Basic Information | |
---|---|
Family ID | F029210 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 189 |
Average Sequence Length | 45 residues |
Representative Sequence | VTTGVVLARTGSTYRVHTDTGEVTAVLRGKLKHRDDDRVVA |
Number of Associated Samples | 145 |
Number of Associated Scaffolds | 189 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 90.48 % |
% of genes near scaffold ends (potentially truncated) | 99.47 % |
% of genes from short scaffolds (< 2000 bps) | 83.60 % |
Associated GOLD sequencing projects | 133 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.471 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.339 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.090 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.439 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.54% Coil/Unstructured: 72.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 189 Family Scaffolds |
---|---|---|
PF01619 | Pro_dh | 60.85 |
PF02737 | 3HCDH_N | 7.41 |
PF02803 | Thiolase_C | 2.65 |
PF00725 | 3HCDH | 2.65 |
PF13646 | HEAT_2 | 2.12 |
PF00589 | Phage_integrase | 0.53 |
PF00005 | ABC_tran | 0.53 |
COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
---|---|---|---|
COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 60.85 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 10.05 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 7.41 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 7.41 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 7.41 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 7.41 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 7.41 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 7.41 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 2.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.47 % |
Unclassified | root | N/A | 0.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1002058 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 3289 | Open in IMG/M |
3300002558|JGI25385J37094_10000357 | All Organisms → cellular organisms → Bacteria | 11798 | Open in IMG/M |
3300002561|JGI25384J37096_10006501 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 4336 | Open in IMG/M |
3300002906|JGI25614J43888_10117782 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300002908|JGI25382J43887_10086659 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300002908|JGI25382J43887_10223323 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300002909|JGI25388J43891_1014572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1431 | Open in IMG/M |
3300002909|JGI25388J43891_1022543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1090 | Open in IMG/M |
3300002911|JGI25390J43892_10057996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 905 | Open in IMG/M |
3300002912|JGI25386J43895_10004650 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 3711 | Open in IMG/M |
3300002912|JGI25386J43895_10071547 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 946 | Open in IMG/M |
3300002914|JGI25617J43924_10119352 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 930 | Open in IMG/M |
3300005177|Ga0066690_10595387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 738 | Open in IMG/M |
3300005180|Ga0066685_10037381 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
3300005180|Ga0066685_11131353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
3300005186|Ga0066676_10001533 | All Organisms → cellular organisms → Bacteria | 9481 | Open in IMG/M |
3300005445|Ga0070708_101188324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 713 | Open in IMG/M |
3300005445|Ga0070708_102219377 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
3300005467|Ga0070706_100597606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1025 | Open in IMG/M |
3300005536|Ga0070697_100285121 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1417 | Open in IMG/M |
3300005540|Ga0066697_10222469 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300005546|Ga0070696_101934280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
3300005552|Ga0066701_10290990 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300005553|Ga0066695_10316235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 983 | Open in IMG/M |
3300005555|Ga0066692_10995969 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 513 | Open in IMG/M |
3300005558|Ga0066698_10236144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1258 | Open in IMG/M |
3300005558|Ga0066698_10423297 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 912 | Open in IMG/M |
3300005566|Ga0066693_10100192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1044 | Open in IMG/M |
3300005569|Ga0066705_10078048 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
3300005615|Ga0070702_100360012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1028 | Open in IMG/M |
3300006031|Ga0066651_10060132 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
3300006031|Ga0066651_10307727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 848 | Open in IMG/M |
3300006031|Ga0066651_10347466 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 796 | Open in IMG/M |
3300006031|Ga0066651_10632728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
3300006034|Ga0066656_10179808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1338 | Open in IMG/M |
3300006046|Ga0066652_100292099 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300006173|Ga0070716_100883754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
3300006755|Ga0079222_10126862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1402 | Open in IMG/M |
3300006791|Ga0066653_10305390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 802 | Open in IMG/M |
3300006797|Ga0066659_10506589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 969 | Open in IMG/M |
3300006797|Ga0066659_10848305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 760 | Open in IMG/M |
3300006797|Ga0066659_11546048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
3300006797|Ga0066659_11602078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
3300006804|Ga0079221_10630194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 730 | Open in IMG/M |
3300006806|Ga0079220_11169002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
3300006844|Ga0075428_102294814 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 555 | Open in IMG/M |
3300006847|Ga0075431_101094339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 762 | Open in IMG/M |
3300006853|Ga0075420_101009510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 716 | Open in IMG/M |
3300006854|Ga0075425_102953379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
3300006903|Ga0075426_10033888 | All Organisms → cellular organisms → Bacteria | 3649 | Open in IMG/M |
3300006903|Ga0075426_11575711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
3300006904|Ga0075424_100702364 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300006954|Ga0079219_10621727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 797 | Open in IMG/M |
3300007258|Ga0099793_10414989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 663 | Open in IMG/M |
3300007258|Ga0099793_10535324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 584 | Open in IMG/M |
3300007265|Ga0099794_10249691 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 915 | Open in IMG/M |
3300009090|Ga0099827_10037661 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3551 | Open in IMG/M |
3300009090|Ga0099827_11185707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
3300009137|Ga0066709_101888230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
3300009137|Ga0066709_102468885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 703 | Open in IMG/M |
3300009137|Ga0066709_103997253 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
3300009147|Ga0114129_10225110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2528 | Open in IMG/M |
3300009162|Ga0075423_13167680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
3300009597|Ga0105259_1036375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1072 | Open in IMG/M |
3300009799|Ga0105075_1039462 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
3300009812|Ga0105067_1054586 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300010046|Ga0126384_12065315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
3300010159|Ga0099796_10476801 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
3300010304|Ga0134088_10710392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
3300010320|Ga0134109_10018566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2108 | Open in IMG/M |
3300010320|Ga0134109_10082560 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1102 | Open in IMG/M |
3300010321|Ga0134067_10329311 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010325|Ga0134064_10402528 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
3300010364|Ga0134066_10031282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1259 | Open in IMG/M |
3300010364|Ga0134066_10121693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 785 | Open in IMG/M |
3300012096|Ga0137389_10274013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1423 | Open in IMG/M |
3300012129|Ga0137345_1021844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
3300012175|Ga0137321_1052047 | Not Available | 894 | Open in IMG/M |
3300012189|Ga0137388_10013057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5966 | Open in IMG/M |
3300012198|Ga0137364_10257109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1291 | Open in IMG/M |
3300012198|Ga0137364_10351226 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1100 | Open in IMG/M |
3300012201|Ga0137365_10160096 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300012203|Ga0137399_10264261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1414 | Open in IMG/M |
3300012203|Ga0137399_10480345 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300012207|Ga0137381_10398322 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1201 | Open in IMG/M |
3300012208|Ga0137376_10459279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1105 | Open in IMG/M |
3300012209|Ga0137379_11496636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
3300012210|Ga0137378_11035223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 735 | Open in IMG/M |
3300012211|Ga0137377_10057108 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3622 | Open in IMG/M |
3300012211|Ga0137377_10167928 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
3300012351|Ga0137386_10322027 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1112 | Open in IMG/M |
3300012351|Ga0137386_11034553 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
3300012354|Ga0137366_10094445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2268 | Open in IMG/M |
3300012356|Ga0137371_10011751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6765 | Open in IMG/M |
3300012360|Ga0137375_10854703 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300012360|Ga0137375_11105631 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 615 | Open in IMG/M |
3300012361|Ga0137360_11557566 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300012363|Ga0137390_10617646 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1051 | Open in IMG/M |
3300012363|Ga0137390_10834183 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 879 | Open in IMG/M |
3300012532|Ga0137373_10910589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 644 | Open in IMG/M |
3300012917|Ga0137395_10918972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 632 | Open in IMG/M |
3300012917|Ga0137395_11061510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
3300012918|Ga0137396_10170398 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
3300012918|Ga0137396_10275969 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1241 | Open in IMG/M |
3300012918|Ga0137396_10548133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 857 | Open in IMG/M |
3300012925|Ga0137419_11974192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
3300012927|Ga0137416_10841690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 813 | Open in IMG/M |
3300012944|Ga0137410_10073246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2488 | Open in IMG/M |
3300012944|Ga0137410_10438477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1058 | Open in IMG/M |
3300012944|Ga0137410_11740068 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 549 | Open in IMG/M |
3300012972|Ga0134077_10009920 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3084 | Open in IMG/M |
3300012972|Ga0134077_10244230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 742 | Open in IMG/M |
3300012975|Ga0134110_10537867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
3300014154|Ga0134075_10048512 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
3300014154|Ga0134075_10113156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1150 | Open in IMG/M |
3300014154|Ga0134075_10259968 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300014157|Ga0134078_10240546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 755 | Open in IMG/M |
3300014157|Ga0134078_10410684 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 610 | Open in IMG/M |
3300014166|Ga0134079_10114265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1048 | Open in IMG/M |
3300014166|Ga0134079_10312688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 702 | Open in IMG/M |
3300015054|Ga0137420_1322418 | All Organisms → cellular organisms → Bacteria | 5394 | Open in IMG/M |
3300015242|Ga0137412_10180688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1692 | Open in IMG/M |
3300015356|Ga0134073_10019728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1605 | Open in IMG/M |
3300015356|Ga0134073_10053820 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1087 | Open in IMG/M |
3300015357|Ga0134072_10058376 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300015359|Ga0134085_10492216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
3300017657|Ga0134074_1042965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1523 | Open in IMG/M |
3300017659|Ga0134083_10277936 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 706 | Open in IMG/M |
3300017930|Ga0187825_10003672 | All Organisms → cellular organisms → Bacteria | 5017 | Open in IMG/M |
3300017961|Ga0187778_10064431 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
3300017997|Ga0184610_1136300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 799 | Open in IMG/M |
3300018027|Ga0184605_10233564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 836 | Open in IMG/M |
3300018056|Ga0184623_10432640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
3300018060|Ga0187765_10120565 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300018063|Ga0184637_10045658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2666 | Open in IMG/M |
3300018431|Ga0066655_10426105 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300018433|Ga0066667_10724192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 837 | Open in IMG/M |
3300018468|Ga0066662_10181874 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300018468|Ga0066662_11571342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 686 | Open in IMG/M |
3300018468|Ga0066662_12975493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
3300018482|Ga0066669_10059960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2457 | Open in IMG/M |
3300019259|Ga0184646_1556241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1979 | Open in IMG/M |
3300019866|Ga0193756_1011883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1158 | Open in IMG/M |
3300019866|Ga0193756_1021081 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300020006|Ga0193735_1178615 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 525 | Open in IMG/M |
3300021073|Ga0210378_10247975 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
3300021081|Ga0210379_10170783 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300021086|Ga0179596_10224638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 921 | Open in IMG/M |
3300021344|Ga0193719_10097632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1277 | Open in IMG/M |
3300025160|Ga0209109_10519130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
3300025885|Ga0207653_10215939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 727 | Open in IMG/M |
3300026015|Ga0208286_1014226 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
3300026277|Ga0209350_1065680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1024 | Open in IMG/M |
3300026297|Ga0209237_1120709 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300026298|Ga0209236_1096395 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1339 | Open in IMG/M |
3300026298|Ga0209236_1166072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 905 | Open in IMG/M |
3300026301|Ga0209238_1205044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
3300026301|Ga0209238_1233348 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300026310|Ga0209239_1021819 | All Organisms → cellular organisms → Bacteria | 3162 | Open in IMG/M |
3300026313|Ga0209761_1165658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1025 | Open in IMG/M |
3300026319|Ga0209647_1119067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1215 | Open in IMG/M |
3300026323|Ga0209472_1076508 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1370 | Open in IMG/M |
3300026323|Ga0209472_1077696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1356 | Open in IMG/M |
3300026324|Ga0209470_1008230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 6430 | Open in IMG/M |
3300026327|Ga0209266_1134505 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300026328|Ga0209802_1020899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3599 | Open in IMG/M |
3300026329|Ga0209375_1103194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1278 | Open in IMG/M |
3300026333|Ga0209158_1340302 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
3300026334|Ga0209377_1132933 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300026528|Ga0209378_1009631 | All Organisms → cellular organisms → Bacteria | 5918 | Open in IMG/M |
3300026536|Ga0209058_1000267 | All Organisms → cellular organisms → Bacteria | 43272 | Open in IMG/M |
3300026537|Ga0209157_1267024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 651 | Open in IMG/M |
3300026537|Ga0209157_1302610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
3300026552|Ga0209577_10007026 | All Organisms → cellular organisms → Bacteria | 10373 | Open in IMG/M |
3300027681|Ga0208991_1111110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 820 | Open in IMG/M |
3300027738|Ga0208989_10123230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 878 | Open in IMG/M |
3300027787|Ga0209074_10040602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1379 | Open in IMG/M |
3300027875|Ga0209283_10017731 | All Organisms → cellular organisms → Bacteria | 4328 | Open in IMG/M |
3300027882|Ga0209590_10008840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4605 | Open in IMG/M |
3300027882|Ga0209590_10887778 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
3300027903|Ga0209488_10159508 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1703 | Open in IMG/M |
3300028072|Ga0247675_1075972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
3300028878|Ga0307278_10316785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
3300031226|Ga0307497_10146196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 976 | Open in IMG/M |
3300031720|Ga0307469_12080629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
3300032893|Ga0335069_10329211 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300033432|Ga0326729_1001460 | All Organisms → cellular organisms → Bacteria | 5061 | Open in IMG/M |
3300034177|Ga0364932_0289767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
3300034773|Ga0364936_020250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1110 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.05% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.17% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.12% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.59% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.06% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.06% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.06% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.06% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.53% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.53% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.53% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.53% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.53% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012129 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2 | Environmental | Open in IMG/M |
3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10020584 | 3300002557 | Grasslands Soil | MTSGVVLARTGSSYRVHTELGEVTATLRGKLKHKDDDRVVVGD |
JGI25385J37094_1000035711 | 3300002558 | Grasslands Soil | MALTTGVVLARVGSTYRVHADRGEVTAVLRGRLKRRDDDRVVAGDVVEL |
JGI25384J37096_100065015 | 3300002561 | Grasslands Soil | MTTGVVLGRRGGTYRVYTEAGEVTASLRGKLKFKDDDRVVAGDIV |
JGI25614J43888_101177821 | 3300002906 | Grasslands Soil | MRGAGTGMTTGVVLVREGGVYRVHTEAGEVAATLRGKLKHRDDDRVVPGDVVELDLHGD |
JGI25382J43887_100866594 | 3300002908 | Grasslands Soil | VITTGVVLVRTGSAYRVHTDGGEVVAVLRGKLKHRDDDRVVAGDVV |
JGI25382J43887_102233233 | 3300002908 | Grasslands Soil | VTATGVVLAREGSTYRVHAGGREVTAVLRGRLKLKDDDRVVA |
JGI25388J43891_10145721 | 3300002909 | Grasslands Soil | VTSGVVLARTGSSYRVHTDQGEVTATLRGRIKHRDDDRVVAGD |
JGI25388J43891_10225433 | 3300002909 | Grasslands Soil | VITTGVVLVRTGSAYRVHTEGGEVVAVLRGKLKHRNDDRVVAGDVVE |
JGI25390J43892_100579963 | 3300002911 | Grasslands Soil | VTQTTGVVLARAGGGYRVHTEAGEITATLRGKLKHQDTDRVVPGDVVVLDGTTIAE |
JGI25386J43895_100046501 | 3300002912 | Grasslands Soil | VITTGVVLARTGSAYRVHTDGGEVVATLRGKLKHRDDDHVVAGDLVEL |
JGI25386J43895_100715471 | 3300002912 | Grasslands Soil | VTQTTGVVLARAGGGYRVHTEAGEITATLRGKLKHQDTDRVVPGDVVVLDGTTI |
JGI25617J43924_101193523 | 3300002914 | Grasslands Soil | VTTGVVLARTGSTYRVDTARGEVVAVLRGKLKHRDEGRVVAGDVVELEQR |
Ga0066690_105953873 | 3300005177 | Soil | VALSSGVVLVRTGSSYRVHTAGGEVTAVLRGRLRRRDDDRVVAGDVVELELRPDGPA |
Ga0066685_100373811 | 3300005180 | Soil | VTAPLMNGVVLARTAGGYRVHTDAGEVTATLRGKLKYQDSDRVVPGDVVVLEGSTI |
Ga0066685_111313532 | 3300005180 | Soil | MTPTSGVVLARTAGGYRVHTDAGEITVTLRGKLKYQDSDRVVPGDVVVLEGSTIAEIR |
Ga0066676_100015331 | 3300005186 | Soil | MAMNTGVVLVRTGATYRVYTDWGEVTAVLRGKLRRREDDRVVAGDVVELELQRDGLATISCVRPRR |
Ga0070708_1011883241 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSGVVLARTGSSYRVHTDQGEVTATLRGRLKHKDDDRVVAGD |
Ga0070708_1022193772 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTGVVIAREGSTYRVHTAAGETSAVLRGKLKQKDDDRVT |
Ga0070706_1005976063 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VITTGVVLVRTGSAYRVHTEGGEVIAVLRGKLKHRDDDRVVAGDV |
Ga0070697_1002851211 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPEHGVTLTNGVVLARTAGGYRVHTDAGEITATLRGKLKYQD |
Ga0066697_102224691 | 3300005540 | Soil | VTTGVVLARTGSTYRVDTDRGEVTATLRGRLKHQDGDRVVAGD |
Ga0070696_1019342802 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTGVVLTHKGGGKYSVHTPEGEVTAVLRGKLKHDDDERVVAGDIVELTLHRDGPAT |
Ga0066701_102909901 | 3300005552 | Soil | VTTGVVLARTGSTYRVHTDRGEVTATLRGRLKHQDGDRVV |
Ga0066695_103162353 | 3300005553 | Soil | VTATSGVVLARTAGGYRVHTDAGEITATLRGKLKH |
Ga0066692_109959693 | 3300005555 | Soil | VITTGVVLVRIGSAYRVHTEGGEVVAVLRGKLKHRND |
Ga0066698_102361441 | 3300005558 | Soil | VITGVVLARIGSTYRVHTGAVEVTAVLRGKLKYRDDDRVVAGDVVELELHADGRA |
Ga0066698_104232973 | 3300005558 | Soil | MAMNTGVVLVRTGATYRVYTDWGEVTAVLRGKLRRREDDRVVAGDVVELELQRDGL |
Ga0066693_101001923 | 3300005566 | Soil | MRRASANVSATSGVVLARTAGGYRVHTDDGEITVS |
Ga0066705_100780484 | 3300005569 | Soil | MSATSGVVLARTAGGYRVHTDAGEIIATLRGKLKHQDSD |
Ga0070702_1003600123 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLNGVVLARAAGGYRVHTDAGEVVATLRGKLKHKDDDRVVPGDVVVLEG |
Ga0066651_100601324 | 3300006031 | Soil | VITTGVVLTRTGSTYRIHTQAGEVTAVLRGKLKHRD |
Ga0066651_103077273 | 3300006031 | Soil | MAVTTGVVLARTGSTYRVHTEGGERIAALRGKLKHQSGERVVA |
Ga0066651_103474661 | 3300006031 | Soil | VSATSGVVLARTAGGYRVHTDAGEITATLRGQLKYQDSGRVVPGDVV |
Ga0066651_106327283 | 3300006031 | Soil | VTTTGVVLVRTGSAYRVHTDRGEVTAVLRGKLKHRDDDRVV |
Ga0066656_101798081 | 3300006034 | Soil | VTAPLMNGVVLARTAGGYRVHTDAGEVTATLRGKLKY |
Ga0066652_1002920994 | 3300006046 | Soil | MTPTSGVVLSRTAGGYRVHTDAGEITASLRGKLKYKDSD |
Ga0070716_1008837541 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPEHGVTLTNGVVLARTAGGYRVHTDAGEITATLRGKLKYQDSDRVVPGDVV |
Ga0079222_101268621 | 3300006755 | Agricultural Soil | VTSGVVLARSGSTYRVHAEGREIVATLRGKLKHKDDDRVVVGDV |
Ga0066653_103053901 | 3300006791 | Soil | VITTGVVLVRTGSAYRVHTEGGEVVAVLRGKLKHR |
Ga0066659_105065891 | 3300006797 | Soil | MTPTSGVVLARTAGGYRVHTDAGEITVTLRGKLKYQDSDRVVPGDVV |
Ga0066659_108483053 | 3300006797 | Soil | VITTGVVLTRTGSTYRIHTQAGEVTAVLRGKLKHRDDDRIVAGDVVELERHAG |
Ga0066659_115460481 | 3300006797 | Soil | VSATSGVVLARTAGGYRVHTDAGEITVTLRGKLKHQDSDRVVP |
Ga0066659_116020782 | 3300006797 | Soil | VTTGVVLARTGSTYRVHAERGEMTAVLRGKLKRQDDDRVVAGDVVELDVRG |
Ga0079221_106301943 | 3300006804 | Agricultural Soil | MTTGVVLARTGATYRVHTGGGGAGTAVLRGQPKHR |
Ga0079220_111690021 | 3300006806 | Agricultural Soil | VTTGVVLARTGSTYRVHTDTGEVTAVLRGKLKHRDDDRV |
Ga0075428_1022948143 | 3300006844 | Populus Rhizosphere | VITGVVLARAVGGYRVHTPDGECVAVLRGRLKQADDDRVVAGDLVELALHA |
Ga0075431_1010943393 | 3300006847 | Populus Rhizosphere | MTTGVVLVREGGVYRVHTDAGEVAATLRGKLKHKDDDRVVPGDVVELDLHG |
Ga0075420_1010095103 | 3300006853 | Populus Rhizosphere | VTTGVVLARTGGTFRVHTANGEIEAVLRGKLKHKDDDRVV |
Ga0075425_1029533792 | 3300006854 | Populus Rhizosphere | VSATSGVVLARTAGGYRVHTDAGEITASLRGKLKYKDSDRVVPGDVVVLEGTT |
Ga0075426_100338881 | 3300006903 | Populus Rhizosphere | VTSGVVLARTGSSYRVHTDQGEVTATLRGRLKHKDDD |
Ga0075426_115757112 | 3300006903 | Populus Rhizosphere | VITTGVVLVRTGSAYRVHTEGGEVVAVLRGKLKHRDD |
Ga0075424_1007023641 | 3300006904 | Populus Rhizosphere | VTTGVVIAREGSTYRVHTAAGETSAVLRGKMKQKDDDRV |
Ga0079219_106217273 | 3300006954 | Agricultural Soil | VTTGVVIAREGSTYRVHSDGGELTAVLRGKLKQKDDDRVTVGDVV |
Ga0099793_104149891 | 3300007258 | Vadose Zone Soil | VSATSGVVLARTAGGYRVHTDAGEITVTLRGKLKHQDADRVVPG |
Ga0099793_105353243 | 3300007258 | Vadose Zone Soil | VSAVSGVVLARTAGGYRVHTAEGEITASLRGKLKY |
Ga0099794_102496913 | 3300007265 | Vadose Zone Soil | MTTGVVLGRRGGTFRVYTEGVEVTASLRGKLKFRDDDRVVAGDVV |
Ga0099827_100376611 | 3300009090 | Vadose Zone Soil | VVLARTGSTYRVHTDRGEVTATLRGRLKHQDGDRVVA |
Ga0099827_111857071 | 3300009090 | Vadose Zone Soil | VTVTSGVVLARTAGGYRVHTGVGEITVTLRGKLKHQDSDRVVPGDVVV |
Ga0066709_1018882303 | 3300009137 | Grasslands Soil | VTTGVVLARTGSTYRVHAERGEMTAVLRGKLKRKDDDRVVAGDVVELDVR |
Ga0066709_1024688853 | 3300009137 | Grasslands Soil | VITTGVVLARTGSAYRVHTDGGEVVATLRGKLKHRDDDRVVAGD |
Ga0066709_1039972532 | 3300009137 | Grasslands Soil | MTGVVLARTGGTFRVHTANGECTAVLRGKMKHADDDRVVAGDVVELELHGDGPATIQLV |
Ga0114129_102251101 | 3300009147 | Populus Rhizosphere | VITGVVLARAVGGYRVHTPDGECVAVLRGRLKQADDDRVVAG |
Ga0075423_131676802 | 3300009162 | Populus Rhizosphere | MTSGVVLARTGGTFRVHTADGEIEAVLRGKLKHKD |
Ga0105259_10363751 | 3300009597 | Soil | MTLLNGVVLARVGGAYRIHTDSGEVTATLRGKLKHKDEDRVVPGD |
Ga0105075_10394621 | 3300009799 | Groundwater Sand | MAVTIGVVLARTGSTYRVHGDQGEVSAVLPGRLKRRDDDRVVAGDIVELELRADGP |
Ga0105067_10545861 | 3300009812 | Groundwater Sand | MAVTIGVVLARTGSTYRVHGDQGEVSAVLPGRLKRRDDDRVVAGDIVELELRADGPATITRVRPRRSV |
Ga0126384_120653151 | 3300010046 | Tropical Forest Soil | MIAGVVLARAGGGYRVHTSEGERTAVLRGRLKLADDDRV |
Ga0099796_104768011 | 3300010159 | Vadose Zone Soil | VSATSGVVLARTAGGYRVHTDAGEITASLRGKLKYKD |
Ga0134088_107103922 | 3300010304 | Grasslands Soil | VTTGVVLARTGSTYRVHAERGEMTAVLRGKLKRKDDDRVV |
Ga0134109_100185661 | 3300010320 | Grasslands Soil | MSATSGVVLARTAGGYRVHTDAGEIIATLRGKLKHQDSDRVVPGDVVV |
Ga0134109_100825601 | 3300010320 | Grasslands Soil | VTTGVVLARIGSTYRVHTGAVEVTAVLRGKLKHRDDDRVVAGDV |
Ga0134067_103293111 | 3300010321 | Grasslands Soil | VTSGVVLARTGSSYRVHTDLGEVTATLRGKLKHRDDDRVVAG |
Ga0134064_104025283 | 3300010325 | Grasslands Soil | VIATGVVLVRTGSAYRVHTDGGEVVATLRGKLKHRD |
Ga0134066_100312823 | 3300010364 | Grasslands Soil | VTSGVVLARTGSSYRVHTDQGEVTATLRGRLKHKDDG |
Ga0134066_101216933 | 3300010364 | Grasslands Soil | MTTTGVVLVRAAGGYRVHTDAGEITATLRGKLKHK |
Ga0137389_102740131 | 3300012096 | Vadose Zone Soil | MTTGVVLGRRGGTFRVYTEGGEVTASLRGKLKFKDDDRVVA |
Ga0137345_10218441 | 3300012129 | Soil | VTLTRGTVLERTGGTYRVRTDAGEVEAVLRGKLKRPDDDKIVA |
Ga0137321_10520471 | 3300012175 | Soil | MTGVILARTGSTFRVQTDTGEVTAVLGGKLKHKDDGR |
Ga0137388_100130571 | 3300012189 | Vadose Zone Soil | MTTGVVLGRRGGTFRVYTEGGEVTASLRGKLKFKDDDRVVAGDV |
Ga0137364_102571093 | 3300012198 | Vadose Zone Soil | VITTGVVLVRTGSAYRVHTDRGEVTAVLRGKLKHR |
Ga0137364_103512263 | 3300012198 | Vadose Zone Soil | MTTTGVVLVRAAGGYRVHTDAGEITATLRGKLKHKDSDRVVPG |
Ga0137365_101600964 | 3300012201 | Vadose Zone Soil | MTTGVVLVRTGSAYRVQTEGGEVVAVLRGRLKHRDDDRVVAGDVVELEL |
Ga0137399_102642613 | 3300012203 | Vadose Zone Soil | MTTGVVLVREGGVYRVHTEGGEVIATLRGKLKHRDDDR |
Ga0137399_104803451 | 3300012203 | Vadose Zone Soil | VTTTGVVLERTGSAYRVHTDGGEVVAVLRGKLKHRDDDRVVAGDV |
Ga0137381_103983221 | 3300012207 | Vadose Zone Soil | VRTGVVLERTGSTFRVHTDAGEVTAVLRGRVKHRDDDRVV |
Ga0137376_104592793 | 3300012208 | Vadose Zone Soil | VSATSGVVLARTAGGYRVHTDAGEIIASLLGKLKYKDSDRVVPGDVVVLEGST |
Ga0137379_114966363 | 3300012209 | Vadose Zone Soil | MTSTSGVVLARTAGGYRVHTDAGEITVTLRGKLKYQD |
Ga0137378_110352233 | 3300012210 | Vadose Zone Soil | VSATSGVVLARTAGGYRVHTDAGEITASLRGKLKYKDSDRVVPGDVVVLEGS |
Ga0137377_100571085 | 3300012211 | Vadose Zone Soil | VQLTNGVVLARTAGGYRVHTDAGEITASLRGKLKHQDDDRVVPGDVVVLEGSTIAEI |
Ga0137377_101679281 | 3300012211 | Vadose Zone Soil | VAVSSGVVLVRTGSSYRVHTAGGEVTAVLRGRLRRRDDDRVVA |
Ga0137386_103220271 | 3300012351 | Vadose Zone Soil | MSATSGVVLARTAGGYRVHTDAGEIIATLRGKLKHQDSDRVVPGD |
Ga0137386_110345531 | 3300012351 | Vadose Zone Soil | MTTGVVLVRTGSAYRVQTEGGEVVAVLRGRLKHRDDD |
Ga0137366_100944454 | 3300012354 | Vadose Zone Soil | VTATGVVLVREGGVYRVHTEAGEVTATLRGKLKHRDDDRVVPGDVVELDL |
Ga0137371_100117517 | 3300012356 | Vadose Zone Soil | VIATGVVLVRTGSAYRVHTDGGEVVATLRGKLKHRDDDRVVAGDVVELEL |
Ga0137375_108547033 | 3300012360 | Vadose Zone Soil | VTTGVVLERTGSTYRVHTSVGEVTAVLRGKVKHRDDDRVVAGDVVELERHTGDRATIAAVRPRR |
Ga0137375_111056313 | 3300012360 | Vadose Zone Soil | MSATSGVVLARTAGGYRVHTDAGEIIATLRGKLKHRDSDRVVPGDVVVLE |
Ga0137360_115575663 | 3300012361 | Vadose Zone Soil | VSIGVVLAREGSTYRVHTDAGEVTAVLRGKLKHRDDDRVVAGDV |
Ga0137390_106176463 | 3300012363 | Vadose Zone Soil | MRRPEHDVTLTNGVVLARTAGGYRIHTDAGEITATLRGKLKYQDSDRVVPG |
Ga0137390_108341833 | 3300012363 | Vadose Zone Soil | MTTGVVLVRTGSAYRVHTEGGEVVAVLRGKLKHRDDDRVV |
Ga0137373_109105891 | 3300012532 | Vadose Zone Soil | MTTTGVVLLREGGVYRVHTDAGEVTATLRGKLKRRDDDRVVPGDVVEL |
Ga0137395_109189721 | 3300012917 | Vadose Zone Soil | VTTTGVVLVRTGSAYRVHTDRGEVVAVLRGKLKHRDDDRVVAGDVVDL |
Ga0137395_110615101 | 3300012917 | Vadose Zone Soil | MTTGVVLVRTGSAYRVHTEGGEVVAVLRGKLKHRDDDRVVAGD |
Ga0137396_101703981 | 3300012918 | Vadose Zone Soil | MTTGVVLVREGGVYRVHTEAGEVAATLRGKLKHRDDDRVVPGDV |
Ga0137396_102759693 | 3300012918 | Vadose Zone Soil | VRGGGRLTTGVVLGRKGGTLRVYTEGGEVTASLRGKLKFKDDDRVVAG |
Ga0137396_105481331 | 3300012918 | Vadose Zone Soil | VTATSGVVLARTAGGYRVHTDAGELIASLRGKLKYRDSDRVVPGDV |
Ga0137419_119741922 | 3300012925 | Vadose Zone Soil | MTTGVVLVREGGVYRVHTEAGEVAATLRGKLKHRDDDRVVPGDVVE |
Ga0137416_108416903 | 3300012927 | Vadose Zone Soil | MTPTTGVVLARTGGGYRVHTEAGEITATLRGKLKHK |
Ga0137410_100732464 | 3300012944 | Vadose Zone Soil | VSATSGVVLARTAGGYRVHTDAGEIIASLRGKLKYK |
Ga0137410_104384773 | 3300012944 | Vadose Zone Soil | VSATSGVVLARTAGGYRVHTDAGEIIASLRGKLKY |
Ga0137410_117400681 | 3300012944 | Vadose Zone Soil | MTTGVVLVREGGVYRVHTDAGEVAATLRGKLKHKDDDRVVPGDV |
Ga0134077_100099204 | 3300012972 | Grasslands Soil | MALTTGVVLARVGSTYRVHADRGEVTAVLRGRLKRRDDDRVVAGDVVELELQPD |
Ga0134077_102442301 | 3300012972 | Grasslands Soil | MAVTTGVVLARAGSTYRVHTEDGERTAALRGKLKRRGDDRIVAGDVVELEVQ |
Ga0134110_105378672 | 3300012975 | Grasslands Soil | VALSSGVVLVRTGSSYRVHTAGGEVTAVLRGRLRRRNDDRVVAGDVVEL |
Ga0134075_100485121 | 3300014154 | Grasslands Soil | MTTGVVLVRTGAAYRVHTDAGEVTAVLRGKLKHRDDDRVVAG |
Ga0134075_101131563 | 3300014154 | Grasslands Soil | VTATSGVVLARTAGGYRVHTDAGEIIASLRGKLKYQDSDRVVPGDVVVLEGS |
Ga0134075_102599681 | 3300014154 | Grasslands Soil | VITTGVVLVRIGSAYRVHTEGGEVVAVLRGKLKHRNDDRVVAGD |
Ga0134078_102405461 | 3300014157 | Grasslands Soil | MRRPEHSVTLTHGVVLARTAGGYRVHTDAGEITATLRGKLKYQDSDRVVPGDVVVLEGSK |
Ga0134078_104106841 | 3300014157 | Grasslands Soil | MITTGVVLARTGSAYRVHTDQGDVVATLRGKLKHRDDDRVVAGDVVELEL |
Ga0134079_101142653 | 3300014166 | Grasslands Soil | VTSGVVLARTGSSYRVHTDQGEVTATLRGRIKHKDDDRVVAG |
Ga0134079_103126883 | 3300014166 | Grasslands Soil | VTTTGVVLVRTGSAYRVHTDRGEVTAVLRGKLKHRDDDRVVAGDVVEL |
Ga0137420_13224185 | 3300015054 | Vadose Zone Soil | VLVRTGSTYRVHTEGGEVVAVLRGKLKHRDDDAWWG* |
Ga0137412_101806884 | 3300015242 | Vadose Zone Soil | MTTGVVLVRTGSAYRVHTEGGEVVAVLRGKLKHRDD |
Ga0134073_100197284 | 3300015356 | Grasslands Soil | MAMNTGVVLVRTGATYRVYTDWGEVTAVLRGKLRRREDDRVVAGDVVELELQRDGLATISCVRPRRSV |
Ga0134073_100538201 | 3300015356 | Grasslands Soil | VALSSGVVLVRTGSSYRVHTAGGEVTAVLRGRLRR |
Ga0134072_100583763 | 3300015357 | Grasslands Soil | VITTGVVLARTGSAYRVHTDGGEVVATLRGKLKHRDDDRVVAGDVVEL |
Ga0134085_104922163 | 3300015359 | Grasslands Soil | MTTGVVLVRTGSAYRVQTEGGEVVAVLRGRLKHRDDDRVVAGDVVEL |
Ga0134074_10429654 | 3300017657 | Grasslands Soil | VITTGVVLVRTGSAYRVHTEAGEVVAVLRGRLKHRDDDRVVAGDVVELELQ |
Ga0134083_102779363 | 3300017659 | Grasslands Soil | MTHPSPPTSGVVLVRTAGGYRVHTDAGEMTVTLRGKLKYRDDDRVVPGDIVTLDGTTITA |
Ga0187825_100036721 | 3300017930 | Freshwater Sediment | MTTGVVLTHTGGGKYSVHTPEGEVTAVLRGKLKQDDDERVVAGDIV |
Ga0187778_100644314 | 3300017961 | Tropical Peatland | MTSGVVLARTGGTYRVHTPEGEVTAVLRGKLKLADDDRLVAGDVVELALHRDGR |
Ga0184610_11363003 | 3300017997 | Groundwater Sediment | VSATSGVVLARTAGGYRVHTDAGEIIASLRGKLKYKDSDRVVPGDVVELE |
Ga0184605_102335642 | 3300018027 | Groundwater Sediment | VTTGVILARTGSTFRVQTDAGEVTAVLGGKLKHKDDGRVVAGDIVDFE |
Ga0184623_104326401 | 3300018056 | Groundwater Sediment | MTASIGVVLVRAGGVYRVHTDEGEVAATLRGKLKYKDDDRVVPGDVVVLDGTTIT |
Ga0187765_101205653 | 3300018060 | Tropical Peatland | VTRGVVLARVGSTYRVNTETGDCVAVLSGKLKHADGDRVVAGDVVEVE |
Ga0184637_100456584 | 3300018063 | Groundwater Sediment | MTASIGVVLVRAGGVYRVHTDEGEVAATLRGKLKYKDDDRVVPGD |
Ga0066655_104261051 | 3300018431 | Grasslands Soil | VITTGVVLARTGSAYRVHTDGGEVVATLRGKLKHRDDDRVVAGDM |
Ga0066667_107241921 | 3300018433 | Grasslands Soil | VTGVVLARMGSTYRVHAERGEVTAVLRGKLKRKDDDR |
Ga0066662_101818741 | 3300018468 | Grasslands Soil | VSSGVVLVRTGSSYRVHTAGGEVTAVLRGRLRRRDDDRVVAGDVVDLELRPDGPATISRIHP |
Ga0066662_115713421 | 3300018468 | Grasslands Soil | MTTGVVLGRRGGTYRVYTEAGEVTASLRGKLKFKDDDR |
Ga0066662_129754932 | 3300018468 | Grasslands Soil | MTPPLPPPTSGVVLVRTAGGYRVHTDAGEMTVTLRGKLKYRDDDRVVPGDV |
Ga0066669_100599601 | 3300018482 | Grasslands Soil | VALSSGVVLVRTGSSYRVHTAGGEVTAVLRGRLRRRDDD |
Ga0184646_15562414 | 3300019259 | Groundwater Sediment | MTPPPSPVSGVVLVRAAGGYRVHTEAGEITATLRGKLKRKDDDRV |
Ga0193756_10118831 | 3300019866 | Soil | MTTGVVLVREGGVYRVHTEGGEVTATLRGKLKHRDDDRVVPG |
Ga0193756_10210813 | 3300019866 | Soil | LVRTGSAYRVHTDRGEVVAVLRGKLKHQDNDRVVAGD |
Ga0193735_11786151 | 3300020006 | Soil | VSATTGVVLARTAGGYRVHTDAGEVIASLRGKLKYKDSDRVVPGDVVVLEGTT |
Ga0210378_102479753 | 3300021073 | Groundwater Sediment | VNTTGVVLVREGGVYRVHTDAGEVVASLRGKLKHRDDDRVVP |
Ga0210379_101707831 | 3300021081 | Groundwater Sediment | MTTGVVLVREGGVYRVHTDAGEVTATLRGKLKHRDD |
Ga0179596_102246381 | 3300021086 | Vadose Zone Soil | VSATSGVVLARTAGGYRVHTDAGEIIASLRGKLKYKDS |
Ga0193719_100976323 | 3300021344 | Soil | MTTGVVLVREGGVYRIHTDAGEITATLRGKLKHRDDDRVVPGDVVELDDQGTITGIR |
Ga0209109_105191302 | 3300025160 | Soil | VTRSVAGVVLAKSGGTFRVHTPAGAVTAVLRGKLKHRDDDRIVAGDV |
Ga0207653_102159391 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLNGVVLARAAGGYRVHTDAGEVVATLRGKLKHKDDDRVVPGDVVVLEGSTI |
Ga0208286_10142263 | 3300026015 | Rice Paddy Soil | VITGVVLARSGSTFRVHTADGEVVAALTGKIKHKNLDRVVAGDVVELTLQADGPA |
Ga0209350_10656801 | 3300026277 | Grasslands Soil | VTGVVLARMGSTYRVHAERGEMTAVLRGKLKRKDDDRVVAG |
Ga0209237_11207091 | 3300026297 | Grasslands Soil | VTTGVVLARTGSTYRVHAERGEVTAVLRGKLKHKDDDRVVAGDVVEL |
Ga0209236_10963951 | 3300026298 | Grasslands Soil | VTTGVVLARTGSTYRVHAERGEVTAVLRGKLKHKDD |
Ga0209236_11660724 | 3300026298 | Grasslands Soil | VTVTNGVVLARTAGGYRVHTDAGEITATLRGKLKYQ |
Ga0209238_12050441 | 3300026301 | Grasslands Soil | MTTTGVVLVRAAGGYRVHTDAGEITATLRGKLKHKDSDRVVPGDVVVLE |
Ga0209238_12333481 | 3300026301 | Grasslands Soil | VTSGVVLARTGSTYRVHTDQGEVTATLRGKLKHKDDDRVV |
Ga0209239_10218191 | 3300026310 | Grasslands Soil | VTSGVVLARTGSSYRVHTDQGEVTATLRGRLKHRDDDRVVA |
Ga0209761_11656583 | 3300026313 | Grasslands Soil | VTGVVLARMGSTYRVHAERGEMTAVLRGKLKRKDDDRVVAGDVVELEVRGD |
Ga0209647_11190671 | 3300026319 | Grasslands Soil | MRGAGTGMTTGVVLVREGGVYRVHTEAGEVAATLRGKLKHRDDDRVVPGDVVELDLHGDG |
Ga0209472_10765083 | 3300026323 | Soil | MAVTTGVVLARTGSTYRVHTEGGERIAALRGKLKHQSGERVVAGDVV |
Ga0209472_10776963 | 3300026323 | Soil | MTHPPSPTSGVVLVRTAGGYRVHTDAGEMTVTLRGKLT |
Ga0209470_10082301 | 3300026324 | Soil | VTTGVVLARTGSTYRVHAERGEMTAVLRGKLKRKDDDRV |
Ga0209266_11345051 | 3300026327 | Soil | VITTGVVLTRTGSTYRIHTQAGEVTAVLRGKLKHRDDDRIVAGDVVEL |
Ga0209802_10208991 | 3300026328 | Soil | MTTGVVLGRRGGTYRVYTEAGEVTASLRGKLKFKD |
Ga0209375_11031943 | 3300026329 | Soil | MTHPPSPTSGVVLVRTAGGYRVHTDAGEMTVTLRGKLKYRDDDRVVPGDIVTLDGTTI |
Ga0209158_13403022 | 3300026333 | Soil | VTTGVVLARTGSTYRVHTDTGEVTAVLRGKLKHRDDDRVVA |
Ga0209377_11329331 | 3300026334 | Soil | MTTGVVLARTGSAYRVHTSGGDVVATLRGKLKHRDDDRVVA |
Ga0209378_10096311 | 3300026528 | Soil | VTATSGVVLARTAGGYRVHTDAGEITATLRGKLKHRDSD |
Ga0209058_100026745 | 3300026536 | Soil | VALSSGVVLVRTGSSYRVHTDRGEVTAVLRGRLRRRDDDRVV |
Ga0209157_12670241 | 3300026537 | Soil | VTTGVVLARTGSTYRVHAERGEMTAVLRGKLKRKDDDRVVAGDVV |
Ga0209157_13026103 | 3300026537 | Soil | VQLTNGVVLARTAGGYRVHTDAGEITASLRGKLKHQDDDRVVPGDVVVLEGSTI |
Ga0209577_1000702610 | 3300026552 | Soil | VALSSGVVLVRTGSSYRVHTAGGEVTAVLRGRLRRRDDDRVVAGDVV |
Ga0208991_11111101 | 3300027681 | Forest Soil | VTATSGVVLARTAGGYRVHTDAGEITASLRGKLKYKDSDRAVPGDVVVLEG |
Ga0208989_101232303 | 3300027738 | Forest Soil | VSAISGVVLARTAGGYRVHTDGGEIIASLRGKLKYKDSDRV |
Ga0209074_100406021 | 3300027787 | Agricultural Soil | VTSGVVLARSGSTYRVHAEGREIVATLRGKLKHKDD |
Ga0209283_100177315 | 3300027875 | Vadose Zone Soil | MTPTTGVVLARTGGGYRVHTDAGEITATLRGKLKHQDTGRV |
Ga0209590_100088401 | 3300027882 | Vadose Zone Soil | VITTGVVLVRIGSAYRVHTEGGEVVAVLRGKLKHR |
Ga0209590_108877781 | 3300027882 | Vadose Zone Soil | VTTGVVLARTGSTYRVHTDRGEVTATLRGRLKHQDGDRVVA |
Ga0209488_101595081 | 3300027903 | Vadose Zone Soil | VSATSGVVLARTAGGYRVHTDAGEITASLRGKLKYKDSDRVVPGD |
Ga0247675_10759722 | 3300028072 | Soil | VTTGVVLARTGSTYRVHTDTGEVTAVLRGKLKYRDDDRVVAGDVVDLELQSD |
Ga0307278_103167853 | 3300028878 | Soil | VSATSGVVLARTAGGYRVHTDAGEVIASLRGKLKYKDSDRVVPGDVVVLEG |
Ga0307497_101461963 | 3300031226 | Soil | MTLVNGVVLARVGGTYRVHTDGGEITATLRGKLKHKDEDRVV |
Ga0307469_120806291 | 3300031720 | Hardwood Forest Soil | VTLLNGVVLARVGGGYRVHTDGGEVTATLRGKLKHKDEDR |
Ga0335069_103292111 | 3300032893 | Soil | VSSGVVLARAGSQFRVHVDGREVTATLRGKLKHRDDDRVVVG |
Ga0326729_10014601 | 3300033432 | Peat Soil | MTTGVVLERTGNTFRVHTPEGECIAVLRGRLKRGDDDRLVAGDVVD |
Ga0364932_0289767_503_619 | 3300034177 | Sediment | MSVTTGVVLVREGGVYRVHTEAGEVAATLRGKLKHRDDD |
Ga0364936_020250_2_118 | 3300034773 | Sediment | VITGVILARSGGTYRVHTAAGEVTAVLRGKMKHADDSRV |
⦗Top⦘ |