030991 | Soil | LILVFAHKWVRWYHVLRYDKAFTFAASVRYGLWLARG |
Ga0170834_1004486023 | 3300031057 | Forest Soil | MPMTLMFVRKWVRWSRVLRYGKAFGFVDSMRYGLWLARS |
Ga0170834_10314752112 | 3300031057 | Forest Soil | MSRILVFTHKWVRWYRVLRYAKALGFVASLRYGLWLARS |
Ga0170834_1103579333 | 3300031057 | Forest Soil | GVMSMILTFARTWGRWYRVLRYGKGFSFADSVRYGLWLAHS |
Ga0170824_1012930397 | 3300031231 | Forest Soil | MILTFARTWGRWYRLLRYGKGFSFADSVRYGLWLAHS |
Ga0170824_1144295172 | 3300031231 | Forest Soil | MSLILVFARKWARWYRLLRYRKAFTFADSIRYGLWLARG |
Ga0170818_1015362948 | 3300031474 | Forest Soil | MILKFACTWGRWYRVLRYGKGFSFADSVRYGLWLAHS |
Ga0318516_105966492 | 3300031543 | Soil | MSMILTFAQTRGRWYRVLRYGKGFSFADSVRYGLWLAQS |
Ga0318541_101930632 | 3300031545 | Soil | MSVILTFASEWVRWYRVLRYAKALSFFASVRYGLWLARS |
Ga0310915_103162412 | 3300031573 | Soil | MSVILTLASKWVRWYAALRYAKEFSLVDSVRYGLWLARS |
Ga0310915_104761861 | 3300031573 | Soil | MSVILAFASKWVRWYCVLRYAKAFSFFASVRYGLWLARS |
Ga0318574_104236151 | 3300031680 | Soil | VMSVILTVASRWVRWYRVLRYAKAFSFFASVRYGLWLARS |
Ga0310686_1015725283 | 3300031708 | Soil | MSLILVFARKWVRWYRVLRYGKAFTFVASVRYGLWLARS |
Ga0306917_105043831 | 3300031719 | Soil | MSMILTFARTWGRWYRVRRYGKGFSFADSVRYGLWLAQS |
Ga0306918_115666151 | 3300031744 | Soil | SVILTFASEWVRWYRVLRYAKALSFFASVRYGLWLARS |
Ga0307477_100418325 | 3300031753 | Hardwood Forest Soil | MSLILIFARTWVRWYRVLRYHKAFSFADSVRYRLWLSLS |
Ga0307477_100611492 | 3300031753 | Hardwood Forest Soil | MTLILVFACKWVRWYRVLRYGKAFSFADSIRHGLWLARG |
Ga0307475_100447192 | 3300031754 | Hardwood Forest Soil | MSLILVFARKWVGWYRMLRYREAFSFAASIRYGLWLARG |
Ga0307475_107468811 | 3300031754 | Hardwood Forest Soil | ATLGVALGGFMSLILVFARKWVGWYRLLRYRQAFSFSASIRYGLWLARG |
Ga0318543_100208245 | 3300031777 | Soil | MSVILAFASKWVRWYCVLRHAKAFSFFASVRYGLWLARS |
Ga0318576_102636182 | 3300031796 | Soil | MSVILTFASKWVRWYRVLRYAKAFSFFASVRYGLW |
Ga0318550_105120491 | 3300031797 | Soil | ILTFASEWVRWYRVLRYAKALSFFASVRYGLWLARS |
Ga0318511_102329931 | 3300031845 | Soil | MSLILTFTTKWVRWYRVLRYAKAFSFFASVRYGLWLARS |
Ga0306919_104964371 | 3300031879 | Soil | MSNILSFARTWARWYGVLRYAKEFSFADSVRYGLWLARS |
Ga0306925_100861045 | 3300031890 | Soil | MSVILTFASKWVRWYCVLRYAKAFSFFASVLWPVAGA |
Ga0318522_101076402 | 3300031894 | Soil | MSVILTFASKWVRWYRVLRRAKEFSFVASVRYGLWLARS |
Ga0306921_127187891 | 3300031912 | Soil | LSFARTWARWYGVLRYAKSFSFANSVRYGLWLTRS |
Ga0318575_103962371 | 3300032055 | Soil | ILTFASEWVRWYRVLRYAKAFSFFASVRYGLWLARS |
Ga0318504_104356931 | 3300032063 | Soil | SVILTLASKWVRWYAALRYAKEFSLVDSVRYGLWLARS |
Ga0306924_120787442 | 3300032076 | Soil | MFVILMFARKWVGWYRLLRYRKAFSLANSIRYGLWLARG |
Ga0318540_100163421 | 3300032094 | Soil | MSVILTVASRWVRWYRVLRYAKAFSFFASVRYGLWLA |
Ga0311301_1001840110 | 3300032160 | Peatlands Soil | MSVTLTFVHKWVRWYRVLRYGKAFSFVDSMRYGLWLARS |
Ga0311301_101185086 | 3300032160 | Peatlands Soil | MSLILVFARKWVGWYRVLRYRKAFSFADSIRYGLWLARG |
Ga0307472_1001691221 | 3300032205 | Hardwood Forest Soil | MSLILRFARTWVRWYRVLRYHKAFSFADSVRYRLWLSL |
Ga0306920_1003298803 | 3300032261 | Soil | MSVTFMFVRKWVRWYRVLRYGKAFSFVDSMRCGQWLARG |
Ga0335085_10000186123 | 3300032770 | Soil | MSLIFAFVRKWVAWYCVLRYGKTFGFGDSIRYGLWLARG |
Ga0335082_100042782 | 3300032782 | Soil | MSTIFEFATNWVRWYRVLRYAKAFSLVASVRFGLWLARS |
Ga0335079_100615233 | 3300032783 | Soil | MSLILTFARKWVEWYRVLRYGKAFSFADSIRYGLWLARG |
Ga0335079_101493982 | 3300032783 | Soil | MSVILAFASKWVRWYGVLRYSKEFRFVDSVRYGLWLARS |
Ga0335080_115990861 | 3300032828 | Soil | GSAGFSGGVMSVILAFASKWVRWYGVLRYSKEFRFVDSVRYGLWLARS |
Ga0335070_120761551 | 3300032829 | Soil | MSVILTFASKWVRWYGVLRHAKEFSFVDSVRYGLWLARG |
Ga0335081_1000638412 | 3300032892 | Soil | MSTILGFATNWLRWYRVLRYAEAFSLVASVRFGLWLARS |
Ga0335072_101298245 | 3300032898 | Soil | MTPMFIRKWVRWYRVLRYGKAFSLVDSMRYGLWLARS |
Ga0335083_1000040231 | 3300032954 | Soil | MSLILTFVRKWVAWYCVLRYGKTFGFGDSIRYGLWLARG |
Ga0335076_110628171 | 3300032955 | Soil | MSLILVFVRKWVAWYCLLRDEKTFGFADSIRYGLWL |
Ga0335076_110996291 | 3300032955 | Soil | MSVILAFASKWVRWYGVLRYSKEFRFIDSVRYGLWLARS |
Ga0335077_113547362 | 3300033158 | Soil | MSVILTFASKWVRWYGVLRYAKAFSLVDSVRYGLWLARS |
Ga0310914_102234141 | 3300033289 | Soil | MSNILSFARTWARWYGVLRYAKEFSFADSVRYGLW |
Ga0326728_10000241180 | 3300033402 | Peat Soil | MSMILTFTRKRGRWYRALRYGKGFSFANFVRYGLGLARS |
Ga0326727_101944922 | 3300033405 | Peat Soil | MSVILTFASKWVRWYGVLRYAKEFSFVDSVRYGLWLARS |
Ga0326727_108547362 | 3300033405 | Peat Soil | STIFEFATNWLRWYRVLRYAKAFSLVASVRFGLWLARS |
Ga0314864_0001081_2508_2627 | 3300033805 | Peatland | MSTILEFATNWLRWYRVLRYAKAFSLIASVRFGLWLARS |
⦗Top⦘ |