NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F029015

Metatranscriptome Family F029015

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029015
Family Type Metatranscriptome
Number of Sequences 189
Average Sequence Length 107 residues
Representative Sequence MPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Number of Associated Samples 132
Number of Associated Scaffolds 189

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 15.68 %
% of genes near scaffold ends (potentially truncated) 64.55 %
% of genes from short scaffolds (< 2000 bps) 96.30 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (89.418 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(86.772 % of family members)
Environment Ontology (ENVO) Unclassified
(96.825 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.005 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.39%    β-sheet: 27.55%    Coil/Unstructured: 53.06%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 189 Family Scaffolds
PF06399GFRP 14.81



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.53 %
UnclassifiedrootN/A8.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005420|Ga0068879_1469906All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1030Open in IMG/M
3300008832|Ga0103951_10042449All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1575Open in IMG/M
3300008832|Ga0103951_10618073All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda590Open in IMG/M
3300008998|Ga0103502_10054894All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1350Open in IMG/M
3300008998|Ga0103502_10098251All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1039Open in IMG/M
3300008998|Ga0103502_10126436All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda919Open in IMG/M
3300008998|Ga0103502_10167456All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda799Open in IMG/M
3300008998|Ga0103502_10284241All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda609Open in IMG/M
3300008998|Ga0103502_10316563All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda576Open in IMG/M
3300009022|Ga0103706_10077442All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda734Open in IMG/M
3300009022|Ga0103706_10083224All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda715Open in IMG/M
3300009028|Ga0103708_100036732All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1016Open in IMG/M
3300009269|Ga0103876_1017688All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda821Open in IMG/M
3300009274|Ga0103878_1038397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda552Open in IMG/M
3300012966|Ga0129341_1113817All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1137Open in IMG/M
3300018609|Ga0192959_1005268All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1770Open in IMG/M
3300018615|Ga0192957_1008061All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1832Open in IMG/M
3300018626|Ga0192863_1022102All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda814Open in IMG/M
3300018654|Ga0192918_1030221All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda855Open in IMG/M
3300018657|Ga0192889_1025972All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda908Open in IMG/M
3300018659|Ga0193067_1033182All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda774Open in IMG/M
3300018659|Ga0193067_1055182All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda580Open in IMG/M
3300018673|Ga0193229_1014090All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda799Open in IMG/M
3300018685|Ga0193086_1019621All Organisms → Viruses → Predicted Viral1042Open in IMG/M
3300018690|Ga0192917_1005179All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1507Open in IMG/M
3300018691|Ga0193294_1040649All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda531Open in IMG/M
3300018699|Ga0193195_1013152All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda864Open in IMG/M
3300018708|Ga0192920_1015866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1428Open in IMG/M
3300018709|Ga0193209_1049378All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda601Open in IMG/M
3300018709|Ga0193209_1053524All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda573Open in IMG/M
3300018717|Ga0192964_1014447All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1955Open in IMG/M
3300018720|Ga0192866_1043353All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda723Open in IMG/M
3300018723|Ga0193038_1012493All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1194Open in IMG/M
3300018727|Ga0193115_1033418All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda823Open in IMG/M
3300018731|Ga0193529_1013088All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1404Open in IMG/M
3300018736|Ga0192879_1071637All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda776Open in IMG/M
3300018752|Ga0192902_1093243All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda520Open in IMG/M
3300018758|Ga0193058_1015117All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1013Open in IMG/M
3300018763|Ga0192827_1095369Not Available504Open in IMG/M
3300018769|Ga0193478_1047753All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda692Open in IMG/M
3300018770|Ga0193530_1089407All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda570Open in IMG/M
3300018770|Ga0193530_1097309Not Available537Open in IMG/M
3300018771|Ga0193314_1032082All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda943Open in IMG/M
3300018771|Ga0193314_1035312All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda893Open in IMG/M
3300018777|Ga0192839_1068696All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda549Open in IMG/M
3300018783|Ga0193197_1018504All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1032Open in IMG/M
3300018784|Ga0193298_1102069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda500Open in IMG/M
3300018789|Ga0193251_1067989All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1067Open in IMG/M
3300018792|Ga0192956_1066829All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda971Open in IMG/M
3300018792|Ga0192956_1103766All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda702Open in IMG/M
3300018792|Ga0192956_1134923Not Available561Open in IMG/M
3300018792|Ga0192956_1140991All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda539Open in IMG/M
3300018792|Ga0192956_1143323Not Available531Open in IMG/M
3300018793|Ga0192928_1076131All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda583Open in IMG/M
3300018794|Ga0193357_1043220All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda742Open in IMG/M
3300018802|Ga0193388_1058530Not Available611Open in IMG/M
3300018804|Ga0193329_1048206All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda850Open in IMG/M
3300018804|Ga0193329_1056472All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda777Open in IMG/M
3300018813|Ga0192872_1079590Not Available563Open in IMG/M
3300018819|Ga0193497_1045216All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda821Open in IMG/M
3300018819|Ga0193497_1062802All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda688Open in IMG/M
3300018819|Ga0193497_1088084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda562Open in IMG/M
3300018834|Ga0192877_1054000All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1215Open in IMG/M
3300018837|Ga0192927_1027758All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda855Open in IMG/M
3300018837|Ga0192927_1075363All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda530Open in IMG/M
3300018837|Ga0192927_1075993All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda528Open in IMG/M
3300018853|Ga0192958_1146306Not Available529Open in IMG/M
3300018854|Ga0193214_1022593All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1219Open in IMG/M
3300018854|Ga0193214_1089169Not Available565Open in IMG/M
3300018859|Ga0193199_1052216All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda912Open in IMG/M
3300018865|Ga0193359_1048904All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda814Open in IMG/M
3300018865|Ga0193359_1103507Not Available532Open in IMG/M
3300018867|Ga0192859_1033206All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda810Open in IMG/M
3300018873|Ga0193553_1003389All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda2990Open in IMG/M
3300018873|Ga0193553_1017757All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1797Open in IMG/M
3300018882|Ga0193471_1076837Not Available635Open in IMG/M
3300018887|Ga0193360_1030234All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1346Open in IMG/M
3300018887|Ga0193360_1137073All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda532Open in IMG/M
3300018896|Ga0192965_1015415All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda2711Open in IMG/M
3300018896|Ga0192965_1036555All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1830Open in IMG/M
3300018898|Ga0193268_1105828All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda856Open in IMG/M
3300018902|Ga0192862_1149557All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda550Open in IMG/M
3300018908|Ga0193279_1030570All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1088Open in IMG/M
3300018912|Ga0193176_10134609All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda682Open in IMG/M
3300018921|Ga0193536_1123441All Organisms → Viruses → Predicted Viral1046Open in IMG/M
3300018921|Ga0193536_1126665All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1029Open in IMG/M
3300018929|Ga0192921_10217165All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda552Open in IMG/M
3300018934|Ga0193552_10165578All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda629Open in IMG/M
3300018935|Ga0193466_1170139All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda507Open in IMG/M
3300018944|Ga0193402_10127663All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda711Open in IMG/M
3300018947|Ga0193066_10050466All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1149Open in IMG/M
3300018948|Ga0192985_1037628All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1748Open in IMG/M
3300018950|Ga0192892_10051305All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1484Open in IMG/M
3300018953|Ga0193567_10145782All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda770Open in IMG/M
3300018956|Ga0192919_1196691All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda583Open in IMG/M
3300018956|Ga0192919_1218874Not Available535Open in IMG/M
3300018957|Ga0193528_10298441All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda538Open in IMG/M
3300018960|Ga0192930_10143567All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda914Open in IMG/M
3300018961|Ga0193531_10030150All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1863Open in IMG/M
3300018961|Ga0193531_10040589All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1679Open in IMG/M
3300018961|Ga0193531_10121239All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1027Open in IMG/M
3300018964|Ga0193087_10062143All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1158Open in IMG/M
3300018965|Ga0193562_10107926All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda797Open in IMG/M
3300018975|Ga0193006_10051018All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1204Open in IMG/M
3300018978|Ga0193487_10005102All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda3546Open in IMG/M
3300018978|Ga0193487_10148574All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda811Open in IMG/M
3300018979|Ga0193540_10011585All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1515Open in IMG/M
3300018979|Ga0193540_10224019All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda511Open in IMG/M
3300018982|Ga0192947_10088863All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1016Open in IMG/M
3300018982|Ga0192947_10088864All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1016Open in IMG/M
3300018985|Ga0193136_10180306All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda630Open in IMG/M
3300018985|Ga0193136_10229126All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda553Open in IMG/M
3300018986|Ga0193554_10268508All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda645Open in IMG/M
3300018987|Ga0193188_10082952All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda529Open in IMG/M
3300018988|Ga0193275_10026315All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1264Open in IMG/M
3300018988|Ga0193275_10237010All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda572Open in IMG/M
3300018989|Ga0193030_10121935All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda824Open in IMG/M
3300018989|Ga0193030_10138601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda780Open in IMG/M
3300018992|Ga0193518_10070748All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1340Open in IMG/M
3300018996|Ga0192916_10129193All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda758Open in IMG/M
3300018996|Ga0192916_10203141All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda576Open in IMG/M
3300018997|Ga0193257_10099128All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda922Open in IMG/M
3300018998|Ga0193444_10110090All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda729Open in IMG/M
3300018998|Ga0193444_10114632All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda714Open in IMG/M
3300018999|Ga0193514_10080519All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1167Open in IMG/M
3300018999|Ga0193514_10137028All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda897Open in IMG/M
3300018999|Ga0193514_10138468All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda891Open in IMG/M
3300018999|Ga0193514_10274346All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda582Open in IMG/M
3300019004|Ga0193078_10132495All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda610Open in IMG/M
3300019006|Ga0193154_10026774All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1720Open in IMG/M
3300019006|Ga0193154_10084969All Organisms → Viruses → Predicted Viral1124Open in IMG/M
3300019006|Ga0193154_10157798All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda818Open in IMG/M
3300019006|Ga0193154_10294487All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda536Open in IMG/M
3300019010|Ga0193044_10163455All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda722Open in IMG/M
3300019011|Ga0192926_10246733All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda763Open in IMG/M
3300019013|Ga0193557_10138558All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda853Open in IMG/M
3300019013|Ga0193557_10151135All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda805Open in IMG/M
3300019016|Ga0193094_10105636All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1043Open in IMG/M
3300019019|Ga0193555_10028576All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1914Open in IMG/M
3300019019|Ga0193555_10258419All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda557Open in IMG/M
3300019020|Ga0193538_10040303All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1664Open in IMG/M
3300019023|Ga0193561_10143961All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda964Open in IMG/M
3300019023|Ga0193561_10202745All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda773Open in IMG/M
3300019023|Ga0193561_10219726All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda731Open in IMG/M
3300019028|Ga0193449_10155113All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1024Open in IMG/M
3300019037|Ga0192886_10155365All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda713Open in IMG/M
3300019038|Ga0193558_10107326All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1128Open in IMG/M
3300019040|Ga0192857_10071541All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda890Open in IMG/M
3300019044|Ga0193189_10055047All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda935Open in IMG/M
3300019044|Ga0193189_10167459All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda521Open in IMG/M
3300019045|Ga0193336_10591269All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda545Open in IMG/M
3300019051|Ga0192826_10108776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda999Open in IMG/M
3300019052|Ga0193455_10048883All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1687Open in IMG/M
3300019053|Ga0193356_10039704All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1354Open in IMG/M
3300019053|Ga0193356_10091604All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1007Open in IMG/M
3300019055|Ga0193208_10116752All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1233Open in IMG/M
3300019055|Ga0193208_10297403All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda831Open in IMG/M
3300019115|Ga0193443_1011826All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda850Open in IMG/M
3300019120|Ga0193256_1052308All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda694Open in IMG/M
3300019121|Ga0193155_1056367All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda546Open in IMG/M
3300019126|Ga0193144_1115475Not Available502Open in IMG/M
3300019127|Ga0193202_1018938All Organisms → Viruses → Predicted Viral1039Open in IMG/M
3300019136|Ga0193112_1015860All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1519Open in IMG/M
3300019138|Ga0193216_10034320All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1178Open in IMG/M
3300019138|Ga0193216_10083925All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda737Open in IMG/M
3300019143|Ga0192856_1048914All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda602Open in IMG/M
3300019147|Ga0193453_1032286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1223Open in IMG/M
3300019152|Ga0193564_10039624All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1438Open in IMG/M
3300019152|Ga0193564_10155333All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda714Open in IMG/M
3300021928|Ga0063134_1136518All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda507Open in IMG/M
3300031522|Ga0307388_10503275All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda797Open in IMG/M
3300031674|Ga0307393_1109388All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda606Open in IMG/M
3300031709|Ga0307385_10146786All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda889Open in IMG/M
3300031709|Ga0307385_10412167All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda516Open in IMG/M
3300031717|Ga0307396_10094192All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1342Open in IMG/M
3300031734|Ga0307397_10600267All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda517Open in IMG/M
3300031738|Ga0307384_10086170All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1252Open in IMG/M
3300031739|Ga0307383_10201075All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda939Open in IMG/M
3300031739|Ga0307383_10718032All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda510Open in IMG/M
3300031742|Ga0307395_10176059All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda903Open in IMG/M
3300031742|Ga0307395_10301104All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda692Open in IMG/M
3300031743|Ga0307382_10052322All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1578Open in IMG/M
3300031750|Ga0307389_10075320All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1697Open in IMG/M
3300032481|Ga0314668_10290329All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda845Open in IMG/M
3300033572|Ga0307390_10563142All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda709Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine86.77%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.47%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.59%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.06%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.53%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.53%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.53%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018609Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782449-ERR1712128)EnvironmentalOpen in IMG/M
3300018615Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782230-ERR1712123)EnvironmentalOpen in IMG/M
3300018626Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789512-ERR1719180)EnvironmentalOpen in IMG/M
3300018654Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000841 (ERX1782169-ERR1712180)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018673Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_048 - TARA_N000000115 (ERX1782433-ERR1712189)EnvironmentalOpen in IMG/M
3300018685Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782360-ERR1712233)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018691Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001616 (ERX1782222-ERR1712214)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018708Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782185-ERR1711899)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018717Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789634-ERR1719196)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018727Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782136-ERR1711928)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018736Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000750 (ERX1789504-ERR1719154)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018771Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438)EnvironmentalOpen in IMG/M
3300018777Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018789Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001380 (ERX1809763-ERR1740128)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018802Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789649-ERR1719297)EnvironmentalOpen in IMG/M
3300018804Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001738 (ERX1789642-ERR1719208)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018834Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789722-ERR1719319)EnvironmentalOpen in IMG/M
3300018837Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782235-ERR1712073)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018887Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789534-ERR1719462)EnvironmentalOpen in IMG/M
3300018896Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789685-ERR1719483)EnvironmentalOpen in IMG/M
3300018898Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789568-ERR1719317)EnvironmentalOpen in IMG/M
3300018902Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789490-ERR1719234)EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018912Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243)EnvironmentalOpen in IMG/M
3300018921Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789458-ERR1719341)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018935Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789599-ERR1719494)EnvironmentalOpen in IMG/M
3300018944Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789675-ERR1719391)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018950Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789413-ERR1719427)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018956Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000841 (ERX1782332-ERR1711962)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018960Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018987Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789590-ERR1719255)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018992Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_146 - TARA_N000003240 (ERX1789485-ERR1719233)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019023Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_145 - TARA_N000003231EnvironmentalOpen in IMG/M
3300019028Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789432-ERR1719419)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019038Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003141EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019044Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789478-ERR1719328)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019115Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002358 (ERX1782231-ERR1711979)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019121Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782343-ERR1711910)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019127Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782135-ERR1712133)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019138Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000077 (ERX1782429-ERR1712131)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019147Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782434-ERR1711973)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068879_146990613300005420Freshwater LakeMPYIIVRESYIQSSCAVDGLPLNEIRLLSEKASSPSDIRDEKNRRVEFSTPSYNLLNALEQIGYRVVTSGAFVTGTKKFDTKDFVWTLHRPSNEIEQ*
Ga0103951_1004244913300008832MarinePKSCPSSPLFFPKRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM*
Ga0103951_1061807313300008832MarineTNVVPPTMPYVIVRESYINNSCLVDGLPLNEVRLITEKSCSPSQYRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDLDM*
Ga0103502_1005489423300008998MarineMPYVIVRESYINNSCLVDGLPLNEVRLITEKSCSPSQYRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDLDM*
Ga0103502_1009825133300008998MarineVAGHVGERRERTDVTMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM*
Ga0103502_1012643613300008998MarineVDGLPLNEVRSVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG*
Ga0103502_1016745613300008998MarineVSRHGGKGIEAIMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM*
Ga0103502_1028424113300008998MarineMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEAEMG*
Ga0103502_1031656313300008998MarineMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA*
Ga0103706_1007744213300009022Ocean WaterMSGHSHVVFLNVAATGHMNPTLPLVAELTMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSYFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM*
Ga0103706_1008322413300009022Ocean WaterMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM*
Ga0103708_10003673213300009028Ocean WaterVAELTMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM*
Ga0103876_101768813300009269Surface Ocean WaterMPYIIVRESYISNRCVVDGLPSNEVRQISEKSSSPSSVRDERNSRIEFNTEACNLLNALEQLGYKVVTSSSFVTGPKKFDTKDFVWTLYRPSRCDIEM*
Ga0103878_103839713300009274Surface Ocean WaterLSLLTMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG*
Ga0129341_111381723300012966AqueousMVDGLPLNEIRLLSEKASSPSDMRDEKNRRVEFCTPSFNLLNALEQIGYRVVTSGSFVTGTKKFDTKDFVWTLHRPSNEIEQ*
Ga0192959_100526813300018609MarineTWGVRVRLLGWRSDNCGPKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0192957_100806113300018615MarineHGESGSDFWAGGLTIVGLKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0192863_102210223300018626MarineMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVITSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0192918_103022113300018654MarineSCPSSPLFFPKRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0192889_102597213300018657MarineVAELTMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193067_103318213300018659MarineDGLPSNEIRLITEKCSPSHYRDERHWRVEFSTEAFTLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0193067_105518213300018659MarineFIIITNGLNIFITMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSIEADMG
Ga0193229_101409013300018673MarineMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVITSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193086_101962123300018685MarineMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0192917_100517913300018690MarineVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193294_104064913300018691MarineLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193195_101315223300018699MarineFKMPYVIVRESYINNSCVVDGLPSNEIRLITEKCSPSHYRDERHWRVEFSTEAFTLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0192920_101586623300018708MarineTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193209_104937823300018709MarineYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193209_105352413300018709MarineEGERTGCGQVWQETNVAPSNMPYVIVRESYINNSCLVDGLPNNEIRLITEKSCSPSHYKDERSWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0192964_101444723300018717MarineFWAGGLTIVGLKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0192866_104335323300018720MarineSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193038_101249313300018723MarineTCCLSDISVESCQGNDYYRRLIMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHYKDERSWRVEFSTESYSILNALEQIGYKVITSSSFVTGHKKFDTKDFIWTLYRPSKCDIEM
Ga0193115_103341813300018727MarineMPYLHRGESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193529_101308813300018731MarineFPQRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0192879_107163713300018736MarineGNHAVYHRQESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0192902_109324313300018752MarineWGSWCLFERPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193058_101511713300018758MarineHGESGSDSVPTSSRLVHQCMMPYLIVRESYINSYCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAVNLLNALEQIGYKVVTSSSYVTGPKKFDTKDFIWTLYRPSCEMEM
Ga0192827_109536923300018763MarineNSCVVDGLPSNEIRLITEKCSPSHYRDERHWRVEFSTEAFTLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0193478_104775323300018769MarineESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193530_108940713300018770MarineMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEAEMG
Ga0193530_109730923300018770MarineCARHVSRHGGQGIEVTMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193314_103208223300018771MarineVHVSRHGGTEGIEVTMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193314_103531223300018771MarineVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHYRDERSWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0192839_106869613300018777MarineMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193197_101850423300018783MarineLNGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193298_110206913300018784MarineQKRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193251_106798933300018789MarineMPYVIVRESYIQTSCMVDGLPLNEIRLLSEKASSPSDMRDEKNRRVEFATPSFNLLNALEQIGYRVVTSGAFVTGTKKFDTKDFVWTLHRPSNEIEQ
Ga0192956_106682913300018792MarineSYINNSCLVDGLPPNEVRLISEKSSSPSDFRDEKNRRVEFSTQAFNLLNALEQLGYKVVTSSSFVTGHKKFDSKDFIWTLYRPSSDIEI
Ga0192956_110376623300018792MarineCMVDGLPTNEVRLISEKSSSPSDLRDERNRRVEFSTQAFNLLNALEQLGYKVVTSSSFVTGPKRFDSKDFIWTLYRPSSDIEI
Ga0192956_113492313300018792MarineVGLKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0192956_114099113300018792MarineMPYLIVRESYLDCSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYKVVTSSSFVSGHKKFDTKDFVWTLYRSSYDKDIG
Ga0192956_114332323300018792MarineMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0192928_107613113300018793MarineMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFVSGQQKFSTKDFIWTLYRSSYEAEIWAETEGVSLFRRMCSVVCCSVFT
Ga0193357_104322023300018794MarineVVDGLPMNEVRLITEKSSSPSHLRDERNWRVEFSTEAFNLLNSLEQIGYKVVTSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193388_105853013300018802MarineMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSNYRDERSWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193329_104820613300018804MarineMPYVIVRESYINNSCVVDGLPSNEIRLITEKCSPSHYRDERHWRVEFSTEAFTLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0193329_105647223300018804MarineRESYINNSCVVDGLPSNEVRLITEKSCSPSHYKDERSWRVEFSTESYSILNALEQIGYKVITSSSFVTGHKKFDTKDFIWTLYRPSKCDIEM
Ga0192872_107959013300018813MarineIEVTMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193497_104521623300018819MarineMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHYRDERSWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193497_106280213300018819MarineGQGIEVTMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193497_108808413300018819MarineNKRHGCLVTPKSCPSSPLFFPKRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0192877_105400033300018834MarineYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEMEM
Ga0192927_102775813300018837MarineMPYIIVRESYINNRCVVDGLPSNEVRQISEKSSSPSSVRDERNSRIEFNTEACNLLNALEQLGYKVVTSSSFVTGPKKFDTKDLVWTLYRPSRCDIEM
Ga0192927_107536313300018837MarineESYLNSSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEAEMG
Ga0192927_107599313300018837MarineLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0192958_114630613300018853MarineTWGVRVRLLGWRSDNCGPRLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0193214_102259313300018854MarineASVSPGPVWGSWCLLERPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193214_108916923300018854MarineVRMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHYRDERSWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193199_105221613300018859MarineAESCQHPDHEPVEVKDAAGARIIFKMPYVIVRESYINNSCVVDGLPSNEIRLITEKCSPSHYRDERHWRVEFSTEAFTLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0193359_104890413300018865MarineMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLSALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193359_110350713300018865MarinePGPAAPTHDATSASTTMPYLILRESYINNTCVVDGLPMNEVRLITEKSSSPSHLRDERNWRVEFSTEAFNLLNSLEQIGYKVVTSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0192859_103320633300018867MarineARHVSRHGGQGIEVTMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193553_100338913300018873MarineTWGVRVRLSGWQSHFVGVQNNLASYSNFSDETFVYHKFQAMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNWRDERNWRVEFCTEAHNLLNALEQIGYKVVTSSSFVTGSKKFDTKDFIWTLYRPSKCDIEM
Ga0193553_101775713300018873MarineTWGVRVRLLGWQSHFVGVKNNFASYSNFSDETFVYHKFQAMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNWRDERNWRVEFCTEAHNLLNALEQIGYKVVTSSSFVTGSKKFDTKDFIWTLYRPSKCDIEM
Ga0193471_107683713300018882MarineMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193360_103023423300018887MarineGPVWGSWCLLERPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193360_113707313300018887MarineGPVWGSWCLLERPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0192965_101541513300018896MarineMPYLIVRESYIQTSCLVDGLPLNEVRLITEKSSSPSDLRDEKNRRVEFSTPAFNLLNALEQIGYKVISSSSFVTGPKKFDTKDFIWTLYRPSSEIEG
Ga0192965_103655513300018896MarineDFWAGGLTIVGLKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0193268_110582823300018898MarineMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNWRDERNWRVEFCTEAHNLLNALEQIGYKVVTSSSFVTGSKKFDTKDFVWTMYRPSKCDIEM
Ga0192862_114955713300018902MarineMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVITSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193279_103057023300018908MarineMPYVIVRESYINNSCLVDGLPLNEVRLITEKSCSPSQFRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0193176_1013460913300018912MarineMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVITSSSFISGQQKFSTKNFIWTLYRSSYEADMG
Ga0193536_112344113300018921MarineIAPKNLLQSASDRRCSRYGGTVTRKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193536_112666513300018921MarineVSRHGGQGIEVTMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0192921_1021716513300018929MarineYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193552_1016557823300018934MarineMPYIIVRESYISNRCVVDGLPSNEVRQISEKSSSPSSVRDERNSRIEFNTEACNLLNALEQLGYKVVTSSSFVTGPKKFDTKDFVWTLYRPSRCDIEM
Ga0193466_117013913300018935MarineLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193402_1012766323300018944MarineMLKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193066_1005046623300018947MarineKGQHLPNLCNRYLRTCCLSDISVESCQGNDYYRRLIMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHYKDERSWRVEFSTESYSILNALEQIGYKVITSSSFVTGHKKFDTKDFIWTLYRPSKCDIEM
Ga0192985_103762823300018948MarineWAGGLTIVGLKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0192892_1005130533300018950MarineHLGWQWKNIGLQIDCLKINRNNKQISSNETFGPQISFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0193567_1014578223300018953MarineRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0192919_119669113300018956MarineKRSGEYKARQNYNCPNQSNTARMPYLIVRESYINSSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEIEM
Ga0192919_121887413300018956MarineKRSGEYKARQNYNCPNQSNTARMPYLIVRESYINSSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEIEM
Ga0193528_1029844113300018957MarineSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEAEMG
Ga0192930_1014356723300018960MarineSPGPVWGSWCLFERPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193531_1003015023300018961MarineQRVASPGLIGGLGDLHSLKRPPPEMPYLIVRESYINSSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIE
Ga0193531_1004058913300018961MarinePACRLQGLLGGLGGLHSLKKAALYPEMPYLIVRESYINSSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193531_1012123923300018961MarineVRESYINNSCLVDGLPLNEVRLITEKSCSPSQYRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDLDM
Ga0193087_1006214313300018964MarineCCQSDISVESCQGNDYYRRLIMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHYRDERSWRVEFSTESYSILNALEQIGYKVITSSSFVTGHKKFDTKDFIWTLYRPSKCDIEM
Ga0193562_1010792623300018965MarineMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFSTPACNLLNALEQIGYKVITSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193006_1005101813300018975MarinePYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNWRDERNWRVEFCTEAHNLLNALEQIGYKVVTSSSFVTGSKKFDTKDFIWTLYRPSKCDIEM
Ga0193487_1000510213300018978MarineVSPGPVWGSWCLLERPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193487_1014857423300018978MarineMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193540_1001158513300018979MarineSASDRRCSRYGGTVTRKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193540_1022401913300018979MarineIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEAEMG
Ga0192947_1008886323300018982MarineTWGVRVRLLGWRSDNCGPRLIASKINIQSKQISSNETFRRHIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0192947_1008886413300018982MarineTWESGSDFWAGGLTIVGLKLIASKINIQSKQISSNETFRRHIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0193136_1018030613300018985MarinePAVRPRMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193136_1022912613300018985MarineSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193554_1026850813300018986MarineARARAARTTMPYLIVRESYLNSSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEAEMG
Ga0193188_1008295213300018987MarineGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193275_1001867123300018988MarineMSHQTTSTISPFQRPKPIWPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193275_1002631513300018988MarineMPYLIVRESYINSSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193275_1023701013300018988MarineMPYLIVRESYINSSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193030_1012193513300018989MarinePKNLLQSASDRRCSRYGGTVTRKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193030_1013860123300018989MarineRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193518_1007074813300018992MarineILSTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNYRDERNWRVEFCTEAHNLLNALEQIGYKVVTSSSFVTGSKKFDTKDFVWTMYRPSKCDIEM
Ga0192916_1012919313300018996MarineNNSCLVDGLPLNEVRLITEKSCSPSQYRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0192916_1020314113300018996MarineTWGVGCESSGHEEAVTSLYSTTTTTMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193257_1009912823300018997MarineVSRHGGTEGIEVTMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193444_1011009013300018998MarineLVTPKSCPSSTLLITQRCLRLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193444_1011463223300018998MarineSCPSSPLFFPQRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193514_1008051913300018999MarineVTNVVPPTMPYVIVRESYINNSCLVDGLPLNEVRLITEKSCSPSQYRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0193514_1013702813300018999MarineLEYTMPYIIVRESYISNRCVVDGLPSNEVRQISEKSSSPSSVRDERNSRIEFNTEACNLLNALEQLGYKVVTSSSFVTGPKKFDTKDFVWTLYRPSRCDIEM
Ga0193514_1013846813300018999MarineVVAELTMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193514_1027434623300018999MarineSYINNSCLVDGLPLNEVRLITEKSCSPSQYRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0193078_1013249513300019004MarineSSPAVSISMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193154_1002677413300019006MarineGEYIRASVRVRHLGWQWKNIGLQIDCLKINSNNKQISSNETFGPQISFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0193154_1008496913300019006MarineMPYVIVRESYINNSCLVDGLPNNEIRLITEKSCSPSHYKDERSWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193154_1015779823300019006MarineMGSQGQAAAGPAAPTHDATSASTTMPYLILRESYINNTCVVDGLPMNEVRLITEKSSSPSHLRDERNWRVEFSTEAFNLLNSLEQIGYKVVTSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193154_1029448713300019006MarineLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193196_1028986823300019007MarineNSCVVDGLPSNESCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193044_1016345523300019010MarineNNTCVVDGLPMNEVRLITEKSSSPSHLRDERNWRVEFSTEAFNLLNSLEQIGYKVVTSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0192926_1024673313300019011MarineMPYLIVRESYLNSSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEAEMG
Ga0193557_1013855813300019013MarineLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193557_1015113513300019013MarineMPCIIVRESYISNRCVVDGLPSNEVRQISEKSSSPSSVRDERNSRIEFNTEACNLLNALEQLGYKVVTSSSFVTGPKKFDTKDFVWTLYRPSRCDIEM
Ga0193094_1010563613300019016MarineVSPGPVWGSWCLLVRPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193555_1002857653300019019MarineSVSPGPVWGSWCLLERPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193555_1025841923300019019MarineLSPLTMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193538_1004030323300019020MarineLQGLVGGLGDLHSLKKAALFPEMPYLIVRESYINSSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193561_1014396123300019023MarineWVRSGQGGVTPHNELSVRNVSPTNMPYVIVRESYINNSCLVDGLPLNEIRLITEKSCSPSHYRDERSWRVEFSTESYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193561_1020274513300019023MarineAGPAAPTHDATSASTTMPYLILRESYINNTCVVDGLPMNEVRLITEKSSSPSHLRDERNWRVEFSTEAFNLLNSLEQIGYKVVTSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193561_1021972613300019023MarinePPHSAGRDRAGQGGMPYLILRESYLSTSCTVDGLPLNEVRTVTEKTSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVITSSSFVSGTQKFATKDFVWTLYRSSYEADMG
Ga0193449_1015511323300019028MarineVVDGLPSNEVRLITEKSCSPSHYKDERSWRVEFSTESYSILNALEQIGYKVITSSSFVTGHKKFDTKDFIWTLYRPSKCDIEM
Ga0192886_1015536513300019037MarineQGNDLVRARREQPRSMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0193558_1010732623300019038MarineVVDGLPSNEVRLITEKSCSPSHYRDERSWRVEFSTESYSILNALEQIGYKVITSSSFVTGHKKFDTKDFIWTLYRPSKCDIEM
Ga0192857_1007154133300019040MarineHGSQGQAAAGPAAPTHDATSASTTMPYLILRESYINNTCVVDGLPMNEVRLITEKSSSPSHLRDERNWRVEFSTEAFNLLNSLEQIGYKVVTSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193189_1005504733300019044MarineQRVARACVGSWCLLERPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0193189_1016745923300019044MarineNGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193336_1059126913300019045MarineRTRMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0192826_1010877613300019051MarineVTPKSCPSSPLFFPKRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193455_1004888313300019052MarineLGWQWKNIGLQIDCLKINRNNKQISSNETFGPQISFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0193356_1003970413300019053MarineMPYLILRESYINHSCIVDGLPLNEVRLITEKSSSPSNWRDERNWRVEFCTEAHNLLNALEQIGYKVVTSSSFVTGSKKFDTKDFIWTLYRPSKCDIEM
Ga0193356_1009160413300019053MarineVRESYINNTCLVDGLPLNEVRLITEKSCSPSQYRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIDM
Ga0193208_1011675233300019055MarineMPYVIVRESYINNSCLVDGLPNNEIRLITEKSCSPSHYKDERSWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193208_1029740313300019055MarineYIIVRESYISNRCVVDGLPSNEVRQISEKSSSPSSVRDERNSRIEFNTEACNLLNALEQLGYKVVTSSSFLTGPKKFDTKDFVWTLYRPSRCDIEM
Ga0193443_101182623300019115MarineMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNWRDERNWRVEFCTQAHNLLNALEQIGYKVVTSSSFVTGSKKFDTKDFIWTLYRPSKCDIEM
Ga0193256_105230813300019120MarineVSRGSRHVLRHVAMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEAEMG
Ga0193155_105636713300019121MarineHLNGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193144_111547513300019126MarineVTMPYIIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHFRDERHWRVEFSTEAYNLLNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDIEM
Ga0193202_101893813300019127MarineKRAGEYKARQNYNCPNQSNTARMPYLIVRESYINSSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPTCEIEM
Ga0193112_101586013300019136MarineQRCLWLVLTRYGGAVTAKMPYLIVRESYINSHCIVDGLPLNEIRLITEKSSSNTDLKDERNRRVEFATPACNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193216_1003432023300019138MarineNRYLRTCCLSDISVESCQGNDYYRRLIMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHYKDERSWRVEFSTESYSILNALEQIGYKVITSSSFVTGHKKFDTKDFIWTLYRPSKCDIEM
Ga0193216_1008392513300019138MarineMPYLIVRESYLNNSCLVDGLPLNEVRTVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVITSSSFISGQQKFSTKVNR
Ga0192856_104891423300019143MarineGLPMNEVRLITEKSSSPSHLRDERNWRVEFSTEAFNLLNSLEQIGYKVVTSSSFVTGHKKFDTKDYIWTLYRPNKCDIEM
Ga0193453_103228623300019147MarineMGLSKGQHLPNLCNRYLRTCCLSDISVESCQGNDYYRRLIMPYVIVRESYINNSCVVDGLPSNEVRLITEKSCSPSHYKDERSWRVEFSTESYSILNALEQIGYKVITSSSFVTGHKKFDTKDFIWTLYRPSKCDIEM
Ga0193564_1003962423300019152MarineVSPGPVWGSWCLLVRPPPEMPYLIVRESYINTSCLVDGLPLNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDYIWTLYRPSCEMEM
Ga0193564_1015533313300019152MarineVDGLPLNEVRSVTEKSSCPSDLRDEKNRRVEFSTPAYNLLNALEKIGYRVVTSSSFISGQQKFSTKDFIWTLYRSSYEADMG
Ga0063134_113651813300021928MarinePYVIVRESYINNSCLVDGLPLNEVRLITEKSCSPSQYRDERSWRLEFSTESYNILNALEQIGYKVITSSSFVTGHKKFDTKDYIWTLYRPSKCDLDM
Ga0247587_101711513300026504SeawaterVDGLPLNEIRLLSEKASSPSDMRDEKNRRVEFCTPSFNLLNALEQIGYRVVTSGSFVTGTKKFDTKDFVWTLHRPSNEIEQ
Ga0307388_1050327533300031522MarineGRPRRRIVTCRDCQNMPYLIVRESYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEMEM
Ga0307393_104585023300031674MarineVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0307393_110938823300031674MarineMPYLILRESYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEMEM
Ga0307385_1014678623300031709MarineGLTIVGLKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0307385_1041216713300031709MarinePAHLEAPGDPAPGPAGEAMPYLIVRESYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEMEM
Ga0307396_1009419213300031717MarineMPYLIVRESYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEMEM
Ga0307397_1060026713300031734MarineAPGPPGGPGDPAPGPAGEAMPYLILRESYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEMEM
Ga0307384_1008617033300031738MarineDTPPAHLEAPGDPAPGPAGEAMPYLILRESYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEMEM
Ga0307383_1020107513300031739MarineINRKYKQISSNETFRPQISFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0307383_1071803213300031739MarineMPYLIVRESYIQSSCLVDGLPLNEVRLITEKSSSPSDLRDEKNRRVEFSTPAFNLLNALEQIGYKVISSSSFVTGPKKFDTKDFIWTLYRPSSEIEG
Ga0307395_1017605913300031742MarineLTIVGLKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0307395_1030110413300031742MarinePPAHLEAPGDPAPGPAGEAMPYLILRESYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA
Ga0307382_1005232223300031743MarineLLGWRSDNCGPKLIASKINIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0307389_1007532023300031750MarineNIQSKQISSNETFRRQIYFTMPYLIVRESYINNSCIVDGLPLNEVRLITEKSSSPSNLRDERNWRVEFSTEAYNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSKCDIEM
Ga0314668_1029032923300032481SeawaterMPYIIVRESYIQTSCTVDGLPLNEIRLLSEKASSPSDMRDEKNRRVEFCTPSFNLLNALEQIGYRVVTSGAFVTGTKKFDTKDFVWTLHRPSNEIEQ
Ga0307390_1056314213300033572MarinePAHLEAPGDPAPGPAGEAMPYLILRESYINSSCLVDGLPPNEIRLITEKSSSPSDLRDERNRRVEFSTPAFNLLNALEQIGYKVVTSSSFVTGPKKFDTKDFIWTLYRPSCEIEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.