Basic Information | |
---|---|
Family ID | F029122 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 189 |
Average Sequence Length | 38 residues |
Representative Sequence | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRP |
Number of Associated Samples | 175 |
Number of Associated Scaffolds | 189 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.53 % |
% of genes near scaffold ends (potentially truncated) | 77.25 % |
% of genes from short scaffolds (< 2000 bps) | 84.66 % |
Associated GOLD sequencing projects | 164 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.942 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.809 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.455 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.439 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.57% β-sheet: 0.00% Coil/Unstructured: 91.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 189 Family Scaffolds |
---|---|---|
PF00665 | rve | 60.32 |
PF05035 | DGOK | 1.06 |
PF07883 | Cupin_2 | 0.53 |
PF05272 | VirE | 0.53 |
PF03626 | COX4_pro | 0.53 |
PF13458 | Peripla_BP_6 | 0.53 |
PF00196 | GerE | 0.53 |
PF00547 | Urease_gamma | 0.53 |
PF13607 | Succ_CoA_lig | 0.53 |
PF08450 | SGL | 0.53 |
PF01019 | G_glu_transpept | 0.53 |
PF00126 | HTH_1 | 0.53 |
PF00005 | ABC_tran | 0.53 |
PF01610 | DDE_Tnp_ISL3 | 0.53 |
PF00561 | Abhydrolase_1 | 0.53 |
COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
---|---|---|---|
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 60.32 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 60.32 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 60.32 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 60.32 |
COG3734 | 2-keto-3-deoxy-galactonokinase | Carbohydrate transport and metabolism [G] | 1.06 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.53 |
COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.53 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.53 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.53 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
COG5545 | Predicted P-loop ATPase and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.94 % |
Unclassified | root | N/A | 1.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908043|A2_c1_ConsensusfromContig56126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1628 | Open in IMG/M |
3300000712|JGI11925J11888_100062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1781 | Open in IMG/M |
3300000901|JGI12192J12874_100115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1772 | Open in IMG/M |
3300000907|JGI11871J12876_100132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1798 | Open in IMG/M |
3300000956|JGI10216J12902_101562441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 757 | Open in IMG/M |
3300001111|JGI12666J13322_100150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1313 | Open in IMG/M |
3300001120|JGI12137J13328_100163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1784 | Open in IMG/M |
3300001137|JGI12637J13337_1001104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2089 | Open in IMG/M |
3300001141|JGI12638J13249_100427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1368 | Open in IMG/M |
3300001143|JGI12687J13287_100173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1660 | Open in IMG/M |
3300001153|JGI12684J13248_100190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1239 | Open in IMG/M |
3300001154|JGI12636J13339_1017597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1036 | Open in IMG/M |
3300001155|JGI12625J13251_10135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1191 | Open in IMG/M |
3300001159|JGI12650J13346_1000299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1785 | Open in IMG/M |
3300001163|JGI12705J13279_100156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1329 | Open in IMG/M |
3300001170|JGI12704J13340_1005112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1270 | Open in IMG/M |
3300001527|A3513AW1_1041834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1761 | Open in IMG/M |
3300001527|A3513AW1_1161999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1541 | Open in IMG/M |
3300001545|JGI12630J15595_10013006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1798 | Open in IMG/M |
3300001546|JGI12659J15293_10019712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1784 | Open in IMG/M |
3300001661|JGI12053J15887_10033963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2868 | Open in IMG/M |
3300001661|JGI12053J15887_10109517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1488 | Open in IMG/M |
3300001686|C688J18823_10911643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
3300001867|JGI12627J18819_10029535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2263 | Open in IMG/M |
3300001867|JGI12627J18819_10115444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1104 | Open in IMG/M |
3300005552|Ga0066701_10782713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 569 | Open in IMG/M |
3300005591|Ga0070761_10071966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1962 | Open in IMG/M |
3300005938|Ga0066795_10085865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 934 | Open in IMG/M |
3300005950|Ga0066787_10005240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1948 | Open in IMG/M |
3300005994|Ga0066789_10000758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13597 | Open in IMG/M |
3300005994|Ga0066789_10054441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1748 | Open in IMG/M |
3300005995|Ga0066790_10457308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 545 | Open in IMG/M |
3300006354|Ga0075021_10355005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
3300006354|Ga0075021_10706211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
3300006574|Ga0074056_11774729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
3300006797|Ga0066659_10150896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1652 | Open in IMG/M |
3300007076|Ga0075435_101741477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 547 | Open in IMG/M |
3300007255|Ga0099791_10596348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 540 | Open in IMG/M |
3300007258|Ga0099793_10009624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3699 | Open in IMG/M |
3300008885|Ga0115910_159371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
3300009093|Ga0105240_10111904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3302 | Open in IMG/M |
3300009094|Ga0111539_11581118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
3300009098|Ga0105245_10346871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1470 | Open in IMG/M |
3300009101|Ga0105247_11010238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
3300009147|Ga0114129_12760688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
3300009633|Ga0116129_1211881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
3300009661|Ga0105858_1016232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1977 | Open in IMG/M |
3300009662|Ga0105856_1279891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
3300010039|Ga0126309_10635243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 677 | Open in IMG/M |
3300010048|Ga0126373_13170973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum → Bradyrhizobium japonicum SEMIA 5079 | 512 | Open in IMG/M |
3300011433|Ga0137443_1234506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 546 | Open in IMG/M |
3300012181|Ga0153922_1053965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 894 | Open in IMG/M |
3300012202|Ga0137363_10336932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1246 | Open in IMG/M |
3300012203|Ga0137399_10916280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 738 | Open in IMG/M |
3300012357|Ga0137384_11064700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 649 | Open in IMG/M |
3300012361|Ga0137360_10135909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1930 | Open in IMG/M |
3300012930|Ga0137407_11647046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
3300012944|Ga0137410_10412586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
3300014054|Ga0120135_1001041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2146 | Open in IMG/M |
3300014829|Ga0120104_1006968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1984 | Open in IMG/M |
3300014878|Ga0180065_1081196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 725 | Open in IMG/M |
3300015051|Ga0137414_1101437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 747 | Open in IMG/M |
3300015051|Ga0137414_1113681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1184 | Open in IMG/M |
3300015052|Ga0137411_1255708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
3300015054|Ga0137420_1064353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1779 | Open in IMG/M |
3300015068|Ga0167645_118305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 658 | Open in IMG/M |
3300015080|Ga0167639_1005337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1907 | Open in IMG/M |
3300015160|Ga0167642_1045351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 681 | Open in IMG/M |
3300015168|Ga0167631_1007707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1575 | Open in IMG/M |
3300015206|Ga0167644_1000232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 60834 | Open in IMG/M |
3300015241|Ga0137418_10924792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 639 | Open in IMG/M |
3300015373|Ga0132257_100620190 | Not Available | 1338 | Open in IMG/M |
3300015373|Ga0132257_104503232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
3300017974|Ga0187777_10369771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 988 | Open in IMG/M |
3300018027|Ga0184605_10035560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2074 | Open in IMG/M |
3300018422|Ga0190265_10342576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1579 | Open in IMG/M |
3300018468|Ga0066662_10114702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1949 | Open in IMG/M |
3300019869|Ga0193705_1030274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
3300019879|Ga0193723_1142399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
3300019882|Ga0193713_1022772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1852 | Open in IMG/M |
3300019886|Ga0193727_1032152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1791 | Open in IMG/M |
3300020004|Ga0193755_1030758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1777 | Open in IMG/M |
3300020081|Ga0206354_11322328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 894 | Open in IMG/M |
3300020140|Ga0179590_1013978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1790 | Open in IMG/M |
3300020582|Ga0210395_10672530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 775 | Open in IMG/M |
3300020583|Ga0210401_10230379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1711 | Open in IMG/M |
3300021086|Ga0179596_10128863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1183 | Open in IMG/M |
3300021168|Ga0210406_10175796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1786 | Open in IMG/M |
3300021170|Ga0210400_10075584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2642 | Open in IMG/M |
3300021171|Ga0210405_10156206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1806 | Open in IMG/M |
3300021181|Ga0210388_10437982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1149 | Open in IMG/M |
3300021363|Ga0193699_10057292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1517 | Open in IMG/M |
3300021405|Ga0210387_10055969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3186 | Open in IMG/M |
3300021475|Ga0210392_10290273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1169 | Open in IMG/M |
3300021477|Ga0210398_10165679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1799 | Open in IMG/M |
3300022561|Ga0212090_10817252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
3300023056|Ga0233357_1001254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1874 | Open in IMG/M |
3300024330|Ga0137417_1103020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
3300024330|Ga0137417_1280633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1257 | Open in IMG/M |
3300025509|Ga0208848_1008317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2143 | Open in IMG/M |
3300025900|Ga0207710_10434434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 676 | Open in IMG/M |
3300025905|Ga0207685_10398986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 705 | Open in IMG/M |
3300025910|Ga0207684_10831745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 779 | Open in IMG/M |
3300025912|Ga0207707_10205679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1716 | Open in IMG/M |
3300025921|Ga0207652_10104750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2502 | Open in IMG/M |
3300025928|Ga0207700_10154791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1898 | Open in IMG/M |
3300025928|Ga0207700_10507819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1067 | Open in IMG/M |
3300025944|Ga0207661_10189631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1801 | Open in IMG/M |
3300026214|Ga0209838_1005005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1858 | Open in IMG/M |
3300026220|Ga0209855_1008684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1811 | Open in IMG/M |
3300026221|Ga0209848_1011296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1779 | Open in IMG/M |
3300026274|Ga0209888_1011092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1812 | Open in IMG/M |
3300026291|Ga0209890_10012998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3354 | Open in IMG/M |
3300026291|Ga0209890_10024010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2365 | Open in IMG/M |
3300026291|Ga0209890_10030116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2079 | Open in IMG/M |
3300026291|Ga0209890_10141230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 806 | Open in IMG/M |
3300026294|Ga0209839_10039585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1748 | Open in IMG/M |
3300026355|Ga0257149_1011680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1145 | Open in IMG/M |
3300026361|Ga0257176_1000260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3049 | Open in IMG/M |
3300026369|Ga0257152_1002550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1799 | Open in IMG/M |
3300026376|Ga0257167_1001518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2279 | Open in IMG/M |
3300026475|Ga0257147_1003971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1759 | Open in IMG/M |
3300026475|Ga0257147_1010613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1215 | Open in IMG/M |
3300026480|Ga0257177_1036093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
3300026481|Ga0257155_1005920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1536 | Open in IMG/M |
3300026489|Ga0257160_1003134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1890 | Open in IMG/M |
3300026496|Ga0257157_1001642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3087 | Open in IMG/M |
3300026499|Ga0257181_1002928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1794 | Open in IMG/M |
3300026507|Ga0257165_1062639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 675 | Open in IMG/M |
3300026508|Ga0257161_1013778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1495 | Open in IMG/M |
3300026515|Ga0257158_1054434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 743 | Open in IMG/M |
3300026721|Ga0208841_100259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1351 | Open in IMG/M |
3300027002|Ga0209110_1028844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 663 | Open in IMG/M |
3300027257|Ga0208996_1003479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1668 | Open in IMG/M |
3300027504|Ga0209114_1054418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 706 | Open in IMG/M |
3300027512|Ga0209179_1106036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
3300027512|Ga0209179_1129023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
3300027546|Ga0208984_1008549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1913 | Open in IMG/M |
3300027559|Ga0209222_1010391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1896 | Open in IMG/M |
3300027575|Ga0209525_1103609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
3300027603|Ga0209331_1010663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2405 | Open in IMG/M |
3300027605|Ga0209329_1109043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
3300027633|Ga0208988_1157825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 543 | Open in IMG/M |
3300027651|Ga0209217_1130469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 704 | Open in IMG/M |
3300027655|Ga0209388_1033008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1485 | Open in IMG/M |
3300027674|Ga0209118_1009519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3371 | Open in IMG/M |
3300027684|Ga0209626_1014994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1806 | Open in IMG/M |
3300027698|Ga0209446_1020304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1648 | Open in IMG/M |
3300027768|Ga0209772_10025830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1685 | Open in IMG/M |
3300027795|Ga0209139_10054204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1407 | Open in IMG/M |
3300027862|Ga0209701_10682663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 532 | Open in IMG/M |
(restricted) 3300027872|Ga0255058_10414140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
3300027910|Ga0209583_10315130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 715 | Open in IMG/M |
3300027915|Ga0209069_10092723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1452 | Open in IMG/M |
(restricted) 3300027997|Ga0255057_10676968 | Not Available | 501 | Open in IMG/M |
3300028673|Ga0257175_1004919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1786 | Open in IMG/M |
3300028802|Ga0307503_10566948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
3300029951|Ga0311371_10395144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1884 | Open in IMG/M |
3300030520|Ga0311372_10494410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1799 | Open in IMG/M |
3300031253|Ga0307490_1000024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 97236 | Open in IMG/M |
3300031546|Ga0318538_10049947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2039 | Open in IMG/M |
3300031561|Ga0318528_10052890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2058 | Open in IMG/M |
3300031668|Ga0318542_10057821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1781 | Open in IMG/M |
3300031682|Ga0318560_10066601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1808 | Open in IMG/M |
3300031719|Ga0306917_10076737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2333 | Open in IMG/M |
3300031720|Ga0307469_10717772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 908 | Open in IMG/M |
3300031744|Ga0306918_10136003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1799 | Open in IMG/M |
3300031747|Ga0318502_10061266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2006 | Open in IMG/M |
3300031748|Ga0318492_10059463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1806 | Open in IMG/M |
3300031763|Ga0318537_10035214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1792 | Open in IMG/M |
3300031777|Ga0318543_10377716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 635 | Open in IMG/M |
3300031779|Ga0318566_10083809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1552 | Open in IMG/M |
3300031781|Ga0318547_10072795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1907 | Open in IMG/M |
3300031879|Ga0306919_10074515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2322 | Open in IMG/M |
3300031880|Ga0318544_10025680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2013 | Open in IMG/M |
3300031890|Ga0306925_12013002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 544 | Open in IMG/M |
3300031896|Ga0318551_10528790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 677 | Open in IMG/M |
3300031910|Ga0306923_12014574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 585 | Open in IMG/M |
3300031912|Ga0306921_10800502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
3300031941|Ga0310912_10130101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1883 | Open in IMG/M |
3300031942|Ga0310916_10167423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1823 | Open in IMG/M |
3300032035|Ga0310911_10629311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 622 | Open in IMG/M |
3300032041|Ga0318549_10045017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1802 | Open in IMG/M |
3300032059|Ga0318533_10090795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2099 | Open in IMG/M |
3300032076|Ga0306924_10304289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1829 | Open in IMG/M |
3300032089|Ga0318525_10061496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1875 | Open in IMG/M |
3300032094|Ga0318540_10173507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1036 | Open in IMG/M |
3300032180|Ga0307471_100810080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1103 | Open in IMG/M |
3300033289|Ga0310914_11702634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 534 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.81% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 16.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 5.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.65% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 2.65% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.12% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.12% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.59% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.59% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.59% |
Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.06% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.06% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.06% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.06% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.06% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.06% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.06% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.53% |
Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.53% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.53% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.53% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.53% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.53% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.53% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.53% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.53% |
Chlorella Sacherophilia (Mzch 10155) Associated | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Chlorella Sacherophilia (Mzch 10155) Associated | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
3300000712 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 | Environmental | Open in IMG/M |
3300000901 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 | Environmental | Open in IMG/M |
3300000907 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001111 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 | Environmental | Open in IMG/M |
3300001120 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 | Environmental | Open in IMG/M |
3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
3300001141 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 | Environmental | Open in IMG/M |
3300001143 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 | Environmental | Open in IMG/M |
3300001153 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001155 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 | Environmental | Open in IMG/M |
3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
3300001163 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 | Environmental | Open in IMG/M |
3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
3300001527 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300008885 | Microbial communities associated with green microalga Chlorella saccharophila, Germany - (MZCH: 10155) | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015068 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015160 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
3300026220 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes) | Environmental | Open in IMG/M |
3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
3300026274 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 (SPAdes) | Environmental | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026721 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN395 (SPAdes) | Environmental | Open in IMG/M |
3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027997 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6 | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031253 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3U | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
A2_c1_00040930 | 2124908043 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRP |
JGI11925J11888_1000622 | 3300000712 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSIA |
JGI12192J12874_1001152 | 3300000901 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPF |
JGI11871J12876_1001321 | 3300000907 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSTVRQI |
JGI10216J12902_1015624412 | 3300000956 | Soil | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRGSNLQAD* |
JGI12666J13322_1001501 | 3300001111 | Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRRPTQIWV |
JGI12137J13328_1001632 | 3300001120 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSTAR |
JGI12637J13337_10011042 | 3300001137 | Forest Soil | MLIRPAIGDTDPIRYGRPTPDGQFSGNIIDEAMRPSVVW* |
JGI12638J13249_1004271 | 3300001141 | Forest Soil | MLIRPAIDDTDPIRHRRPTPDGQFSGNIIDEAMRP |
JGI12687J13287_1001732 | 3300001143 | Forest Soil | MLIRPAIDDTDPIRHRRPTPDGQFSGNIIDEAMRGQ |
JGI12684J13248_1001902 | 3300001153 | Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRP |
JGI12636J13339_10175972 | 3300001154 | Forest Soil | MLIRPAIGDTDPIRYRCPTPDGQFSGNIIDEAMRP |
JGI12625J13251_101351 | 3300001155 | Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPTIAW* |
JGI12650J13346_10002991 | 3300001159 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSDM |
JGI12705J13279_1001561 | 3300001163 | Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRG |
JGI12704J13340_10051122 | 3300001170 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPS |
A3513AW1_10418342 | 3300001527 | Permafrost | MLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRP |
A3513AW1_11619992 | 3300001527 | Permafrost | MLIRPAIGDTDPIRYRRHTPDGQFSGNIIDEAMRP* |
JGI12630J15595_100130062 | 3300001545 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPCRKWPSFR |
JGI12659J15293_100197121 | 3300001546 | Forest Soil | MLIRPVIGDTDPIRSRRPTPDGQFSGNIIDEAMRPS |
JGI12053J15887_100339632 | 3300001661 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDSQFSGNIIDEAMRP* |
JGI12053J15887_101095171 | 3300001661 | Forest Soil | MLIRPAIGDTDPIRYRCSTPDGQFSGNILDEAMRPCSF |
C688J18823_109116431 | 3300001686 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPRC |
JGI12627J18819_100295351 | 3300001867 | Forest Soil | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRRAK |
JGI12627J18819_101154441 | 3300001867 | Forest Soil | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRRAKE |
Ga0066701_107827131 | 3300005552 | Soil | MLICPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPSIA* |
Ga0070761_100719662 | 3300005591 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPAQRRNLQ* |
Ga0066795_100858652 | 3300005938 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPS |
Ga0066787_100052401 | 3300005950 | Soil | MLICPAIGDTDPIRYRRPTPDSQFSGNIFDEAMRPSIA* |
Ga0066789_1000075816 | 3300005994 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSTEVDQ* |
Ga0066789_100544411 | 3300005994 | Soil | RRVPMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPPLV* |
Ga0066790_104573081 | 3300005995 | Soil | RRVPMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRLPPPPSLGRL* |
Ga0075021_103550052 | 3300006354 | Watersheds | MLICPAIGDTDPIRYRRPTPGGQFSGNIFDEAMRP |
Ga0075021_107062112 | 3300006354 | Watersheds | MLIRPAIGDTDLIRCPCHSPGGHSSGNILSEAMRP |
Ga0074056_117747291 | 3300006574 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRSDSLLVQ |
Ga0066659_101508961 | 3300006797 | Soil | MLIGPAIGDTDPIRYRRPTLDGQFSGNILDEAMRP* |
Ga0075435_1017414772 | 3300007076 | Populus Rhizosphere | MLIRPAIGDTEPIRYRCPNPDGQFSGNILDEAMR* |
Ga0099791_105963481 | 3300007255 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPLSRGIGV |
Ga0099793_100096245 | 3300007258 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNNLDEAMRPPSNLQAD* |
Ga0115910_1593711 | 3300008885 | Chlorella Sacherophilia (Mzch 10155) Associated | MLIRPAISDTDPIRHRRPTPDGQFSGNIIDEAMRPFARRG |
Ga0105240_101119045 | 3300009093 | Corn Rhizosphere | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRP |
Ga0111539_115811181 | 3300009094 | Populus Rhizosphere | MLIRPAIGDTEPIRYRCPNPDGQFSGNILDEAMRP |
Ga0105245_103468712 | 3300009098 | Miscanthus Rhizosphere | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRQSKNHRG |
Ga0105247_110102382 | 3300009101 | Switchgrass Rhizosphere | MLIRPAIGETDPIRYRRSNPDGQFSGNILDEAMRGSNLNAD* |
Ga0114129_127606882 | 3300009147 | Populus Rhizosphere | MLIRPAIGDTDPIRYRRPTPGGQFSGNIFDDAMR* |
Ga0116129_12118812 | 3300009633 | Peatland | MLIRPAIGDTDPIRYRRPNPDGQFSGNIIDEAMRP* |
Ga0105858_10162321 | 3300009661 | Permafrost Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPFGRRLPPIDPKMAI |
Ga0105856_12798912 | 3300009662 | Permafrost Soil | MLICPAIGDTDPILYRRPTPDSQFSGNIFDDAMRPDR |
Ga0126309_106352431 | 3300010039 | Serpentine Soil | MLICPAIGGTDPIRYRRPTPDGQFSGNIFDEAMRPSIA* |
Ga0126373_131709731 | 3300010048 | Tropical Forest Soil | PMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRP* |
Ga0137443_12345061 | 3300011433 | Soil | MLICPAIGDTDPIRYHRPTPDGQFSGNIFYEAMRGHF |
Ga0153922_10539651 | 3300012181 | Attine Ant Fungus Gardens | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRP* |
Ga0137363_103369322 | 3300012202 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPRQI* |
Ga0137399_109162802 | 3300012203 | Vadose Zone Soil | PAIGDTDPIRYRRPTPDDQFSGNILDEAMRPSIAW* |
Ga0137384_110647001 | 3300012357 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRP |
Ga0137360_101359091 | 3300012361 | Vadose Zone Soil | MLIRPAIRDTDPIRYRRPTPDGQFSGNIIDEAMRSVSASNI |
Ga0137407_116470462 | 3300012930 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPSIA* |
Ga0137410_104125862 | 3300012944 | Vadose Zone Soil | PMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPSIAW* |
Ga0120135_10010413 | 3300014054 | Permafrost | MLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRL* |
Ga0120104_10069683 | 3300014829 | Permafrost | MLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRGRMTIWSASGAN |
Ga0180065_10811961 | 3300014878 | Soil | MLICPAIGDTDPIRYRRPTPDGQFFGNIFDEAMRP |
Ga0137414_11014371 | 3300015051 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPFRRPAMRP |
Ga0137414_11136812 | 3300015051 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRAGQ |
Ga0137411_12557081 | 3300015052 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAVTFLMRQC |
Ga0137420_10643531 | 3300015054 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRDEAMR |
Ga0167645_1183052 | 3300015068 | Glacier Forefield Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRLCVPKT* |
Ga0167639_10053371 | 3300015080 | Glacier Forefield Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPRAAP |
Ga0167642_10453511 | 3300015160 | Glacier Forefield Soil | MLICPAIGDTDPIRYRRPTLGGQFSGNIFDEAMRPSIA* |
Ga0167631_10077071 | 3300015168 | Glacier Forefield Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPFE |
Ga0167644_100023240 | 3300015206 | Glacier Forefield Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPRDRLIDQWCK* |
Ga0137418_109247921 | 3300015241 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPAS |
Ga0132257_1006201901 | 3300015373 | Arabidopsis Rhizosphere | LICPAIGDADPIRYRRPTPDGQFSGNIFDEAMRPAP* |
Ga0132257_1045032321 | 3300015373 | Arabidopsis Rhizosphere | MLIRPAIGDTDPIRYRRPTPDGQFSGNIPDEAMRG |
Ga0187777_103697712 | 3300017974 | Tropical Peatland | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRPFD |
Ga0184605_100355602 | 3300018027 | Groundwater Sediment | MLICPAIGDTDPIRYRRPTPGGQFSGNIFDEAMRPSIA |
Ga0190265_103425762 | 3300018422 | Soil | MLICPAIGDTDPIRYHRPTPDSQFSGNIFDEAMRT |
Ga0066662_101147021 | 3300018468 | Grasslands Soil | MLIGPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPSTA |
Ga0193705_10302741 | 3300019869 | Soil | MLICPAIRDTDPIRYRRPTPGGQFSGNIFDEAMRV |
Ga0193723_11423991 | 3300019879 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPL |
Ga0193713_10227721 | 3300019882 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPP |
Ga0193727_10321521 | 3300019886 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPSI |
Ga0193755_10307582 | 3300020004 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPPA |
Ga0206354_113223281 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRPAAQI |
Ga0179590_10139781 | 3300020140 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRSSEL |
Ga0210395_106725301 | 3300020582 | Soil | MLIRPVIGDTDPIRSRRPTPDGQFSGNIIDEAMRPAQRRNLQ |
Ga0210401_102303791 | 3300020583 | Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPPS |
Ga0179596_101288631 | 3300021086 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRSPDHRRREVFE |
Ga0210406_101757961 | 3300021168 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRVPVN |
Ga0210400_100755844 | 3300021170 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIGEAMRPST |
Ga0210405_101562061 | 3300021171 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIGEAMRPRAAPE |
Ga0210388_104379821 | 3300021181 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRVWAAAFGG |
Ga0193699_100572922 | 3300021363 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPPSLG |
Ga0210387_100559696 | 3300021405 | Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPASLN |
Ga0210392_102902731 | 3300021475 | Soil | MLIRPAISDTDPIRYRRPTPDGQFSGNIIDEAMRPTRDLGG |
Ga0210398_101656791 | 3300021477 | Soil | MLIRPVIGDTDPIRSRRPTPDGQFSGNIIDEAMRGVKLG |
Ga0212090_108172522 | 3300022561 | Glacier Valley | MLIRPAIGETDPIRYRRHTPDGQFSGNIIDEAMRRANKPR |
Ga0233357_10012543 | 3300023056 | Soil | MLIRPAIGDTDPIRYGRPTPDGQFSGNIIDEAMRPFT |
Ga0137417_11030201 | 3300024330 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRIRYRRPTPDGQFSGNIIDEAM |
Ga0137417_12806332 | 3300024330 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRP |
Ga0208848_10083172 | 3300025509 | Arctic Peat Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRANRL |
Ga0207710_104344342 | 3300025900 | Switchgrass Rhizosphere | MLIRPAIGETDPIRYRRSNPDGQFSGNILDEAMRGSNLNAD |
Ga0207685_103989861 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIRPAIGETDPIRYRRSNPDGQFSGNILDEAMRPA |
Ga0207684_108317451 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIRPAIDDTDPIRYRRPTPDGQFSGNIFDEAMRGSILQAE |
Ga0207707_102056792 | 3300025912 | Corn Rhizosphere | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRLTKAALSFAGR |
Ga0207652_101047503 | 3300025921 | Corn Rhizosphere | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRLQF |
Ga0207700_101547911 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIRPAIGETDPIRYRRSNPDGQFSGNILDEAMRPADRHPK |
Ga0207700_105078191 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIRPAIGDTDPIRCRRPNPDGQFSGNILDEAMRGVNIAG |
Ga0207661_101896311 | 3300025944 | Corn Rhizosphere | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRPRRHPD |
Ga0209838_10050051 | 3300026214 | Soil | MLICPAIGDTDPIRYRRPTPDSQFSGNIFDEAMRPSIA |
Ga0209855_10086841 | 3300026220 | Permafrost Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSSNQA |
Ga0209848_10112961 | 3300026221 | Permafrost Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRR |
Ga0209888_10110921 | 3300026274 | Permafrost Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRRVSAFKY |
Ga0209890_100129981 | 3300026291 | Soil | RPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSRIAQTSVEL |
Ga0209890_100240101 | 3300026291 | Soil | PAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSITW |
Ga0209890_100301161 | 3300026291 | Soil | RPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPPLV |
Ga0209890_101412301 | 3300026291 | Soil | IRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPFGRRLPPIDPKMAI |
Ga0209839_100395851 | 3300026294 | Soil | MLICPAIGDTDPIRYRRPTPDSQFSGNIFDEAMRG |
Ga0257149_10116802 | 3300026355 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRR |
Ga0257176_10002603 | 3300026361 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPGRRAA |
Ga0257152_10025502 | 3300026369 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPA |
Ga0257167_10015181 | 3300026376 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPS |
Ga0257147_10039711 | 3300026475 | Soil | MLIRPAIRDTDPIRYRRPTPDGQFSGNIIDEAMRVNIAGR |
Ga0257147_10106131 | 3300026475 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPST |
Ga0257177_10360931 | 3300026480 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPSA |
Ga0257155_10059201 | 3300026481 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRGSNLNA |
Ga0257160_10031343 | 3300026489 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRG |
Ga0257157_10016421 | 3300026496 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSTA |
Ga0257181_10029281 | 3300026499 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPF |
Ga0257165_10626391 | 3300026507 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPLQV |
Ga0257161_10137781 | 3300026508 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPLERRVL |
Ga0257158_10544342 | 3300026515 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRG |
Ga0208841_1002591 | 3300026721 | Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPP |
Ga0209110_10288441 | 3300027002 | Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPFTA |
Ga0208996_10034791 | 3300027257 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRYRNGLCRHYV |
Ga0209114_10544182 | 3300027504 | Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPSYCLT |
Ga0209179_11060361 | 3300027512 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPG |
Ga0209179_11290232 | 3300027512 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPLQVGLLRCL |
Ga0208984_10085491 | 3300027546 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDSQFSGNIIDEAMRAHNLAKLATAR |
Ga0209222_10103911 | 3300027559 | Forest Soil | MLIRPAIGDTDLIRYRRPTPDGQFSGNIIDEAMRPSIVW |
Ga0209525_11036091 | 3300027575 | Forest Soil | MLIRPAIGDTDPIRYRRHTPDGQFSGNIIDEAMRPG |
Ga0209331_10106631 | 3300027603 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPTIAW |
Ga0209329_11090432 | 3300027605 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPFGRRVL |
Ga0208988_11578251 | 3300027633 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRVNFGRRSPGLGGQ |
Ga0209217_11304692 | 3300027651 | Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPALAPIGRLKSAV |
Ga0209388_10330081 | 3300027655 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPLFFSKIV |
Ga0209118_10095192 | 3300027674 | Forest Soil | MLICPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPSIA |
Ga0209626_10149942 | 3300027684 | Forest Soil | MLIRPAIGDTDPIRYGRPTPDGQFSGNIIDEAMRPFGRR |
Ga0209446_10203041 | 3300027698 | Bog Forest Soil | MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRLHRLAT |
Ga0209772_100258302 | 3300027768 | Bog Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPVRRQNLE |
Ga0209139_100542042 | 3300027795 | Bog Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRGSILDADP |
Ga0209701_106826631 | 3300027862 | Vadose Zone Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRGAGVNLRSRNTVQV |
(restricted) Ga0255058_104141402 | 3300027872 | Seawater | MLICPAIGDTDPIRCRRPSHGSQFSGNILDEAMRLIVGTD |
Ga0209583_103151301 | 3300027910 | Watersheds | MLICPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPRSAS |
Ga0209069_100927231 | 3300027915 | Watersheds | MLICPAIDDTDLIRYRRPTPDGQSSGNIFGEAMRP |
(restricted) Ga0255057_106769681 | 3300027997 | Seawater | MLICPAIGDTDPIRCRRPSHGSQFSGNILDEAMRPLPVANNFHW |
Ga0257175_10049191 | 3300028673 | Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPASR |
Ga0307503_105669482 | 3300028802 | Soil | MLICPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRHR |
Ga0311371_103951443 | 3300029951 | Palsa | MLIRPAIGDTDPIRYRRHTPDGQFSGNIIDEAMRPL |
Ga0311372_104944102 | 3300030520 | Palsa | MLIRPAIGDTDPIRYRRHTPDGQFSGNIIDEAMRS |
Ga0307490_10000242 | 3300031253 | Sea-Ice Brine | MLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRSSRFESMRHCWR |
Ga0318538_100499471 | 3300031546 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRGSKLHAE |
Ga0318528_100528901 | 3300031561 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRC |
Ga0318542_100578212 | 3300031668 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRGSK |
Ga0318560_100666012 | 3300031682 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPIGVALKCRGTASL |
Ga0306917_100767372 | 3300031719 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRSGALLV |
Ga0307469_107177722 | 3300031720 | Hardwood Forest Soil | MLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPSTACKIN |
Ga0306918_101360032 | 3300031744 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRP |
Ga0318502_100612662 | 3300031747 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRRSA |
Ga0318492_100594632 | 3300031748 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRG |
Ga0318537_100352142 | 3300031763 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPPYCLI |
Ga0318543_103777161 | 3300031777 | Soil | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRS |
Ga0318566_100838091 | 3300031779 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPIGVA |
Ga0318547_100727951 | 3300031781 | Soil | SSRRAPMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRP |
Ga0306919_100745153 | 3300031879 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRGSKLHA |
Ga0318544_100256803 | 3300031880 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPLQI |
Ga0306925_120130022 | 3300031890 | Soil | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAPRCFRT |
Ga0318551_105287902 | 3300031896 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPPYCL |
Ga0306923_120145742 | 3300031910 | Soil | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRSGALLV |
Ga0306921_108005021 | 3300031912 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRRQILVGHD |
Ga0310912_101301013 | 3300031941 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRGVNF |
Ga0310916_101674232 | 3300031942 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPSYCLI |
Ga0310911_106293111 | 3300032035 | Soil | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRERLV |
Ga0318549_100450172 | 3300032041 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPLM |
Ga0318533_100907951 | 3300032059 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPFRLPTLG |
Ga0306924_103042892 | 3300032076 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPLSRG |
Ga0318525_100614963 | 3300032089 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRYW |
Ga0318540_101735071 | 3300032094 | Soil | MLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRWIERVTPGSMALL |
Ga0307471_1008100802 | 3300032180 | Hardwood Forest Soil | MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRDASDP |
Ga0310914_117026341 | 3300033289 | Soil | MLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRPLSCG |
⦗Top⦘ |