NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029122

Metagenome / Metatranscriptome Family F029122

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029122
Family Type Metagenome / Metatranscriptome
Number of Sequences 189
Average Sequence Length 38 residues
Representative Sequence MLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRP
Number of Associated Samples 175
Number of Associated Scaffolds 189

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.53 %
% of genes near scaffold ends (potentially truncated) 77.25 %
% of genes from short scaffolds (< 2000 bps) 84.66 %
Associated GOLD sequencing projects 164
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.942 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.809 % of family members)
Environment Ontology (ENVO) Unclassified
(26.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.439 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.57%    β-sheet: 0.00%    Coil/Unstructured: 91.43%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 189 Family Scaffolds
PF00665rve 60.32
PF05035DGOK 1.06
PF07883Cupin_2 0.53
PF05272VirE 0.53
PF03626COX4_pro 0.53
PF13458Peripla_BP_6 0.53
PF00196GerE 0.53
PF00547Urease_gamma 0.53
PF13607Succ_CoA_lig 0.53
PF08450SGL 0.53
PF01019G_glu_transpept 0.53
PF00126HTH_1 0.53
PF00005ABC_tran 0.53
PF01610DDE_Tnp_ISL3 0.53
PF00561Abhydrolase_1 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 189 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 60.32
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 60.32
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 60.32
COG4584TransposaseMobilome: prophages, transposons [X] 60.32
COG37342-keto-3-deoxy-galactonokinaseCarbohydrate transport and metabolism [G] 1.06
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.53
COG3125Heme/copper-type cytochrome/quinol oxidase, subunit 4Energy production and conversion [C] 0.53
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.53
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.53
COG3464TransposaseMobilome: prophages, transposons [X] 0.53
COG5545Predicted P-loop ATPase and inactivated derivativesMobilome: prophages, transposons [X] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.94 %
UnclassifiedrootN/A1.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908043|A2_c1_ConsensusfromContig56126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1628Open in IMG/M
3300000712|JGI11925J11888_100062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1781Open in IMG/M
3300000901|JGI12192J12874_100115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1772Open in IMG/M
3300000907|JGI11871J12876_100132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1798Open in IMG/M
3300000956|JGI10216J12902_101562441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium757Open in IMG/M
3300001111|JGI12666J13322_100150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1313Open in IMG/M
3300001120|JGI12137J13328_100163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1784Open in IMG/M
3300001137|JGI12637J13337_1001104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2089Open in IMG/M
3300001141|JGI12638J13249_100427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1368Open in IMG/M
3300001143|JGI12687J13287_100173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1660Open in IMG/M
3300001153|JGI12684J13248_100190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1239Open in IMG/M
3300001154|JGI12636J13339_1017597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1036Open in IMG/M
3300001155|JGI12625J13251_10135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1191Open in IMG/M
3300001159|JGI12650J13346_1000299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1785Open in IMG/M
3300001163|JGI12705J13279_100156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1329Open in IMG/M
3300001170|JGI12704J13340_1005112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1270Open in IMG/M
3300001527|A3513AW1_1041834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1761Open in IMG/M
3300001527|A3513AW1_1161999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1541Open in IMG/M
3300001545|JGI12630J15595_10013006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1798Open in IMG/M
3300001546|JGI12659J15293_10019712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1784Open in IMG/M
3300001661|JGI12053J15887_10033963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2868Open in IMG/M
3300001661|JGI12053J15887_10109517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1488Open in IMG/M
3300001686|C688J18823_10911643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales558Open in IMG/M
3300001867|JGI12627J18819_10029535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2263Open in IMG/M
3300001867|JGI12627J18819_10115444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1104Open in IMG/M
3300005552|Ga0066701_10782713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium569Open in IMG/M
3300005591|Ga0070761_10071966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1962Open in IMG/M
3300005938|Ga0066795_10085865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria934Open in IMG/M
3300005950|Ga0066787_10005240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1948Open in IMG/M
3300005994|Ga0066789_10000758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales13597Open in IMG/M
3300005994|Ga0066789_10054441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1748Open in IMG/M
3300005995|Ga0066790_10457308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium545Open in IMG/M
3300006354|Ga0075021_10355005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria915Open in IMG/M
3300006354|Ga0075021_10706211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300006574|Ga0074056_11774729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria612Open in IMG/M
3300006797|Ga0066659_10150896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1652Open in IMG/M
3300007076|Ga0075435_101741477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales547Open in IMG/M
3300007255|Ga0099791_10596348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium540Open in IMG/M
3300007258|Ga0099793_10009624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3699Open in IMG/M
3300008885|Ga0115910_159371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria697Open in IMG/M
3300009093|Ga0105240_10111904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3302Open in IMG/M
3300009094|Ga0111539_11581118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria760Open in IMG/M
3300009098|Ga0105245_10346871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1470Open in IMG/M
3300009101|Ga0105247_11010238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria650Open in IMG/M
3300009147|Ga0114129_12760688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300009633|Ga0116129_1211881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales550Open in IMG/M
3300009661|Ga0105858_1016232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1977Open in IMG/M
3300009662|Ga0105856_1279891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300010039|Ga0126309_10635243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium677Open in IMG/M
3300010048|Ga0126373_13170973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum → Bradyrhizobium japonicum SEMIA 5079512Open in IMG/M
3300011433|Ga0137443_1234506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium546Open in IMG/M
3300012181|Ga0153922_1053965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria894Open in IMG/M
3300012202|Ga0137363_10336932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1246Open in IMG/M
3300012203|Ga0137399_10916280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium738Open in IMG/M
3300012357|Ga0137384_11064700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium649Open in IMG/M
3300012361|Ga0137360_10135909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1930Open in IMG/M
3300012930|Ga0137407_11647046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria611Open in IMG/M
3300012944|Ga0137410_10412586All Organisms → cellular organisms → Bacteria → Proteobacteria1090Open in IMG/M
3300014054|Ga0120135_1001041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2146Open in IMG/M
3300014829|Ga0120104_1006968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1984Open in IMG/M
3300014878|Ga0180065_1081196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium725Open in IMG/M
3300015051|Ga0137414_1101437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium747Open in IMG/M
3300015051|Ga0137414_1113681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1184Open in IMG/M
3300015052|Ga0137411_1255708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300015054|Ga0137420_1064353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1779Open in IMG/M
3300015068|Ga0167645_118305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales658Open in IMG/M
3300015080|Ga0167639_1005337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1907Open in IMG/M
3300015160|Ga0167642_1045351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium681Open in IMG/M
3300015168|Ga0167631_1007707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1575Open in IMG/M
3300015206|Ga0167644_1000232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales60834Open in IMG/M
3300015241|Ga0137418_10924792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales639Open in IMG/M
3300015373|Ga0132257_100620190Not Available1338Open in IMG/M
3300015373|Ga0132257_104503232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium507Open in IMG/M
3300017974|Ga0187777_10369771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium988Open in IMG/M
3300018027|Ga0184605_10035560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2074Open in IMG/M
3300018422|Ga0190265_10342576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1579Open in IMG/M
3300018468|Ga0066662_10114702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1949Open in IMG/M
3300019869|Ga0193705_1030274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1164Open in IMG/M
3300019879|Ga0193723_1142399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300019882|Ga0193713_1022772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1852Open in IMG/M
3300019886|Ga0193727_1032152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1791Open in IMG/M
3300020004|Ga0193755_1030758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1777Open in IMG/M
3300020081|Ga0206354_11322328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria894Open in IMG/M
3300020140|Ga0179590_1013978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1790Open in IMG/M
3300020582|Ga0210395_10672530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium775Open in IMG/M
3300020583|Ga0210401_10230379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1711Open in IMG/M
3300021086|Ga0179596_10128863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1183Open in IMG/M
3300021168|Ga0210406_10175796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1786Open in IMG/M
3300021170|Ga0210400_10075584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2642Open in IMG/M
3300021171|Ga0210405_10156206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1806Open in IMG/M
3300021181|Ga0210388_10437982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1149Open in IMG/M
3300021363|Ga0193699_10057292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1517Open in IMG/M
3300021405|Ga0210387_10055969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3186Open in IMG/M
3300021475|Ga0210392_10290273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1169Open in IMG/M
3300021477|Ga0210398_10165679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1799Open in IMG/M
3300022561|Ga0212090_10817252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300023056|Ga0233357_1001254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1874Open in IMG/M
3300024330|Ga0137417_1103020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria647Open in IMG/M
3300024330|Ga0137417_1280633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1257Open in IMG/M
3300025509|Ga0208848_1008317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2143Open in IMG/M
3300025900|Ga0207710_10434434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales676Open in IMG/M
3300025905|Ga0207685_10398986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium705Open in IMG/M
3300025910|Ga0207684_10831745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium779Open in IMG/M
3300025912|Ga0207707_10205679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1716Open in IMG/M
3300025921|Ga0207652_10104750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2502Open in IMG/M
3300025928|Ga0207700_10154791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1898Open in IMG/M
3300025928|Ga0207700_10507819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1067Open in IMG/M
3300025944|Ga0207661_10189631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1801Open in IMG/M
3300026214|Ga0209838_1005005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1858Open in IMG/M
3300026220|Ga0209855_1008684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1811Open in IMG/M
3300026221|Ga0209848_1011296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1779Open in IMG/M
3300026274|Ga0209888_1011092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1812Open in IMG/M
3300026291|Ga0209890_10012998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3354Open in IMG/M
3300026291|Ga0209890_10024010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2365Open in IMG/M
3300026291|Ga0209890_10030116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2079Open in IMG/M
3300026291|Ga0209890_10141230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium806Open in IMG/M
3300026294|Ga0209839_10039585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1748Open in IMG/M
3300026355|Ga0257149_1011680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1145Open in IMG/M
3300026361|Ga0257176_1000260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3049Open in IMG/M
3300026369|Ga0257152_1002550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1799Open in IMG/M
3300026376|Ga0257167_1001518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2279Open in IMG/M
3300026475|Ga0257147_1003971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1759Open in IMG/M
3300026475|Ga0257147_1010613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1215Open in IMG/M
3300026480|Ga0257177_1036093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300026481|Ga0257155_1005920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1536Open in IMG/M
3300026489|Ga0257160_1003134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1890Open in IMG/M
3300026496|Ga0257157_1001642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3087Open in IMG/M
3300026499|Ga0257181_1002928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1794Open in IMG/M
3300026507|Ga0257165_1062639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales675Open in IMG/M
3300026508|Ga0257161_1013778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1495Open in IMG/M
3300026515|Ga0257158_1054434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria743Open in IMG/M
3300026721|Ga0208841_100259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1351Open in IMG/M
3300027002|Ga0209110_1028844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales663Open in IMG/M
3300027257|Ga0208996_1003479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1668Open in IMG/M
3300027504|Ga0209114_1054418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales706Open in IMG/M
3300027512|Ga0209179_1106036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria627Open in IMG/M
3300027512|Ga0209179_1129023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
3300027546|Ga0208984_1008549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1913Open in IMG/M
3300027559|Ga0209222_1010391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1896Open in IMG/M
3300027575|Ga0209525_1103609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria671Open in IMG/M
3300027603|Ga0209331_1010663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2405Open in IMG/M
3300027605|Ga0209329_1109043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
3300027633|Ga0208988_1157825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium543Open in IMG/M
3300027651|Ga0209217_1130469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales704Open in IMG/M
3300027655|Ga0209388_1033008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1485Open in IMG/M
3300027674|Ga0209118_1009519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3371Open in IMG/M
3300027684|Ga0209626_1014994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1806Open in IMG/M
3300027698|Ga0209446_1020304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1648Open in IMG/M
3300027768|Ga0209772_10025830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1685Open in IMG/M
3300027795|Ga0209139_10054204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1407Open in IMG/M
3300027862|Ga0209701_10682663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium532Open in IMG/M
(restricted) 3300027872|Ga0255058_10414140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria654Open in IMG/M
3300027910|Ga0209583_10315130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium715Open in IMG/M
3300027915|Ga0209069_10092723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1452Open in IMG/M
(restricted) 3300027997|Ga0255057_10676968Not Available501Open in IMG/M
3300028673|Ga0257175_1004919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1786Open in IMG/M
3300028802|Ga0307503_10566948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300029951|Ga0311371_10395144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1884Open in IMG/M
3300030520|Ga0311372_10494410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1799Open in IMG/M
3300031253|Ga0307490_1000024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia97236Open in IMG/M
3300031546|Ga0318538_10049947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2039Open in IMG/M
3300031561|Ga0318528_10052890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2058Open in IMG/M
3300031668|Ga0318542_10057821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1781Open in IMG/M
3300031682|Ga0318560_10066601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1808Open in IMG/M
3300031719|Ga0306917_10076737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2333Open in IMG/M
3300031720|Ga0307469_10717772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium908Open in IMG/M
3300031744|Ga0306918_10136003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1799Open in IMG/M
3300031747|Ga0318502_10061266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2006Open in IMG/M
3300031748|Ga0318492_10059463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1806Open in IMG/M
3300031763|Ga0318537_10035214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1792Open in IMG/M
3300031777|Ga0318543_10377716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales635Open in IMG/M
3300031779|Ga0318566_10083809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1552Open in IMG/M
3300031781|Ga0318547_10072795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1907Open in IMG/M
3300031879|Ga0306919_10074515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2322Open in IMG/M
3300031880|Ga0318544_10025680All Organisms → cellular organisms → Bacteria → Proteobacteria2013Open in IMG/M
3300031890|Ga0306925_12013002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium544Open in IMG/M
3300031896|Ga0318551_10528790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales677Open in IMG/M
3300031910|Ga0306923_12014574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium585Open in IMG/M
3300031912|Ga0306921_10800502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1076Open in IMG/M
3300031941|Ga0310912_10130101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1883Open in IMG/M
3300031942|Ga0310916_10167423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1823Open in IMG/M
3300032035|Ga0310911_10629311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales622Open in IMG/M
3300032041|Ga0318549_10045017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1802Open in IMG/M
3300032059|Ga0318533_10090795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2099Open in IMG/M
3300032076|Ga0306924_10304289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1829Open in IMG/M
3300032089|Ga0318525_10061496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1875Open in IMG/M
3300032094|Ga0318540_10173507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1036Open in IMG/M
3300032180|Ga0307471_100810080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1103Open in IMG/M
3300033289|Ga0310914_11702634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium534Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil16.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.11%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil5.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.70%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.65%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil2.65%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.12%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.12%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.59%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.59%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater1.06%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.06%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.06%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.06%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.06%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.06%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.06%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.53%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.53%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.53%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.53%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.53%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.53%
Chlorella Sacherophilia (Mzch 10155) AssociatedHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Chlorella Sacherophilia (Mzch 10155) Associated0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.53%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.53%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
3300000712Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2EnvironmentalOpen in IMG/M
3300000901Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2EnvironmentalOpen in IMG/M
3300000907Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001111Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3EnvironmentalOpen in IMG/M
3300001120Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3EnvironmentalOpen in IMG/M
3300001137Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3EnvironmentalOpen in IMG/M
3300001141Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2EnvironmentalOpen in IMG/M
3300001143Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1EnvironmentalOpen in IMG/M
3300001153Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3EnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001155Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1EnvironmentalOpen in IMG/M
3300001159Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2EnvironmentalOpen in IMG/M
3300001163Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2EnvironmentalOpen in IMG/M
3300001170Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2EnvironmentalOpen in IMG/M
3300001527Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300008885Microbial communities associated with green microalga Chlorella saccharophila, Germany - (MZCH: 10155)Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300012181Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaGHost-AssociatedOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014054Permafrost microbial communities from Nunavut, Canada - A34_5cm_12MEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015068Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015080Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015160Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015206Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022561Borup_combined assemblyEnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026214Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes)EnvironmentalOpen in IMG/M
3300026220Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes)EnvironmentalOpen in IMG/M
3300026221Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)EnvironmentalOpen in IMG/M
3300026274Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 (SPAdes)EnvironmentalOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026369Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-AEnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026721Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN395 (SPAdes)EnvironmentalOpen in IMG/M
3300027002Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027257Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027872 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031253Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3UEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_000409302124908043SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRP
JGI11925J11888_10006223300000712Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSIA
JGI12192J12874_10011523300000901Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPF
JGI11871J12876_10013213300000907Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSTVRQI
JGI10216J12902_10156244123300000956SoilMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRGSNLQAD*
JGI12666J13322_10015013300001111Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRRPTQIWV
JGI12137J13328_10016323300001120Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSTAR
JGI12637J13337_100110423300001137Forest SoilMLIRPAIGDTDPIRYGRPTPDGQFSGNIIDEAMRPSVVW*
JGI12638J13249_10042713300001141Forest SoilMLIRPAIDDTDPIRHRRPTPDGQFSGNIIDEAMRP
JGI12687J13287_10017323300001143Forest SoilMLIRPAIDDTDPIRHRRPTPDGQFSGNIIDEAMRGQ
JGI12684J13248_10019023300001153Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRP
JGI12636J13339_101759723300001154Forest SoilMLIRPAIGDTDPIRYRCPTPDGQFSGNIIDEAMRP
JGI12625J13251_1013513300001155Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPTIAW*
JGI12650J13346_100029913300001159Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSDM
JGI12705J13279_10015613300001163Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRG
JGI12704J13340_100511223300001170Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPS
A3513AW1_104183423300001527PermafrostMLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRP
A3513AW1_116199923300001527PermafrostMLIRPAIGDTDPIRYRRHTPDGQFSGNIIDEAMRP*
JGI12630J15595_1001300623300001545Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPCRKWPSFR
JGI12659J15293_1001971213300001546Forest SoilMLIRPVIGDTDPIRSRRPTPDGQFSGNIIDEAMRPS
JGI12053J15887_1003396323300001661Forest SoilMLIRPAIGDTDPIRYRRPTPDSQFSGNIIDEAMRP*
JGI12053J15887_1010951713300001661Forest SoilMLIRPAIGDTDPIRYRCSTPDGQFSGNILDEAMRPCSF
C688J18823_1091164313300001686SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPRC
JGI12627J18819_1002953513300001867Forest SoilMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRRAK
JGI12627J18819_1011544413300001867Forest SoilMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRRAKE
Ga0066701_1078271313300005552SoilMLICPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPSIA*
Ga0070761_1007196623300005591SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPAQRRNLQ*
Ga0066795_1008586523300005938SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPS
Ga0066787_1000524013300005950SoilMLICPAIGDTDPIRYRRPTPDSQFSGNIFDEAMRPSIA*
Ga0066789_10000758163300005994SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSTEVDQ*
Ga0066789_1005444113300005994SoilRRVPMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPPLV*
Ga0066790_1045730813300005995SoilRRVPMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRLPPPPSLGRL*
Ga0075021_1035500523300006354WatershedsMLICPAIGDTDPIRYRRPTPGGQFSGNIFDEAMRP
Ga0075021_1070621123300006354WatershedsMLIRPAIGDTDLIRCPCHSPGGHSSGNILSEAMRP
Ga0074056_1177472913300006574SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRSDSLLVQ
Ga0066659_1015089613300006797SoilMLIGPAIGDTDPIRYRRPTLDGQFSGNILDEAMRP*
Ga0075435_10174147723300007076Populus RhizosphereMLIRPAIGDTEPIRYRCPNPDGQFSGNILDEAMR*
Ga0099791_1059634813300007255Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPLSRGIGV
Ga0099793_1000962453300007258Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNNLDEAMRPPSNLQAD*
Ga0115910_15937113300008885Chlorella Sacherophilia (Mzch 10155) AssociatedMLIRPAISDTDPIRHRRPTPDGQFSGNIIDEAMRPFARRG
Ga0105240_1011190453300009093Corn RhizosphereMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRP
Ga0111539_1158111813300009094Populus RhizosphereMLIRPAIGDTEPIRYRCPNPDGQFSGNILDEAMRP
Ga0105245_1034687123300009098Miscanthus RhizosphereMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRQSKNHRG
Ga0105247_1101023823300009101Switchgrass RhizosphereMLIRPAIGETDPIRYRRSNPDGQFSGNILDEAMRGSNLNAD*
Ga0114129_1276068823300009147Populus RhizosphereMLIRPAIGDTDPIRYRRPTPGGQFSGNIFDDAMR*
Ga0116129_121188123300009633PeatlandMLIRPAIGDTDPIRYRRPNPDGQFSGNIIDEAMRP*
Ga0105858_101623213300009661Permafrost SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPFGRRLPPIDPKMAI
Ga0105856_127989123300009662Permafrost SoilMLICPAIGDTDPILYRRPTPDSQFSGNIFDDAMRPDR
Ga0126309_1063524313300010039Serpentine SoilMLICPAIGGTDPIRYRRPTPDGQFSGNIFDEAMRPSIA*
Ga0126373_1317097313300010048Tropical Forest SoilPMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRP*
Ga0137443_123450613300011433SoilMLICPAIGDTDPIRYHRPTPDGQFSGNIFYEAMRGHF
Ga0153922_105396513300012181Attine Ant Fungus GardensMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRP*
Ga0137363_1033693223300012202Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPRQI*
Ga0137399_1091628023300012203Vadose Zone SoilPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPSIAW*
Ga0137384_1106470013300012357Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRP
Ga0137360_1013590913300012361Vadose Zone SoilMLIRPAIRDTDPIRYRRPTPDGQFSGNIIDEAMRSVSASNI
Ga0137407_1164704623300012930Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPSIA*
Ga0137410_1041258623300012944Vadose Zone SoilPMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPSIAW*
Ga0120135_100104133300014054PermafrostMLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRL*
Ga0120104_100696833300014829PermafrostMLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRGRMTIWSASGAN
Ga0180065_108119613300014878SoilMLICPAIGDTDPIRYRRPTPDGQFFGNIFDEAMRP
Ga0137414_110143713300015051Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPFRRPAMRP
Ga0137414_111368123300015051Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRAGQ
Ga0137411_125570813300015052Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAVTFLMRQC
Ga0137420_106435313300015054Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRDEAMR
Ga0167645_11830523300015068Glacier Forefield SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRLCVPKT*
Ga0167639_100533713300015080Glacier Forefield SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPRAAP
Ga0167642_104535113300015160Glacier Forefield SoilMLICPAIGDTDPIRYRRPTLGGQFSGNIFDEAMRPSIA*
Ga0167631_100770713300015168Glacier Forefield SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPFE
Ga0167644_1000232403300015206Glacier Forefield SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPRDRLIDQWCK*
Ga0137418_1092479213300015241Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPAS
Ga0132257_10062019013300015373Arabidopsis RhizosphereLICPAIGDADPIRYRRPTPDGQFSGNIFDEAMRPAP*
Ga0132257_10450323213300015373Arabidopsis RhizosphereMLIRPAIGDTDPIRYRRPTPDGQFSGNIPDEAMRG
Ga0187777_1036977123300017974Tropical PeatlandMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRPFD
Ga0184605_1003556023300018027Groundwater SedimentMLICPAIGDTDPIRYRRPTPGGQFSGNIFDEAMRPSIA
Ga0190265_1034257623300018422SoilMLICPAIGDTDPIRYHRPTPDSQFSGNIFDEAMRT
Ga0066662_1011470213300018468Grasslands SoilMLIGPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPSTA
Ga0193705_103027413300019869SoilMLICPAIRDTDPIRYRRPTPGGQFSGNIFDEAMRV
Ga0193723_114239913300019879SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPL
Ga0193713_102277213300019882SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPP
Ga0193727_103215213300019886SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPSI
Ga0193755_103075823300020004SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPPA
Ga0206354_1132232813300020081Corn, Switchgrass And Miscanthus RhizosphereMLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRPAAQI
Ga0179590_101397813300020140Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRSSEL
Ga0210395_1067253013300020582SoilMLIRPVIGDTDPIRSRRPTPDGQFSGNIIDEAMRPAQRRNLQ
Ga0210401_1023037913300020583SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPPS
Ga0179596_1012886313300021086Vadose Zone SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRSPDHRRREVFE
Ga0210406_1017579613300021168SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRVPVN
Ga0210400_1007558443300021170SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIGEAMRPST
Ga0210405_1015620613300021171SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIGEAMRPRAAPE
Ga0210388_1043798213300021181SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRVWAAAFGG
Ga0193699_1005729223300021363SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPPSLG
Ga0210387_1005596963300021405SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPASLN
Ga0210392_1029027313300021475SoilMLIRPAISDTDPIRYRRPTPDGQFSGNIIDEAMRPTRDLGG
Ga0210398_1016567913300021477SoilMLIRPVIGDTDPIRSRRPTPDGQFSGNIIDEAMRGVKLG
Ga0212090_1081725223300022561Glacier ValleyMLIRPAIGETDPIRYRRHTPDGQFSGNIIDEAMRRANKPR
Ga0233357_100125433300023056SoilMLIRPAIGDTDPIRYGRPTPDGQFSGNIIDEAMRPFT
Ga0137417_110302013300024330Vadose Zone SoilMLIRPAIGDTDPIRYRRIRYRRPTPDGQFSGNIIDEAM
Ga0137417_128063323300024330Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRP
Ga0208848_100831723300025509Arctic Peat SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRANRL
Ga0207710_1043443423300025900Switchgrass RhizosphereMLIRPAIGETDPIRYRRSNPDGQFSGNILDEAMRGSNLNAD
Ga0207685_1039898613300025905Corn, Switchgrass And Miscanthus RhizosphereMLIRPAIGETDPIRYRRSNPDGQFSGNILDEAMRPA
Ga0207684_1083174513300025910Corn, Switchgrass And Miscanthus RhizosphereMLIRPAIDDTDPIRYRRPTPDGQFSGNIFDEAMRGSILQAE
Ga0207707_1020567923300025912Corn RhizosphereMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRLTKAALSFAGR
Ga0207652_1010475033300025921Corn RhizosphereMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRLQF
Ga0207700_1015479113300025928Corn, Switchgrass And Miscanthus RhizosphereMLIRPAIGETDPIRYRRSNPDGQFSGNILDEAMRPADRHPK
Ga0207700_1050781913300025928Corn, Switchgrass And Miscanthus RhizosphereMLIRPAIGDTDPIRCRRPNPDGQFSGNILDEAMRGVNIAG
Ga0207661_1018963113300025944Corn RhizosphereMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRPRRHPD
Ga0209838_100500513300026214SoilMLICPAIGDTDPIRYRRPTPDSQFSGNIFDEAMRPSIA
Ga0209855_100868413300026220Permafrost SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSSNQA
Ga0209848_101129613300026221Permafrost SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRR
Ga0209888_101109213300026274Permafrost SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRRVSAFKY
Ga0209890_1001299813300026291SoilRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSRIAQTSVEL
Ga0209890_1002401013300026291SoilPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSITW
Ga0209890_1003011613300026291SoilRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPPLV
Ga0209890_1014123013300026291SoilIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPFGRRLPPIDPKMAI
Ga0209839_1003958513300026294SoilMLICPAIGDTDPIRYRRPTPDSQFSGNIFDEAMRG
Ga0257149_101168023300026355SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRR
Ga0257176_100026033300026361SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPGRRAA
Ga0257152_100255023300026369SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPA
Ga0257167_100151813300026376SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPS
Ga0257147_100397113300026475SoilMLIRPAIRDTDPIRYRRPTPDGQFSGNIIDEAMRVNIAGR
Ga0257147_101061313300026475SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPST
Ga0257177_103609313300026480SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPSA
Ga0257155_100592013300026481SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRGSNLNA
Ga0257160_100313433300026489SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRG
Ga0257157_100164213300026496SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPSTA
Ga0257181_100292813300026499SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPF
Ga0257165_106263913300026507SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPLQV
Ga0257161_101377813300026508SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPLERRVL
Ga0257158_105443423300026515SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRG
Ga0208841_10025913300026721SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPP
Ga0209110_102884413300027002Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPFTA
Ga0208996_100347913300027257Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRYRNGLCRHYV
Ga0209114_105441823300027504Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPSYCLT
Ga0209179_110603613300027512Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPG
Ga0209179_112902323300027512Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPLQVGLLRCL
Ga0208984_100854913300027546Forest SoilMLIRPAIGDTDPIRYRRPTPDSQFSGNIIDEAMRAHNLAKLATAR
Ga0209222_101039113300027559Forest SoilMLIRPAIGDTDLIRYRRPTPDGQFSGNIIDEAMRPSIVW
Ga0209525_110360913300027575Forest SoilMLIRPAIGDTDPIRYRRHTPDGQFSGNIIDEAMRPG
Ga0209331_101066313300027603Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPTIAW
Ga0209329_110904323300027605Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPFGRRVL
Ga0208988_115782513300027633Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRVNFGRRSPGLGGQ
Ga0209217_113046923300027651Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNIIDEAMRPALAPIGRLKSAV
Ga0209388_103300813300027655Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRPLFFSKIV
Ga0209118_100951923300027674Forest SoilMLICPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPSIA
Ga0209626_101499423300027684Forest SoilMLIRPAIGDTDPIRYGRPTPDGQFSGNIIDEAMRPFGRR
Ga0209446_102030413300027698Bog Forest SoilMLIRPAIGDTDPIRYRRPTPDGQFSGNILDEAMRLHRLAT
Ga0209772_1002583023300027768Bog Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPVRRQNLE
Ga0209139_1005420423300027795Bog Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRGSILDADP
Ga0209701_1068266313300027862Vadose Zone SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRGAGVNLRSRNTVQV
(restricted) Ga0255058_1041414023300027872SeawaterMLICPAIGDTDPIRCRRPSHGSQFSGNILDEAMRLIVGTD
Ga0209583_1031513013300027910WatershedsMLICPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRPRSAS
Ga0209069_1009272313300027915WatershedsMLICPAIDDTDLIRYRRPTPDGQSSGNIFGEAMRP
(restricted) Ga0255057_1067696813300027997SeawaterMLICPAIGDTDPIRCRRPSHGSQFSGNILDEAMRPLPVANNFHW
Ga0257175_100491913300028673SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPASR
Ga0307503_1056694823300028802SoilMLICPAIGDTDPIRYRRPTPDGQFSGNIFDEAMRHR
Ga0311371_1039514433300029951PalsaMLIRPAIGDTDPIRYRRHTPDGQFSGNIIDEAMRPL
Ga0311372_1049441023300030520PalsaMLIRPAIGDTDPIRYRRHTPDGQFSGNIIDEAMRS
Ga0307490_100002423300031253Sea-Ice BrineMLIRPAIGDTDPIRYRRPNADGQFSGNILDEAMRSSRFESMRHCWR
Ga0318538_1004994713300031546SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRGSKLHAE
Ga0318528_1005289013300031561SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRC
Ga0318542_1005782123300031668SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRGSK
Ga0318560_1006660123300031682SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPIGVALKCRGTASL
Ga0306917_1007673723300031719SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRSGALLV
Ga0307469_1071777223300031720Hardwood Forest SoilMLIRPAIGDTDPIRYRRPTPDDQFSGNILDEAMRPSTACKIN
Ga0306918_1013600323300031744SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRP
Ga0318502_1006126623300031747SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRRSA
Ga0318492_1005946323300031748SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRG
Ga0318537_1003521423300031763SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPPYCLI
Ga0318543_1037771613300031777SoilMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRS
Ga0318566_1008380913300031779SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPIGVA
Ga0318547_1007279513300031781SoilSSRRAPMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRP
Ga0306919_1007451533300031879SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRGSKLHA
Ga0318544_1002568033300031880SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPLQI
Ga0306925_1201300223300031890SoilMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAPRCFRT
Ga0318551_1052879023300031896SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPPYCL
Ga0306923_1201457423300031910SoilMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRSGALLV
Ga0306921_1080050213300031912SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRRQILVGHD
Ga0310912_1013010133300031941SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRGVNF
Ga0310916_1016742323300031942SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPSYCLI
Ga0310911_1062931113300032035SoilMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRERLV
Ga0318549_1004501723300032041SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPLM
Ga0318533_1009079513300032059SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPFRLPTLG
Ga0306924_1030428923300032076SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRPLSRG
Ga0318525_1006149633300032089SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRYW
Ga0318540_1017350713300032094SoilMLIRPAIGDTDPIRYRRPNPDGQFSGNILDEAMRWIERVTPGSMALL
Ga0307471_10081008023300032180Hardwood Forest SoilMLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRDASDP
Ga0310914_1170263413300033289SoilMLIRPAIGDTEPIRYRRPNPDGQFSGNILDEAMRPLSCG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.