NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028953

Metagenome / Metatranscriptome Family F028953

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028953
Family Type Metagenome / Metatranscriptome
Number of Sequences 190
Average Sequence Length 39 residues
Representative Sequence MSVILTFASKWVRWYRVLRYAKAFSFFASVRYGLWLARS
Number of Associated Samples 134
Number of Associated Scaffolds 190

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.60 %
% of genes near scaffold ends (potentially truncated) 24.21 %
% of genes from short scaffolds (< 2000 bps) 59.47 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.263 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.526 % of family members)
Environment Ontology (ENVO) Unclassified
(45.263 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.053 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.73%    β-sheet: 0.00%    Coil/Unstructured: 46.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 190 Family Scaffolds
PF02954HTH_8 28.95
PF08281Sigma70_r4_2 9.47
PF13581HATPase_c_2 8.42
PF04542Sigma70_r2 6.32
PF00158Sigma54_activat 3.16
PF13590DUF4136 3.16
PF13185GAF_2 2.63
PF13620CarboxypepD_reg 1.58
PF13419HAD_2 1.58
PF00589Phage_integrase 1.05
PF02321OEP 1.05
PF10431ClpB_D2-small 1.05
PF00072Response_reg 0.53
PF00582Usp 0.53
PF00196GerE 0.53
PF01564Spermine_synth 0.53
PF03551PadR 0.53
PF05598DUF772 0.53
PF00440TetR_N 0.53
PF10677DUF2490 0.53
PF07944Glyco_hydro_127 0.53
PF13701DDE_Tnp_1_4 0.53
PF00378ECH_1 0.53
PF01850PIN 0.53
PF01381HTH_3 0.53
PF12645HTH_16 0.53
PF09424YqeY 0.53
PF11026DUF2721 0.53
PF07730HisKA_3 0.53
PF04366Ysc84 0.53
PF00884Sulfatase 0.53
PF08530PepX_C 0.53
PF01047MarR 0.53
PF13492GAF_3 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 190 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 6.32
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 6.32
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 6.32
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 6.32
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 2.11
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.53
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.53
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.53
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.53
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.53
COG3533Beta-L-arabinofuranosidase, GH127 familyCarbohydrate transport and metabolism [G] 0.53
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.53
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.53
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.53
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.26 %
UnclassifiedrootN/A14.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502001|FACENC_GAMC6GA01AYWKINot Available504Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105429585All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300000789|JGI1027J11758_11762659Not Available519Open in IMG/M
3300001471|JGI12712J15308_10218257Not Available504Open in IMG/M
3300001593|JGI12635J15846_10068960All Organisms → cellular organisms → Bacteria2622Open in IMG/M
3300002245|JGIcombinedJ26739_100082762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2982Open in IMG/M
3300002245|JGIcombinedJ26739_100152435All Organisms → cellular organisms → Bacteria → Acidobacteria2184Open in IMG/M
3300002245|JGIcombinedJ26739_100515221Not Available1073Open in IMG/M
3300003218|JGI26339J46600_10009845All Organisms → cellular organisms → Bacteria2785Open in IMG/M
3300003351|JGI26346J50198_1000143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3729Open in IMG/M
3300004080|Ga0062385_10174946All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300004152|Ga0062386_100614059Not Available889Open in IMG/M
3300004152|Ga0062386_100986092Not Available698Open in IMG/M
3300004633|Ga0066395_10388281All Organisms → cellular organisms → Bacteria → Acidobacteria784Open in IMG/M
3300004635|Ga0062388_100485987All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1101Open in IMG/M
3300005332|Ga0066388_100576212All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300005332|Ga0066388_101449920All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300005332|Ga0066388_101789870All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300005332|Ga0066388_102142604All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300005332|Ga0066388_102325165All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300005343|Ga0070687_100156110All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300005437|Ga0070710_10118854All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300005437|Ga0070710_11398706Not Available523Open in IMG/M
3300005467|Ga0070706_101038284All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005537|Ga0070730_10003248All Organisms → cellular organisms → Bacteria14643Open in IMG/M
3300005602|Ga0070762_10014238All Organisms → cellular organisms → Bacteria4050Open in IMG/M
3300005764|Ga0066903_100991752All Organisms → cellular organisms → Bacteria → Acidobacteria1534Open in IMG/M
3300006041|Ga0075023_100196879All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300006047|Ga0075024_100847205Not Available515Open in IMG/M
3300006059|Ga0075017_100991858All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300006059|Ga0075017_101060805All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300006059|Ga0075017_101437693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300006163|Ga0070715_10411226Not Available754Open in IMG/M
3300006172|Ga0075018_10065830All Organisms → cellular organisms → Bacteria1543Open in IMG/M
3300006173|Ga0070716_100190528All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300006174|Ga0075014_100842932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300006175|Ga0070712_100154716All Organisms → cellular organisms → Bacteria1764Open in IMG/M
3300006176|Ga0070765_100482742All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300006852|Ga0075433_10423666Not Available1174Open in IMG/M
3300009698|Ga0116216_10987513Not Available503Open in IMG/M
3300009792|Ga0126374_10664562All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300010048|Ga0126373_10005034All Organisms → cellular organisms → Bacteria10200Open in IMG/M
3300010048|Ga0126373_10110875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans2552Open in IMG/M
3300010048|Ga0126373_12309802Not Available598Open in IMG/M
3300010339|Ga0074046_10000375All Organisms → cellular organisms → Bacteria40506Open in IMG/M
3300010339|Ga0074046_10031249All Organisms → cellular organisms → Bacteria3632Open in IMG/M
3300010339|Ga0074046_10052953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2690Open in IMG/M
3300010339|Ga0074046_10102541All Organisms → cellular organisms → Bacteria → Acidobacteria1846Open in IMG/M
3300010341|Ga0074045_10006316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium10198Open in IMG/M
3300010341|Ga0074045_10009783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8010Open in IMG/M
3300010341|Ga0074045_10010551All Organisms → cellular organisms → Bacteria7655Open in IMG/M
3300010341|Ga0074045_10056608All Organisms → cellular organisms → Bacteria → Acidobacteria2816Open in IMG/M
3300010343|Ga0074044_10004804All Organisms → cellular organisms → Bacteria11120Open in IMG/M
3300010343|Ga0074044_10112733All Organisms → cellular organisms → Bacteria1827Open in IMG/M
3300010361|Ga0126378_11786228All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300010376|Ga0126381_100075009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4234Open in IMG/M
3300010376|Ga0126381_100081727All Organisms → cellular organisms → Bacteria4067Open in IMG/M
3300010376|Ga0126381_100278352All Organisms → cellular organisms → Bacteria2281Open in IMG/M
3300010376|Ga0126381_100355341All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300010376|Ga0126381_101680967Not Available917Open in IMG/M
3300010379|Ga0136449_100024459All Organisms → cellular organisms → Bacteria → Acidobacteria15072Open in IMG/M
3300010398|Ga0126383_10483065All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300010880|Ga0126350_11103920Not Available1161Open in IMG/M
3300012971|Ga0126369_11428379All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300014164|Ga0181532_10114081All Organisms → cellular organisms → Bacteria1665Open in IMG/M
3300016294|Ga0182041_10631698All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300017822|Ga0187802_10010740All Organisms → cellular organisms → Bacteria → Acidobacteria2952Open in IMG/M
3300017822|Ga0187802_10023102All Organisms → cellular organisms → Bacteria2157Open in IMG/M
3300017926|Ga0187807_1131629All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300017933|Ga0187801_10021466All Organisms → cellular organisms → Bacteria2202Open in IMG/M
3300017933|Ga0187801_10371418All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300017942|Ga0187808_10408402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300017955|Ga0187817_10145053All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300017955|Ga0187817_10260273Not Available1105Open in IMG/M
3300017959|Ga0187779_10044590All Organisms → cellular organisms → Bacteria2578Open in IMG/M
3300017972|Ga0187781_10029134All Organisms → cellular organisms → Bacteria3815Open in IMG/M
3300017975|Ga0187782_11521214Not Available527Open in IMG/M
3300018006|Ga0187804_10425736All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300018088|Ga0187771_10146080All Organisms → cellular organisms → Bacteria1940Open in IMG/M
3300019887|Ga0193729_1035598All Organisms → cellular organisms → Bacteria2080Open in IMG/M
3300020580|Ga0210403_10141262All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-131966Open in IMG/M
3300020580|Ga0210403_10313319All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300020580|Ga0210403_10594923Not Available894Open in IMG/M
3300020581|Ga0210399_10046577All Organisms → cellular organisms → Bacteria3479Open in IMG/M
3300020581|Ga0210399_10059308All Organisms → cellular organisms → Bacteria3085Open in IMG/M
3300020583|Ga0210401_10138248All Organisms → cellular organisms → Bacteria2279Open in IMG/M
3300020583|Ga0210401_11531871All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300021168|Ga0210406_10001149All Organisms → cellular organisms → Bacteria33515Open in IMG/M
3300021168|Ga0210406_10064386All Organisms → cellular organisms → Bacteria3169Open in IMG/M
3300021170|Ga0210400_10000207All Organisms → cellular organisms → Bacteria74783Open in IMG/M
3300021171|Ga0210405_10004786All Organisms → cellular organisms → Bacteria12581Open in IMG/M
3300021181|Ga0210388_10251045All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300021401|Ga0210393_10071940All Organisms → cellular organisms → Bacteria2730Open in IMG/M
3300021407|Ga0210383_10437904All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300021407|Ga0210383_11623356All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300021432|Ga0210384_10011133All Organisms → cellular organisms → Bacteria9121Open in IMG/M
3300021433|Ga0210391_10237411All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300021444|Ga0213878_10329284All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300021474|Ga0210390_10325083All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300021478|Ga0210402_10011326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7700Open in IMG/M
3300021478|Ga0210402_10213794All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300021478|Ga0210402_10463822Not Available1176Open in IMG/M
3300021479|Ga0210410_10058012All Organisms → cellular organisms → Bacteria3378Open in IMG/M
3300021559|Ga0210409_10033230All Organisms → cellular organisms → Bacteria → Acidobacteria4944Open in IMG/M
3300021560|Ga0126371_10058475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3710Open in IMG/M
3300021560|Ga0126371_10163846All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium2295Open in IMG/M
3300021560|Ga0126371_10515168All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300021560|Ga0126371_10550162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1303Open in IMG/M
3300021560|Ga0126371_11669599Not Available762Open in IMG/M
3300021560|Ga0126371_11989844All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300021560|Ga0126371_12771219All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300025910|Ga0207684_11283029All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300025939|Ga0207665_11143672All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025941|Ga0207711_10078742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2876Open in IMG/M
3300026088|Ga0207641_10023889All Organisms → cellular organisms → Bacteria → Acidobacteria5040Open in IMG/M
3300026845|Ga0207760_100807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2978Open in IMG/M
3300026845|Ga0207760_103200All Organisms → cellular organisms → Bacteria → Acidobacteria1432Open in IMG/M
3300026872|Ga0207785_1008199All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300026876|Ga0207837_1015061All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300026959|Ga0207852_1006280All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300026959|Ga0207852_1010670All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300027502|Ga0209622_1007372All Organisms → cellular organisms → Bacteria1804Open in IMG/M
3300027583|Ga0209527_1000049All Organisms → cellular organisms → Bacteria → Acidobacteria22537Open in IMG/M
3300027635|Ga0209625_1001635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium5203Open in IMG/M
3300027698|Ga0209446_1000200All Organisms → cellular organisms → Bacteria14400Open in IMG/M
3300027698|Ga0209446_1022119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1581Open in IMG/M
3300027727|Ga0209328_10036750All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300027812|Ga0209656_10024895All Organisms → cellular organisms → Bacteria3616Open in IMG/M
3300027812|Ga0209656_10117850All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300027824|Ga0209040_10008181All Organisms → cellular organisms → Bacteria7471Open in IMG/M
3300027824|Ga0209040_10075210All Organisms → cellular organisms → Bacteria1967Open in IMG/M
3300027824|Ga0209040_10394448All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300027825|Ga0209039_10001053All Organisms → cellular organisms → Bacteria26797Open in IMG/M
3300027857|Ga0209166_10004289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10023Open in IMG/M
3300027884|Ga0209275_10009787All Organisms → cellular organisms → Bacteria4075Open in IMG/M
3300028047|Ga0209526_10336673All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300030847|Ga0075405_11083403All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300030991|Ga0073994_12416671All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300031057|Ga0170834_100448602All Organisms → cellular organisms → Bacteria2082Open in IMG/M
3300031057|Ga0170834_103147521All Organisms → cellular organisms → Bacteria11547Open in IMG/M
3300031057|Ga0170834_110357933All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300031231|Ga0170824_101293039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6821Open in IMG/M
3300031231|Ga0170824_114429517Not Available1344Open in IMG/M
3300031474|Ga0170818_101536294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8435Open in IMG/M
3300031543|Ga0318516_10596649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300031545|Ga0318541_10193063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1126Open in IMG/M
3300031573|Ga0310915_10316241All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300031573|Ga0310915_10476186All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300031680|Ga0318574_10423615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae778Open in IMG/M
3300031708|Ga0310686_101572528All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300031719|Ga0306917_10504383All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300031744|Ga0306918_11566615All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300031753|Ga0307477_10041832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3147Open in IMG/M
3300031753|Ga0307477_10061149All Organisms → cellular organisms → Bacteria2595Open in IMG/M
3300031754|Ga0307475_10044719All Organisms → cellular organisms → Bacteria3297Open in IMG/M
3300031754|Ga0307475_10746881All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300031777|Ga0318543_10020824All Organisms → cellular organisms → Bacteria2452Open in IMG/M
3300031796|Ga0318576_10263618All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300031797|Ga0318550_10512049Not Available579Open in IMG/M
3300031845|Ga0318511_10232993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae824Open in IMG/M
3300031879|Ga0306919_10496437All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300031890|Ga0306925_10086104All Organisms → cellular organisms → Bacteria3331Open in IMG/M
3300031894|Ga0318522_10107640All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300031912|Ga0306921_12718789All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300032055|Ga0318575_10396237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae701Open in IMG/M
3300032063|Ga0318504_10435693Not Available626Open in IMG/M
3300032076|Ga0306924_12078744Not Available583Open in IMG/M
3300032094|Ga0318540_10016342All Organisms → cellular organisms → Bacteria3018Open in IMG/M
3300032160|Ga0311301_10018401All Organisms → cellular organisms → Bacteria → Acidobacteria20158Open in IMG/M
3300032160|Ga0311301_10118508All Organisms → cellular organisms → Bacteria → Acidobacteria5010Open in IMG/M
3300032205|Ga0307472_100169122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1622Open in IMG/M
3300032261|Ga0306920_100329880All Organisms → cellular organisms → Bacteria2272Open in IMG/M
3300032770|Ga0335085_10000186All Organisms → cellular organisms → Bacteria194184Open in IMG/M
3300032782|Ga0335082_10004278All Organisms → cellular organisms → Bacteria → Acidobacteria15556Open in IMG/M
3300032783|Ga0335079_10061523All Organisms → cellular organisms → Bacteria4280Open in IMG/M
3300032783|Ga0335079_10149398Not Available2622Open in IMG/M
3300032828|Ga0335080_11599086Not Available642Open in IMG/M
3300032829|Ga0335070_12076155Not Available510Open in IMG/M
3300032892|Ga0335081_10006384All Organisms → cellular organisms → Bacteria18764Open in IMG/M
3300032898|Ga0335072_10129824All Organisms → cellular organisms → Bacteria3143Open in IMG/M
3300032954|Ga0335083_10000402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae67348Open in IMG/M
3300032955|Ga0335076_11062817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300032955|Ga0335076_11099629All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300033158|Ga0335077_11354736Not Available688Open in IMG/M
3300033289|Ga0310914_10223414All Organisms → cellular organisms → Bacteria1687Open in IMG/M
3300033402|Ga0326728_10000241All Organisms → cellular organisms → Bacteria219568Open in IMG/M
3300033405|Ga0326727_10194492All Organisms → cellular organisms → Bacteria2238Open in IMG/M
3300033405|Ga0326727_10854736All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300033805|Ga0314864_0001081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5331Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil7.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.37%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.32%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil5.26%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.26%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.21%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.21%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.68%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.16%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.63%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.11%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.11%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.58%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.05%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.05%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.53%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.53%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.53%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.53%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502001Soil microbial communities from sample at FACE Site 2 North Carolina CO2+EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300003351Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026824Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes)EnvironmentalOpen in IMG/M
3300026845Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes)EnvironmentalOpen in IMG/M
3300026872Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes)EnvironmentalOpen in IMG/M
3300026876Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 58 (SPAdes)EnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCE_10992202040502001SoilDFAFASKWVRWYRVLRYGKGFSFTDSVRQGIWLARS
INPhiseqgaiiFebDRAFT_10542958543300000364SoilMSMTLMFVRKWVRWSRVLRYGKAFSFVDSMRYGLWLARS*
JGI1027J11758_1176265923300000789SoilMFVILMFARKWVGWYRLLRYRKAFSLASSIRYGLWLA
JGI12712J15308_1021825713300001471Forest SoilMPECAMSQILLFGRKWVEWYRVLRYGKAFIFADSIRYGLWLARG*
JGI12635J15846_1006896023300001593Forest SoilMSVILKFARKWVRWYRVLRYHKAFSFADSVRFGLWLAPG*
JGIcombinedJ26739_10008276223300002245Forest SoilMSLILRFARTWVRWYRVLRYHKAFSFADSVRYGLWLSLS*
JGIcombinedJ26739_10015243533300002245Forest SoilVFARKWVRWYRVLRYGKAFSFADSIRHGLWLARG*
JGIcombinedJ26739_10051522113300002245Forest SoilGGFMSLILVFARKWVGWYRLLRYRKVFSFAASIRYGLWLARG*
JGI26339J46600_1000984523300003218Bog Forest SoilMSMILTFARTWGQWYRVLRCGKGFSFADSVRYGLWLARS*
JGI26346J50198_100014343300003351Bog Forest SoilMSLILVFARMWVRWYRVLRYDKAFTFVASVRYGLWLARS*
Ga0062385_1017494623300004080Bog Forest SoilMSMILTFAGTWGRWYRVLRYAKAFSFVASVRYGLWLARS*
Ga0062386_10061405923300004152Bog Forest SoilMSVILMFARKWIRWYRVLRYGKEFSFAASVRYGLWLARG*
Ga0062386_10098609223300004152Bog Forest SoilMSLILVFARKGVGWYRVPRYSKAFSFTGSIRYGLWLARG*
Ga0066395_1038828113300004633Tropical Forest SoilMSVILTVASKWVRWYRVLRYAKAFSFFASVRYGLWLARS*
Ga0062388_10048598723300004635Bog Forest SoilMSVIFTFASKWVRWYRVLRYGKGFSLTDSVRHGIWLARS*
Ga0066388_10057621223300005332Tropical Forest SoilMSVILRFASKWVQWYCVLRYAKAFSFFASVRYGLWLARS*
Ga0066388_10144992023300005332Tropical Forest SoilMSVILTVASRWVRWYRVLRYAKAFSFFASVRYGLWLARS*
Ga0066388_10178987023300005332Tropical Forest SoilMSVILTFASKWVRWYGVLRYAKALSFFASVRYGLWLARS*
Ga0066388_10214260423300005332Tropical Forest SoilMSLILTFPRKWVRGYRVLRRGYGFSFFDSVRHGLWLARG*
Ga0066388_10232516523300005332Tropical Forest SoilMSRILVLVRKWNTYYRVLRHGKGFSFVDSLRHGLWLARG*
Ga0070687_10015611023300005343Switchgrass RhizosphereMSLILTFARKWVRWYRLLRCHKAFSFADSVRYGLWLSLS*
Ga0070710_1011885413300005437Corn, Switchgrass And Miscanthus RhizosphereMFVILMFVRKWVGWYRVLRYRKAFSLADSIRCGLCLARG*
Ga0070710_1139870623300005437Corn, Switchgrass And Miscanthus RhizosphereMSVILTFARKWVRWHRVLRYHKAFSFADSVRYGVWLSLS*
Ga0070706_10103828413300005467Corn, Switchgrass And Miscanthus RhizosphereMSVTFMFVRKWVRWYRVLRYGKAFSFVDSMDCGLWLARG*
Ga0070730_10003248113300005537Surface SoilMSLIFTFASKWVRWYRVLRYGKGFSFTDAVRHGIWLARS*
Ga0070762_1001423833300005602SoilLGDVMSVILKFAKWVRWYRVLRYRKAFSFADSVRFGLWLSLS*
Ga0066903_10099175213300005764Tropical Forest SoilMSVILTFASKWVRWYRVLRYAKAFSFFASVRYGLWLARS*
Ga0075023_10019687923300006041WatershedsMSLILIFARTWVRWYRVLRYHKAFSFADSVRFGLWLSLS*
Ga0075024_10084720523300006047WatershedsMFVILMFVRKWVGWYRLLRYRKAFSLANSIRYGLWLARG*
Ga0075017_10099185813300006059WatershedsMFVILMFAHKWVGWYRVLRYRKAFSLANSIRYGLWLARG*
Ga0075017_10106080523300006059WatershedsMSLTFMFVRKWVRWYRVLRYAKAFRFVDSMRYGLWLARS*
Ga0075017_10143769313300006059WatershedsMSMILTFARTWGRWYRVLRYGKGFGFADSVRYGLWLARS*
Ga0070715_1041122613300006163Corn, Switchgrass And Miscanthus RhizosphereMSMTLMFVRKWVRWSRVLRYGKAFGFVDSMRYGLWLARS*
Ga0075018_1006583043300006172WatershedsMSFILMFARKWVQWHRVLRYGKEFSFAHSIQYGLWLTRG*
Ga0070716_10019052833300006173Corn, Switchgrass And Miscanthus RhizosphereMSLILIFARTWVRWYRVLRYHKAFSFADSVRYGLWLSLS*
Ga0075014_10084293223300006174WatershedsMSVTFMFVRKWVRWYRVLRYGKAFSFVDSMRCGLWLARG*
Ga0070712_10015471653300006175Corn, Switchgrass And Miscanthus RhizosphereMSLILALVRKWAGWYRVLRYGKAFSFVDSIRYDLWLARG*
Ga0070765_10048274223300006176SoilMTLILIFARTWVRWYRVLRYHKAFSFADSVRYGLWLSLS*
Ga0075433_1042366613300006852Populus RhizosphereMSRILSFVRMWGRWYGVLRHGKDFSIADSVRYSLWLARS*
Ga0116216_1098751313300009698Peatlands SoilMSVTLTFVHKWVRWYRVLRYGKAFSFVDSMRYGLW
Ga0126374_1066456223300009792Tropical Forest SoilMSNILSFARTWARWYGVLRYAKEFSFADSVRYGLWLARS*
Ga0126373_1000503473300010048Tropical Forest SoilMSVILTFTSKWVRWYYVLRYAKALSFFASVRYGLWLARS*
Ga0126373_1011087533300010048Tropical Forest SoilMSLILTFARKWVRGYRVLRRGNGFSFFDSVRHGLWLARG*
Ga0126373_1230980223300010048Tropical Forest SoilMSVSLTFASKWVRWYGVLRYAKAFSFVDSVRYGLWLARG*
Ga0074046_1000037593300010339Bog Forest SoilMSLILAFARKWVGWYRVLRYRKAFSFADSIRYGLWLARG*
Ga0074046_1003124933300010339Bog Forest SoilMSMIFTFASKWVRWYRVLRYGKGFSFTDSVRHGIWLACS*
Ga0074046_1005295323300010339Bog Forest SoilMSMILTFARTWGRWYRVLRYGKGFSFADSVRYGLWLARS*
Ga0074046_1010254113300010339Bog Forest SoilMILTFAHTWGRWYRVLRYGKGFSFGDSVRYGLWLARS*
Ga0074045_10006316113300010341Bog Forest SoilMSVTFMFVRKWVRVLRYGKAFSFVDSMRCGLWLARG*
Ga0074045_1000978323300010341Bog Forest SoilMSMILTFAHTWGRWYRVLRYGKGFSFGDSVRYGLWLARS*
Ga0074045_1001055133300010341Bog Forest SoilMSVILTFASKWVRWYGVLRYAKAFSLVDSVRYGLWLARS*
Ga0074045_1005660833300010341Bog Forest SoilMSIILRFARTWARWYGVLRYSKAFSFADSVRFGLWLARG*
Ga0074044_1000480493300010343Bog Forest SoilMSMILTLARTWGQWYRVLRYGKGFSFPDSVRYGLWLARS*
Ga0074044_1011273333300010343Bog Forest SoilMSLILVFARKWVRCYRVLRYDKAFTFVASVRYGLWLARS*
Ga0126378_1178622823300010361Tropical Forest SoilMSLILTFTTKWLRWYRVLRYAKAFSFFASVRYGLWLARS
Ga0126381_10007500943300010376Tropical Forest SoilMSLIFTLARKWVRGYRVLRRGNGFSFFDSVRHGLWLARG*
Ga0126381_10008172743300010376Tropical Forest SoilMAMILTFARTWGRWYRVLRYGKGFSFADSVRYGLWLAQS*
Ga0126381_10027835233300010376Tropical Forest SoilMSKILSFARTWARWYAVLRNAKAFSFADSVRYGLWLALS*
Ga0126381_10035534123300010376Tropical Forest SoilMSVILTFASKWVRWYRVLRYAKAFSFFASLRYGLWLARS*
Ga0126381_10168096713300010376Tropical Forest SoilILRFASKWVQWYCVLRYAKAFSFFASVRYGLWLARS*
Ga0136449_100024459133300010379Peatlands SoilMSVTLTFVHKWVRWYRVLRYGKAFSFVDSMRYGLWLARS*
Ga0126383_1048306533300010398Tropical Forest SoilNILSFARTWARWYGVLRYAKAFSFADSVRYGLWLARS*
Ga0126350_1110392023300010880Boreal Forest SoilMSVILKFARKWVRWYCVLRYHKAFSFADSVRFGLWLSLS*
Ga0126369_1142837913300012971Tropical Forest SoilMSLILTFTTKWVRWYRVLRYAKAFSFFASVRYGLWLARS*
Ga0181532_1011408133300014164BogMSVTLMFVRKWVRWYRVLRYGKAFSFVDSMRYGLWLARG*
Ga0182041_1063169823300016294SoilLTFARTWGRWYRVLRYGKGFSFADSVRYGLWLAQR
Ga0187802_1001074053300017822Freshwater SedimentMSLTLMFVRKWVRWYRVLRYGKAFSFVDSMRYGLWLARG
Ga0187802_1002310213300017822Freshwater SedimentMSVILMFARKWVRWYRVLRYGKAFSFVDSMRYGLWLARG
Ga0187807_113162923300017926Freshwater SedimentMSVILMFTRKWARWYRVLRYGKAFSFVDSMRYGLWLARG
Ga0187801_1002146643300017933Freshwater SedimentSVILMFARKWVGWYRVLRYGKAFSFADSVRYGLWLARS
Ga0187801_1037141823300017933Freshwater SedimentMILTFTRTWGRWYRVLRCEKGFSFADSVRYGLWLARS
Ga0187808_1040840213300017942Freshwater SedimentMSLTLMFVRKWVRWYRVLRYGKAFSFVDSMRYGLW
Ga0187817_1014505323300017955Freshwater SedimentMSLILRFARTWAGWYGVLRYSKAFSFADSVRYGLWLARS
Ga0187817_1026027313300017955Freshwater SedimentMSIILRFARTWARWYGVLRYSKAFSFADSVRYGLWLAR
Ga0187779_1004459043300017959Tropical PeatlandMSGILTFVRKWVQWYRVLRYAKAFHFVASVRCGLWLARS
Ga0187781_1002913423300017972Tropical PeatlandMPVILTFASKWVRWYGVLRYAKEFSFADSVRYGLWLARS
Ga0187782_1152121413300017975Tropical PeatlandMSGILTFVRKWVQWYRVLRYAKAFHFVASVRCGLWLA
Ga0187804_1042573623300018006Freshwater SedimentSGVWEISVLGTFASKWARWYRVLRYAKAFSCGAFVRYGLWLARS
Ga0187771_1014608023300018088Tropical PeatlandMSVILTLAGKWVRWHQVLRYDKAFGFVDSVRHGLWLARSL
Ga0193729_103559823300019887SoilMSLILVFACKWVGWYRLLRYRKAFSFADSIRFGLWLARG
Ga0210403_1014126233300020580SoilMSLIFTFASKWVRWYRVLRYGKGFSFTDSMRHGIWLARS
Ga0210403_1031331923300020580SoilDAMSLILIFARTWVRWYLVLRYHKAFSFADSVRYGLWLSLSYFPSQI
Ga0210403_1059492323300020580SoilMSLILALVRKWVGWYRVLRYDKAFSFVDSIRYGLWLARG
Ga0210399_1004657713300020581SoilMSVIFTFASKWVRWYRVLRYGKGFSFTDSVRHGIWLARS
Ga0210399_1005930843300020581SoilMSLILALVRKWVGWYRVLRYGKAFSFVDSIRYGLWLARG
Ga0210401_1013824833300020583SoilMTLILTFARKWVRWYSVLRYHNAFSFADSVRYGLWLSLS
Ga0210401_1153187113300020583SoilLGRVMSLILLFGRKWVDWYRVLRYGRAFRFPDSIRYGLWLARE
Ga0210406_10001149223300021168SoilMSLIFTFASKSVRWYRVLRYGKGFSFTDSVRHGIWLARS
Ga0210406_1006438623300021168SoilMLLILTFARKWVRWYRVLRYHKAFSFADSVRYGLWLARG
Ga0210400_10000207123300021170SoilMSLVFTFAGKWARWYRVLRYGKGFSFTDSVRHGIWLARS
Ga0210405_1000478693300021171SoilMSLILVFVRKWVGWYRLLRYRKAFSFADSIRFGLWLARG
Ga0210388_1025104533300021181SoilMSVIFRFAPKWVRWYGVLRYHKAFSFADSVRFGLWLSLS
Ga0210393_1007194033300021401SoilMSVILKFARKWVRWYRVLRYHKAFSFADSVRFGLWLSLS
Ga0210383_1043790433300021407SoilMSVILKFARKWVRWYRVLRYHKAFSFADSVRFGLW
Ga0210383_1162335623300021407SoilGDVMSVILKFARKWVRWYRVLRYRKAFSFADSVRFGLWLSLS
Ga0210384_10011133153300021432SoilMSVIVTVARKWVRWYRVLRYHKAFSFGDSVRYGLWLSLS
Ga0210391_1023741113300021433SoilGRVMSLILLLGRKWVDWYRVLRYGKAFSFADSSRYGLWRARG
Ga0213878_1032928423300021444Bulk SoilMSVILTLASKWVRWYGVLRHAKEFSFVDSVRYGLWLARG
Ga0210390_1032508313300021474SoilRFLGDVMSLILTFARKWVRWYRVLRYHKAFSFADSVRFGLWLSLS
Ga0210402_1001132673300021478SoilMSLILALVRKWVGWYCVLRYGKAFSFVDSIWYGMWLARG
Ga0210402_1021379423300021478SoilMSLFLTFARKGVRWYRVLRYHKAFSFADSVRYGLWLSLS
Ga0210402_1046382223300021478SoilMSVILKFARKWVRGYRVLRYHKAFSFADSVRFGLWLSLS
Ga0210410_1005801233300021479SoilMSVILKFACKWVRWYRVLRYHKAFSFADSVRFGLWLSLS
Ga0210409_1003323033300021559SoilMSLILIFARTCVRWNRVLRYHKAFSFADSVRYVLWLSLS
Ga0126371_1005847543300021560Tropical Forest SoilMTLLLRFAGKWVRWYRVLRYAKAFSLFGSVRYGLWLARG
Ga0126371_1016384633300021560Tropical Forest SoilMSLILTFARKWVRGYRVLRRGNGFSFFDSVRHGLWLARG
Ga0126371_1051516823300021560Tropical Forest SoilMSLILTFASKWVRWYRVLRYAKAFSLFASVRYGLWLARS
Ga0126371_1055016223300021560Tropical Forest SoilMSVILTFASKWVRWYRVLRYAKAFSFFASVRYGLWLARS
Ga0126371_1166959913300021560Tropical Forest SoilILRFASKWVQWYCVLRYAKAFSFFASVRYGLWLARS
Ga0126371_1198984413300021560Tropical Forest SoilVSLTFASKWVRWYGVLRYAKAFSFVDSVRYGLWLARG
Ga0126371_1277121913300021560Tropical Forest SoilMSVILTVASRWVRWYRVLRYAKAFSFFASVRYGLWLARS
Ga0207684_1128302913300025910Corn, Switchgrass And Miscanthus RhizosphereTFMFVRKWVRWYRVLRYGKAFSFVDSMDCGLWLARG
Ga0207665_1114367223300025939Corn, Switchgrass And Miscanthus RhizosphereMSVTFMFVRKWVRWYRVLRYGKAFSFVDSMDCGLRLARG
Ga0207711_1007874253300025941Switchgrass RhizosphereMSLILTFARKWVRWYRLLRCHKAFSFADSVRYGLWLSLS
Ga0207641_1002388913300026088Switchgrass RhizosphereMSLILTFARKWVRWYRLLRCHKAFSFADSVRYGLWL
Ga0207723_11349213300026824Tropical Forest SoilMSGILILARKRVRSYRVLRYAKAFDFVASVRYGQRL
Ga0207760_10080723300026845Tropical Forest SoilMSTIFAFATNWLRWYRVLRYAKAFSLVASVRFGLWLARS
Ga0207760_10320033300026845Tropical Forest SoilMSVILTLASKWVRWYGVLRYAKEFSFVASVRYGLWLARS
Ga0207785_100819913300026872Tropical Forest SoilMSTIFAFATNWLRWYRVLRYAKAFSLVASVRFGLWLA
Ga0207837_101506123300026876Tropical Forest SoilMSVILTLASKWVRWYGVLRYAKEFSFVASVRYGQRLAGS
Ga0207852_100628023300026959Tropical Forest SoilMSVILTCANKWIRWYGVLRYVKAFSFVDFVRYGLWLARG
Ga0207852_101067023300026959Tropical Forest SoilMSVILTLASKWVRWYGVLRYTKEFSFVDSVRYGLWLAR
Ga0209622_100737233300027502Forest SoilMSLIFTFANKWVGWYRVLRYRKGLNFADSIRYGLWLARG
Ga0209527_1000049153300027583Forest SoilMSLILRFARTWVRWYRVLRYHKAFSFADSVRYGLWLSLS
Ga0209625_100163533300027635Forest SoilMSLILRFARTWVRWYRVLRYHKAFSFVDSVRYGLWLSLS
Ga0209446_1000200123300027698Bog Forest SoilMSLILVFARMWVRWYRVLRYDKAFTFVASVRYGLWLARS
Ga0209446_102211913300027698Bog Forest SoilMSVTFMFVRKWVRWYRVLRYGKAFSFVDSMRCGLWLARG
Ga0209328_1003675023300027727Forest SoilMSLILVFARKWVGWYRLLRYRKAFSFADSIRFGLWLARG
Ga0209656_1002489523300027812Bog Forest SoilMSMILTFPRTWGRWYRVLRYGKGFSFADSVRYGLWLARS
Ga0209656_1011785023300027812Bog Forest SoilMSLILVFARKWVRCYRVLRYDKAFTFVASVRYGLWLARS
Ga0209040_1000818163300027824Bog Forest SoilMSLILAFARKWVGWYRVLRYRKAFSFADSIRYGLWLARG
Ga0209040_1007521023300027824Bog Forest SoilMSMILTFARTWGRWYRVLRYGKGFSFADSVRYGLWLARS
Ga0209040_1039444823300027824Bog Forest SoilDSHIPRTWGRWYRVLRYGKGFSFADSVRYGLWLARS
Ga0209039_1000105363300027825Bog Forest SoilMILTFARTWGQWYRVLRCGKGFSFADSVRYGLWLARS
Ga0209166_1000428973300027857Surface SoilMSLIFTFASKWVRWYRVLRYGKGFSFTDAVRHGIWLARS
Ga0209275_1000978743300027884SoilMSVILKFAKWVRWYRVLRYRKAFSFADSVRFGLWLSLS
Ga0209526_1033667323300028047Forest SoilMSLILVFARKWAGWYRLLRYRKAFSFADSIRYGLWLARG
Ga0075405_1108340313300030847SoilVMSMTLMFVRKWVRWSRVLRYGKAFGFVDSMRYGLWLARS
Ga0073994_1241667113300030991SoilLILVFAHKWVRWYHVLRYDKAFTFAASVRYGLWLARG
Ga0170834_10044860233300031057Forest SoilMPMTLMFVRKWVRWSRVLRYGKAFGFVDSMRYGLWLARS
Ga0170834_103147521123300031057Forest SoilMSRILVFTHKWVRWYRVLRYAKALGFVASLRYGLWLARS
Ga0170834_11035793333300031057Forest SoilGVMSMILTFARTWGRWYRVLRYGKGFSFADSVRYGLWLAHS
Ga0170824_10129303973300031231Forest SoilMILTFARTWGRWYRLLRYGKGFSFADSVRYGLWLAHS
Ga0170824_11442951723300031231Forest SoilMSLILVFARKWARWYRLLRYRKAFTFADSIRYGLWLARG
Ga0170818_10153629483300031474Forest SoilMILKFACTWGRWYRVLRYGKGFSFADSVRYGLWLAHS
Ga0318516_1059664923300031543SoilMSMILTFAQTRGRWYRVLRYGKGFSFADSVRYGLWLAQS
Ga0318541_1019306323300031545SoilMSVILTFASEWVRWYRVLRYAKALSFFASVRYGLWLARS
Ga0310915_1031624123300031573SoilMSVILTLASKWVRWYAALRYAKEFSLVDSVRYGLWLARS
Ga0310915_1047618613300031573SoilMSVILAFASKWVRWYCVLRYAKAFSFFASVRYGLWLARS
Ga0318574_1042361513300031680SoilVMSVILTVASRWVRWYRVLRYAKAFSFFASVRYGLWLARS
Ga0310686_10157252833300031708SoilMSLILVFARKWVRWYRVLRYGKAFTFVASVRYGLWLARS
Ga0306917_1050438313300031719SoilMSMILTFARTWGRWYRVRRYGKGFSFADSVRYGLWLAQS
Ga0306918_1156661513300031744SoilSVILTFASEWVRWYRVLRYAKALSFFASVRYGLWLARS
Ga0307477_1004183253300031753Hardwood Forest SoilMSLILIFARTWVRWYRVLRYHKAFSFADSVRYRLWLSLS
Ga0307477_1006114923300031753Hardwood Forest SoilMTLILVFACKWVRWYRVLRYGKAFSFADSIRHGLWLARG
Ga0307475_1004471923300031754Hardwood Forest SoilMSLILVFARKWVGWYRMLRYREAFSFAASIRYGLWLARG
Ga0307475_1074688113300031754Hardwood Forest SoilATLGVALGGFMSLILVFARKWVGWYRLLRYRQAFSFSASIRYGLWLARG
Ga0318543_1002082453300031777SoilMSVILAFASKWVRWYCVLRHAKAFSFFASVRYGLWLARS
Ga0318576_1026361823300031796SoilMSVILTFASKWVRWYRVLRYAKAFSFFASVRYGLW
Ga0318550_1051204913300031797SoilILTFASEWVRWYRVLRYAKALSFFASVRYGLWLARS
Ga0318511_1023299313300031845SoilMSLILTFTTKWVRWYRVLRYAKAFSFFASVRYGLWLARS
Ga0306919_1049643713300031879SoilMSNILSFARTWARWYGVLRYAKEFSFADSVRYGLWLARS
Ga0306925_1008610453300031890SoilMSVILTFASKWVRWYCVLRYAKAFSFFASVLWPVAGA
Ga0318522_1010764023300031894SoilMSVILTFASKWVRWYRVLRRAKEFSFVASVRYGLWLARS
Ga0306921_1271878913300031912SoilLSFARTWARWYGVLRYAKSFSFANSVRYGLWLTRS
Ga0318575_1039623713300032055SoilILTFASEWVRWYRVLRYAKAFSFFASVRYGLWLARS
Ga0318504_1043569313300032063SoilSVILTLASKWVRWYAALRYAKEFSLVDSVRYGLWLARS
Ga0306924_1207874423300032076SoilMFVILMFARKWVGWYRLLRYRKAFSLANSIRYGLWLARG
Ga0318540_1001634213300032094SoilMSVILTVASRWVRWYRVLRYAKAFSFFASVRYGLWLA
Ga0311301_10018401103300032160Peatlands SoilMSVTLTFVHKWVRWYRVLRYGKAFSFVDSMRYGLWLARS
Ga0311301_1011850863300032160Peatlands SoilMSLILVFARKWVGWYRVLRYRKAFSFADSIRYGLWLARG
Ga0307472_10016912213300032205Hardwood Forest SoilMSLILRFARTWVRWYRVLRYHKAFSFADSVRYRLWLSL
Ga0306920_10032988033300032261SoilMSVTFMFVRKWVRWYRVLRYGKAFSFVDSMRCGQWLARG
Ga0335085_100001861233300032770SoilMSLIFAFVRKWVAWYCVLRYGKTFGFGDSIRYGLWLARG
Ga0335082_1000427823300032782SoilMSTIFEFATNWVRWYRVLRYAKAFSLVASVRFGLWLARS
Ga0335079_1006152333300032783SoilMSLILTFARKWVEWYRVLRYGKAFSFADSIRYGLWLARG
Ga0335079_1014939823300032783SoilMSVILAFASKWVRWYGVLRYSKEFRFVDSVRYGLWLARS
Ga0335080_1159908613300032828SoilGSAGFSGGVMSVILAFASKWVRWYGVLRYSKEFRFVDSVRYGLWLARS
Ga0335070_1207615513300032829SoilMSVILTFASKWVRWYGVLRHAKEFSFVDSVRYGLWLARG
Ga0335081_10006384123300032892SoilMSTILGFATNWLRWYRVLRYAEAFSLVASVRFGLWLARS
Ga0335072_1012982453300032898SoilMTPMFIRKWVRWYRVLRYGKAFSLVDSMRYGLWLARS
Ga0335083_10000402313300032954SoilMSLILTFVRKWVAWYCVLRYGKTFGFGDSIRYGLWLARG
Ga0335076_1106281713300032955SoilMSLILVFVRKWVAWYCLLRDEKTFGFADSIRYGLWL
Ga0335076_1109962913300032955SoilMSVILAFASKWVRWYGVLRYSKEFRFIDSVRYGLWLARS
Ga0335077_1135473623300033158SoilMSVILTFASKWVRWYGVLRYAKAFSLVDSVRYGLWLARS
Ga0310914_1022341413300033289SoilMSNILSFARTWARWYGVLRYAKEFSFADSVRYGLW
Ga0326728_100002411803300033402Peat SoilMSMILTFTRKRGRWYRALRYGKGFSFANFVRYGLGLARS
Ga0326727_1019449223300033405Peat SoilMSVILTFASKWVRWYGVLRYAKEFSFVDSVRYGLWLARS
Ga0326727_1085473623300033405Peat SoilSTIFEFATNWLRWYRVLRYAKAFSLVASVRFGLWLARS
Ga0314864_0001081_2508_26273300033805PeatlandMSTILEFATNWLRWYRVLRYAKAFSLIASVRFGLWLARS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.