Basic Information | |
---|---|
Family ID | F030012 |
Family Type | Metagenome |
Number of Sequences | 186 |
Average Sequence Length | 43 residues |
Representative Sequence | MTVAKVIEFYIPNNFRKRVKWVSPEQRGKIIEFASQMKKSA |
Number of Associated Samples | 135 |
Number of Associated Scaffolds | 186 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 57.53 % |
% of genes near scaffold ends (potentially truncated) | 36.02 % |
% of genes from short scaffolds (< 2000 bps) | 79.03 % |
Associated GOLD sequencing projects | 128 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.796 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.817 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.269 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.226 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.04% β-sheet: 0.00% Coil/Unstructured: 86.96% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 186 Family Scaffolds |
---|---|---|
PF13432 | TPR_16 | 2.15 |
PF08281 | Sigma70_r4_2 | 2.15 |
PF03544 | TonB_C | 2.15 |
PF14534 | DUF4440 | 2.15 |
PF00793 | DAHP_synth_1 | 1.61 |
PF11937 | DUF3455 | 1.61 |
PF00903 | Glyoxalase | 1.61 |
PF14559 | TPR_19 | 1.61 |
PF13581 | HATPase_c_2 | 1.61 |
PF04397 | LytTR | 1.61 |
PF00106 | adh_short | 1.08 |
PF13561 | adh_short_C2 | 1.08 |
PF03576 | Peptidase_S58 | 1.08 |
PF11528 | DUF3224 | 1.08 |
PF02586 | SRAP | 1.08 |
PF00589 | Phage_integrase | 1.08 |
PF04551 | GcpE | 1.08 |
PF13751 | DDE_Tnp_1_6 | 1.08 |
PF00069 | Pkinase | 1.08 |
PF00171 | Aldedh | 1.08 |
PF00072 | Response_reg | 0.54 |
PF00581 | Rhodanese | 0.54 |
PF01979 | Amidohydro_1 | 0.54 |
PF00199 | Catalase | 0.54 |
PF00491 | Arginase | 0.54 |
PF13482 | RNase_H_2 | 0.54 |
PF00578 | AhpC-TSA | 0.54 |
PF16576 | HlyD_D23 | 0.54 |
PF02201 | SWIB | 0.54 |
PF00535 | Glycos_transf_2 | 0.54 |
PF11154 | DUF2934 | 0.54 |
PF08388 | GIIM | 0.54 |
PF00378 | ECH_1 | 0.54 |
PF03992 | ABM | 0.54 |
PF00128 | Alpha-amylase | 0.54 |
PF05974 | DUF892 | 0.54 |
PF05726 | Pirin_C | 0.54 |
PF00239 | Resolvase | 0.54 |
PF00593 | TonB_dep_Rec | 0.54 |
PF07676 | PD40 | 0.54 |
PF13683 | rve_3 | 0.54 |
PF00484 | Pro_CA | 0.54 |
PF01103 | Omp85 | 0.54 |
PF12697 | Abhydrolase_6 | 0.54 |
PF02416 | TatA_B_E | 0.54 |
PF10431 | ClpB_D2-small | 0.54 |
PF08530 | PepX_C | 0.54 |
PF13577 | SnoaL_4 | 0.54 |
PF00326 | Peptidase_S9 | 0.54 |
PF12867 | DinB_2 | 0.54 |
PF01263 | Aldose_epim | 0.54 |
COG ID | Name | Functional Category | % Frequency in 186 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.30 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.15 |
COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 2.15 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.08 |
COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 1.08 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.08 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.08 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.08 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.54 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.54 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.54 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.54 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.54 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.54 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.54 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.54 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.54 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.54 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.54 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.54 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.54 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.54 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.54 |
COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.54 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.80 % |
Unclassified | root | N/A | 17.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZTSFBX01COVZX | Not Available | 500 | Open in IMG/M |
2228664022|INPgaii200_c0615062 | Not Available | 701 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101514663 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300001593|JGI12635J15846_10312092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
3300001593|JGI12635J15846_10409133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300001661|JGI12053J15887_10461312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101629877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 543 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10001306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6262 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10004065 | All Organisms → cellular organisms → Bacteria | 4267 | Open in IMG/M |
3300004091|Ga0062387_100094969 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
3300004092|Ga0062389_100460502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 1409 | Open in IMG/M |
3300004479|Ga0062595_102490924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 516 | Open in IMG/M |
3300005166|Ga0066674_10195947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300005174|Ga0066680_10372923 | Not Available | 909 | Open in IMG/M |
3300005177|Ga0066690_10544408 | Not Available | 777 | Open in IMG/M |
3300005329|Ga0070683_100042133 | All Organisms → cellular organisms → Bacteria | 4204 | Open in IMG/M |
3300005332|Ga0066388_101114701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1338 | Open in IMG/M |
3300005332|Ga0066388_103001020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
3300005435|Ga0070714_100322050 | Not Available | 1446 | Open in IMG/M |
3300005439|Ga0070711_100048465 | All Organisms → cellular organisms → Bacteria | 2905 | Open in IMG/M |
3300005445|Ga0070708_101039001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
3300005445|Ga0070708_101608201 | Not Available | 605 | Open in IMG/M |
3300005467|Ga0070706_100005536 | All Organisms → cellular organisms → Bacteria | 12023 | Open in IMG/M |
3300005541|Ga0070733_10216715 | Not Available | 1255 | Open in IMG/M |
3300005542|Ga0070732_10004069 | All Organisms → cellular organisms → Bacteria | 7875 | Open in IMG/M |
3300005542|Ga0070732_10040667 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
3300005542|Ga0070732_10056116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2281 | Open in IMG/M |
3300005549|Ga0070704_102118172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 523 | Open in IMG/M |
3300005552|Ga0066701_10117089 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300005554|Ga0066661_10292091 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300005554|Ga0066661_10878678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300005561|Ga0066699_10240389 | Not Available | 1274 | Open in IMG/M |
3300005568|Ga0066703_10252682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
3300005568|Ga0066703_10794978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300005569|Ga0066705_10451259 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300005614|Ga0068856_100251703 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
3300005834|Ga0068851_10143238 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300005921|Ga0070766_10002163 | All Organisms → cellular organisms → Bacteria | 9777 | Open in IMG/M |
3300005921|Ga0070766_10654807 | Not Available | 708 | Open in IMG/M |
3300005921|Ga0070766_10673247 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → Candidatus Sumerlaeia → unclassified Candidatus Sumerlaeia → Candidatus Sumerlaeia bacterium | 699 | Open in IMG/M |
3300006806|Ga0079220_11732145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300006871|Ga0075434_100375361 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300006881|Ga0068865_100004723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8227 | Open in IMG/M |
3300006893|Ga0073928_10450966 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300006904|Ga0075424_101921387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 625 | Open in IMG/M |
3300007258|Ga0099793_10014464 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
3300007982|Ga0102924_1247014 | Not Available | 739 | Open in IMG/M |
3300009089|Ga0099828_10845793 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300009090|Ga0099827_10423446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
3300009090|Ga0099827_10775963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300009137|Ga0066709_103663405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300010358|Ga0126370_10596711 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300010376|Ga0126381_103790768 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300010398|Ga0126383_10531054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1239 | Open in IMG/M |
3300011269|Ga0137392_10523688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
3300011269|Ga0137392_11393198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300011270|Ga0137391_10080644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2805 | Open in IMG/M |
3300012019|Ga0120139_1074096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
3300012198|Ga0137364_11396815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300012199|Ga0137383_10028948 | All Organisms → cellular organisms → Bacteria | 3879 | Open in IMG/M |
3300012199|Ga0137383_10311208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
3300012200|Ga0137382_10165335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
3300012203|Ga0137399_10019407 | All Organisms → cellular organisms → Bacteria | 4408 | Open in IMG/M |
3300012205|Ga0137362_11022301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
3300012209|Ga0137379_10058010 | All Organisms → cellular organisms → Bacteria | 3727 | Open in IMG/M |
3300012210|Ga0137378_11601923 | Not Available | 560 | Open in IMG/M |
3300012349|Ga0137387_10348415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
3300012351|Ga0137386_10361118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300012351|Ga0137386_10475157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
3300012351|Ga0137386_10683590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300012361|Ga0137360_10140421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1903 | Open in IMG/M |
3300012925|Ga0137419_10602080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 883 | Open in IMG/M |
3300012927|Ga0137416_10066259 | All Organisms → cellular organisms → Bacteria | 2600 | Open in IMG/M |
3300012929|Ga0137404_10178577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1785 | Open in IMG/M |
3300012929|Ga0137404_10863602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
3300012930|Ga0137407_10132987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2176 | Open in IMG/M |
3300012930|Ga0137407_11790153 | Not Available | 585 | Open in IMG/M |
3300012944|Ga0137410_11069688 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300014969|Ga0157376_10025077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4692 | Open in IMG/M |
3300015371|Ga0132258_10572190 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
3300015372|Ga0132256_101173131 | Not Available | 882 | Open in IMG/M |
3300015373|Ga0132257_100173182 | Not Available | 2542 | Open in IMG/M |
3300015373|Ga0132257_103118422 | Not Available | 604 | Open in IMG/M |
3300016445|Ga0182038_11810709 | Not Available | 551 | Open in IMG/M |
3300017823|Ga0187818_10276341 | Not Available | 736 | Open in IMG/M |
3300017932|Ga0187814_10077059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
3300017943|Ga0187819_10602564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300017955|Ga0187817_10456170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300017974|Ga0187777_11191676 | Not Available | 557 | Open in IMG/M |
3300018006|Ga0187804_10362607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300018007|Ga0187805_10264461 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300018007|Ga0187805_10547979 | Not Available | 544 | Open in IMG/M |
3300018040|Ga0187862_10417839 | Not Available | 820 | Open in IMG/M |
3300018058|Ga0187766_11290192 | Not Available | 532 | Open in IMG/M |
3300018064|Ga0187773_10015494 | All Organisms → cellular organisms → Bacteria | 3217 | Open in IMG/M |
3300019888|Ga0193751_1022291 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
3300020170|Ga0179594_10383125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300020579|Ga0210407_10039874 | All Organisms → cellular organisms → Bacteria | 3493 | Open in IMG/M |
3300020579|Ga0210407_11199775 | Not Available | 571 | Open in IMG/M |
3300020580|Ga0210403_10193057 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
3300020580|Ga0210403_10623178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
3300020580|Ga0210403_10940875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300020580|Ga0210403_11005411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300020581|Ga0210399_10273623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → unclassified Candidatus Contendobacter → Candidatus Contendobacter sp. | 1409 | Open in IMG/M |
3300020581|Ga0210399_10496949 | Not Available | 1014 | Open in IMG/M |
3300020581|Ga0210399_11528937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300020583|Ga0210401_10001641 | All Organisms → cellular organisms → Bacteria | 25530 | Open in IMG/M |
3300020583|Ga0210401_10237899 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
3300020583|Ga0210401_10743503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
3300021046|Ga0215015_11112922 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300021088|Ga0210404_10861724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300021170|Ga0210400_10251061 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300021171|Ga0210405_10001483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 26648 | Open in IMG/M |
3300021171|Ga0210405_10231585 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
3300021171|Ga0210405_10375612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
3300021178|Ga0210408_10114181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2127 | Open in IMG/M |
3300021178|Ga0210408_10131061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1980 | Open in IMG/M |
3300021180|Ga0210396_10004097 | All Organisms → cellular organisms → Bacteria | 14296 | Open in IMG/M |
3300021405|Ga0210387_10391976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
3300021405|Ga0210387_11320057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300021420|Ga0210394_10658831 | Not Available | 919 | Open in IMG/M |
3300021432|Ga0210384_10162142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2007 | Open in IMG/M |
3300021478|Ga0210402_10065286 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
3300021478|Ga0210402_10142610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2178 | Open in IMG/M |
3300021478|Ga0210402_10417538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1246 | Open in IMG/M |
3300021478|Ga0210402_10739301 | Not Available | 908 | Open in IMG/M |
3300021478|Ga0210402_10822207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300021478|Ga0210402_10851081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
3300021478|Ga0210402_11290329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300021479|Ga0210410_10330455 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300021479|Ga0210410_10648279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
3300021559|Ga0210409_10134594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2268 | Open in IMG/M |
3300022557|Ga0212123_10381462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 952 | Open in IMG/M |
3300022731|Ga0224563_1022151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300024055|Ga0247794_10261435 | Not Available | 574 | Open in IMG/M |
3300025901|Ga0207688_10700202 | Not Available | 641 | Open in IMG/M |
3300025910|Ga0207684_10009641 | All Organisms → cellular organisms → Bacteria | 8516 | Open in IMG/M |
3300025910|Ga0207684_10014857 | All Organisms → cellular organisms → Bacteria | 6701 | Open in IMG/M |
3300025917|Ga0207660_11466269 | Not Available | 552 | Open in IMG/M |
3300025922|Ga0207646_11658895 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300025924|Ga0207694_10884606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300025942|Ga0207689_11377702 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
3300026041|Ga0207639_10356717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
3300026078|Ga0207702_11910705 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300026351|Ga0257170_1036653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300026538|Ga0209056_10379528 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300026542|Ga0209805_1144412 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300026551|Ga0209648_10422272 | Not Available | 854 | Open in IMG/M |
3300027439|Ga0209332_1063965 | Not Available | 670 | Open in IMG/M |
3300027565|Ga0209219_1000188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8401 | Open in IMG/M |
3300027565|Ga0209219_1149362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300027587|Ga0209220_1024818 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300027643|Ga0209076_1061825 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300027674|Ga0209118_1177043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300027855|Ga0209693_10053956 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
3300027882|Ga0209590_10849974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300027884|Ga0209275_10728247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300027903|Ga0209488_10926070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300027908|Ga0209006_10014972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7018 | Open in IMG/M |
3300028047|Ga0209526_10008730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6981 | Open in IMG/M |
3300028792|Ga0307504_10197763 | Not Available | 711 | Open in IMG/M |
3300031057|Ga0170834_109845041 | Not Available | 534 | Open in IMG/M |
3300031231|Ga0170824_111907531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300031708|Ga0310686_103358740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300031708|Ga0310686_104401722 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300031708|Ga0310686_106087795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
3300031708|Ga0310686_106286333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18248 | Open in IMG/M |
3300031708|Ga0310686_106613797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300031708|Ga0310686_109517586 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300031708|Ga0310686_114086987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
3300031718|Ga0307474_10002963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12240 | Open in IMG/M |
3300031718|Ga0307474_10403105 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300031720|Ga0307469_10381152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
3300031753|Ga0307477_10035525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3418 | Open in IMG/M |
3300031754|Ga0307475_10396833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
3300031962|Ga0307479_10635830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1048 | Open in IMG/M |
3300031962|Ga0307479_11652727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300032180|Ga0307471_100851532 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300032180|Ga0307471_101427824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
3300032205|Ga0307472_100118318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1866 | Open in IMG/M |
3300032205|Ga0307472_100247029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1396 | Open in IMG/M |
3300032205|Ga0307472_100876192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300032783|Ga0335079_11340145 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300032805|Ga0335078_12129964 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300032828|Ga0335080_10239818 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300033158|Ga0335077_10875524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.53% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.30% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.69% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.15% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.15% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.15% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.61% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.08% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.08% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.08% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.08% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.08% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.54% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.54% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.54% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.54% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.54% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.54% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_09255030 | 2170459024 | Grass Soil | VAKVIEFYKPNNFCKKVKWISPELRGKIVQFSPPVKKSA |
INPgaii200_06150622 | 2228664022 | Soil | MAHVIEFYIPNRFRKNVKWVRAQQRGTVIEFPSQIKKSA |
INPhiseqgaiiFebDRAFT_1015146632 | 3300000364 | Soil | MAHVIEFYIPNRFRKNVKWVRAQQRGTVIEFPSQIKKSA* |
JGI12635J15846_103120921 | 3300001593 | Forest Soil | MTVAKVIEFYIPNNFRKSVKWVSPEQRGKIVEFVSQTKKSA* |
JGI12635J15846_104091332 | 3300001593 | Forest Soil | MTVAKVIEFYIPNTFRKSVKWVSPEERGKIIEFPLQIKKSA* |
JGI12053J15887_104613122 | 3300001661 | Forest Soil | MTVAKVIEFYIPNTFRKSVQWVSPEQRGKIIEFVSQIKKSA* |
JGIcombinedJ26739_1016298771 | 3300002245 | Forest Soil | MTVAKVIEFYIPNTFRKSVKWLSPEQRGKIIEFVSQTKKSA* |
JGIcombinedJ51221_100013066 | 3300003505 | Forest Soil | MTMAKIIEFYIPNNFRKSVKWVSPERRGKIIEFPSEMKKSA* |
JGIcombinedJ51221_100040657 | 3300003505 | Forest Soil | MAKVIEFYIPNNFRKKVKWVSPERRGKIIEFPSQMKKSA* |
Ga0062387_1000949693 | 3300004091 | Bog Forest Soil | MTVAKVIEFYIPKKFRKTMKWVSVEQRGKIIEFASHMKKPA* |
Ga0062389_1004605021 | 3300004092 | Bog Forest Soil | VAKVIEFYIPDNSRKSMKWVPPELRGKIIEFASQIKKSA* |
Ga0062595_1024909241 | 3300004479 | Soil | REDILEMKAVTTVAKVIEFYIPNHFRRSLKWVSAEGRGKIIEFARPMSKSA* |
Ga0066674_101959472 | 3300005166 | Soil | MTVAKVIEFYIPNNFRKSVKWVSPEQRGKIVEFVSQPKKSA* |
Ga0066680_103729231 | 3300005174 | Soil | MTVAKVIEFYIPNIFRKSVKSVSREQRGKIIEFASPIKKSA* |
Ga0066690_105444081 | 3300005177 | Soil | VVKVIEFYIPTNFQKNVKWVSPEYRRKIIEFASQIKKSA* |
Ga0070683_1000421331 | 3300005329 | Corn Rhizosphere | MTVAKIIKFYIPNNFQKSVKWISSEQRGKIIEIASPVKKSA* |
Ga0066388_1011147012 | 3300005332 | Tropical Forest Soil | MAKVIEFYVPNTFRKSLTQVAPQQRGKVIEFRLQTMKSA* |
Ga0066388_1030010201 | 3300005332 | Tropical Forest Soil | LAKVIEFYIPNNFRKSMKWVSPEQRGKMIEFASHIKKPA* |
Ga0070714_1003220502 | 3300005435 | Agricultural Soil | MRRQRRTVAKVIEFYIPNNFRKKLKWISPELRGKIVQFAPPAKKSA* |
Ga0070711_1000484652 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKVIEFYIPKNFRKQSKWISPETRGKIVQFAPPVKKSA* |
Ga0070708_1010390011 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVAKIIEFYIPNNFRKNVKWVSPEQRGKIIDFASRIKKSA* |
Ga0070708_1016082011 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKVIEFYIPNNVRKSLKWVSPEQRGKIIEFAPPVKKSA* |
Ga0070706_10000553610 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVAKVIEFYIPNTFRKSMKWVSSEQRGKIIEFASQTKKSA* |
Ga0070733_102167151 | 3300005541 | Surface Soil | MAVAKVIEFYVPNNFRRRVKWVSPERRGKVLAFGTAN |
Ga0070732_100040694 | 3300005542 | Surface Soil | MTMARVIEFYIPSNYRKSMKWVTPELRGKILEFPSPAKKSA* |
Ga0070732_100406674 | 3300005542 | Surface Soil | VAKVIGFYIPNNFRKSVKWVSPEQRGKIIEFASQIKKSA* |
Ga0070732_100561163 | 3300005542 | Surface Soil | MTVAKVIEFYIPNNFRESLKWVCTSQRGKIIEFTLQVKKSA* |
Ga0070704_1021181721 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAVTTVAKVIEFYIPNHFRRSLKWVSAEGRGKIIEFARPMSKSA |
Ga0066701_101170892 | 3300005552 | Soil | VRELEEKAGMTVAKVIEFYIPNIFRKSVKSVSREQRGKIIEFASPIKKSA* |
Ga0066661_102920911 | 3300005554 | Soil | IEFYIPNNFRKSVKWVSPEQRGKIVEFVSQPKKSA* |
Ga0066661_108786781 | 3300005554 | Soil | MTVAKVIEFYIPGTFRKSVKWVSREQRRKIIEFASPIKKSA* |
Ga0066699_102403892 | 3300005561 | Soil | MTVAKVIEFYIPGTFRKSVKWVSREQRGKIIEFASPIKKSA* |
Ga0066703_102526822 | 3300005568 | Soil | GILEETAGMTVAKVIEFYIPGTFRKSVKWVSREQRGKIIEFASPIKKSA* |
Ga0066703_107949782 | 3300005568 | Soil | MTVAKVIEFYIPENFRKSVKWVSPQRRGKIIEFASQIKKSA* |
Ga0066705_104512591 | 3300005569 | Soil | ETAGMTVAKVIEFYLPNRFRKSVKWVSPEQCGKIIEFASEIKKSA* |
Ga0068856_1002517031 | 3300005614 | Corn Rhizosphere | EGRQTVAKVIEFYTPNNFRKSPKWVSAEQRGKIIEFAPQVKKSA* |
Ga0068851_101432382 | 3300005834 | Corn Rhizosphere | VAKIIEFYIPNNFRKSVKWMPSKQRGKIIEFASQAKKSA* |
Ga0070766_1000216313 | 3300005921 | Soil | MMMAKIIEFYIPNNFRKRVKWVSLQQRGKIIEFASPMKKSA* |
Ga0070766_106548071 | 3300005921 | Soil | VANVIEIYIPNNFRRNVKWVPLEKRGKIIEFVSQIQKSA* |
Ga0070766_106732473 | 3300005921 | Soil | MTVAKVIEFYTYPKSSEKWVSPERRGKIIEFASLIKKSA* |
Ga0079220_117321451 | 3300006806 | Agricultural Soil | VAKVIEFYIPNNFRKSVKWVSPEQRGKIIEFASQIKKSA* |
Ga0075434_1003753611 | 3300006871 | Populus Rhizosphere | AKVIEFYIPKNFQSPRKPGAEMQSGKIIEFRSPAKKSA* |
Ga0068865_1000047232 | 3300006881 | Miscanthus Rhizosphere | VAKIIEFYTPNNFRKSVKWIPSEQRGKIIEFASQVKKSA* |
Ga0073928_104509662 | 3300006893 | Iron-Sulfur Acid Spring | MAVGKVIEFYIPKNFQKSVKWVSPEQRGKIVEFVSPTKKSA* |
Ga0075424_1019213872 | 3300006904 | Populus Rhizosphere | ARVCTHWRMAMAHVIEFYIPNRFRKNVKWVRAQQRGTVIEFPSQIKKSA* |
Ga0099793_100144644 | 3300007258 | Vadose Zone Soil | MTVAKVIEFYIPRNFRKTVKWDSREQRGKIIEFASPIKKSA* |
Ga0102924_12470141 | 3300007982 | Iron-Sulfur Acid Spring | VIEFYIPTNFRKSVKWASPEQRGKITEFAPQVKKSA* |
Ga0099828_108457931 | 3300009089 | Vadose Zone Soil | MIVAKVIEFYIPNTFRKSMKWVSSGQRGKIIEFASQAKKSA* |
Ga0099827_104234462 | 3300009090 | Vadose Zone Soil | MEFYIPNSFRKKLKWISPELRGKIVQFAPPVKKSA* |
Ga0099827_107759631 | 3300009090 | Vadose Zone Soil | MRESLGEKSGLTVAKVIEFYIPNSFRKSMKWVSPEQRGRIIEFVPQVKKSA* |
Ga0066709_1036634051 | 3300009137 | Grasslands Soil | MTVAKVIEFYIPNNFRKTGKWVSPEHRGRIIEFAPQNKKSA* |
Ga0126370_105967112 | 3300010358 | Tropical Forest Soil | VAKVIEFYIPNNFRKSVRRVSAEHRGKIIEFASQTKKSA* |
Ga0126381_1037907681 | 3300010376 | Tropical Forest Soil | REGRQTVAKVIEFYIPNNFRKSVKWVSPEQRGKIIEFASQIKKSA* |
Ga0126383_105310543 | 3300010398 | Tropical Forest Soil | VAKIIEFYIPNNFRKRVKWVSPAERGKIIELPAAIKKSA* |
Ga0137392_105236882 | 3300011269 | Vadose Zone Soil | MTVAKVIEFYIPNTFRKSMKWVSSEQRGKIIEFASLTKKSA* |
Ga0137392_113931981 | 3300011269 | Vadose Zone Soil | EQKAGLTVARVIEFYIPNNFRKSVKWVSPEQRGKIIEFAPQVKKSA* |
Ga0137391_100806443 | 3300011270 | Vadose Zone Soil | MTVAKVIEFYIPNTFRKSMKWVSSGQRGKIIEFASQAKKSA* |
Ga0120139_10740961 | 3300012019 | Permafrost | MAKVIEFYIPNTFRKSVKWVSPEQRGKIIEFASQIKKTA* |
Ga0137364_113968151 | 3300012198 | Vadose Zone Soil | RLVAKVIEFYIPTNFQKNVKWVSPECRGKIIEFASQIKKSA* |
Ga0137383_100289485 | 3300012199 | Vadose Zone Soil | EKAGLTVAKVIEFYIPTNFQKSVKWGPPEQRGKIIEFAPQVKKSA* |
Ga0137383_103112081 | 3300012199 | Vadose Zone Soil | MRESLGEKAGLTVAKVIEFYIPTNFRKSVKWGSPEQRGKIIEFAPQVKKSA* |
Ga0137382_101653352 | 3300012200 | Vadose Zone Soil | MRESLGEKAGLTVAKVIEFYIPTNFQKSVKWGPPEQRGKIIEFAPQVKKSA* |
Ga0137399_100194076 | 3300012203 | Vadose Zone Soil | MRESLGEKAGLTVAKVIEFYIPTNFRKSVKWGSLEQRGKIIEFAPQVKKSA* |
Ga0137362_110223011 | 3300012205 | Vadose Zone Soil | MACGILEEKAGMTVAKVIEFYIPNNFRKSVKWVSPEQRGKIVEFVSQPKKSA* |
Ga0137379_100580102 | 3300012209 | Vadose Zone Soil | VEKVIEFYIPTNFQKNVKWVSPEHRGKIIEFASQIKKSA* |
Ga0137378_116019232 | 3300012210 | Vadose Zone Soil | VAKVIEFYIPNSFRKKLKWISPELRGKIVQFAPPVKKSA* |
Ga0137387_103484153 | 3300012349 | Vadose Zone Soil | AKVIEFYIPNSFRKKLKWISPELRGKIVQFAPPVKKSA* |
Ga0137386_103611181 | 3300012351 | Vadose Zone Soil | VEKVIEFYIPTNFQKNVKWVSPEHRGKIIEFASQIKK |
Ga0137386_104751573 | 3300012351 | Vadose Zone Soil | LTVAKVIEFYIPTNFQKSVKWGPPEQRGKIIEFAPQVKKSA* |
Ga0137386_106835901 | 3300012351 | Vadose Zone Soil | KKRQGRLVAKVIEFYIPTNFQKNVKWVSPECRGKIIEFASQIKKAA* |
Ga0137360_101404212 | 3300012361 | Vadose Zone Soil | MACGILEEKAGMTVAKVIEFYIPNTFRKSMKWVSSEQRGKIIEFASQTKKSA* |
Ga0137419_106020801 | 3300012925 | Vadose Zone Soil | VAKIIEFYIPNNFRKSVKWVPPEQRGKMIEFASQIKKSA* |
Ga0137416_100662595 | 3300012927 | Vadose Zone Soil | MTVAKVIEFYIPNTFRKSMKWVPSGQRGKIIEFASQTKKSA* |
Ga0137404_101785772 | 3300012929 | Vadose Zone Soil | VAKVIEFYIPNNLRKTLKWVSPEQRGKIIEFVPPVKKSA* |
Ga0137404_108636021 | 3300012929 | Vadose Zone Soil | KVIEFYMPNNYRKSVKWVSPQRRGKIIEFASQIKKSA* |
Ga0137407_101329872 | 3300012930 | Vadose Zone Soil | MTVAKVIEFYIPNNFGKKVKWVSPQRRGKIIEFASQIKKSA* |
Ga0137407_117901531 | 3300012930 | Vadose Zone Soil | VGTLEVKAGMTEAKVIEFYIPNNFRKNVKWVSPEQRGKIVEFSSQ |
Ga0137410_110696882 | 3300012944 | Vadose Zone Soil | EFYISTNLRKSLKWVAPEQRGKIFEFVPPVKKSA* |
Ga0157376_100250771 | 3300014969 | Miscanthus Rhizosphere | ERKAGTTMAKVIEFYMPNNVRKNLKWFSREQRGKIIEFAPPVKKSA* |
Ga0132258_105721901 | 3300015371 | Arabidopsis Rhizosphere | VAKVIEFYIPKNFRKSSKWVSAEQRGKIIEFAPPLKKSA* |
Ga0132256_1011731312 | 3300015372 | Arabidopsis Rhizosphere | MAKVIEFDMPNNVRKNLKWFSREQRGKIIEFAPPVKKSA* |
Ga0132257_1001731822 | 3300015373 | Arabidopsis Rhizosphere | EDILESKAVTTVAKVIEFYIPNHFRRSLKWVSAEGRGKIIAFARPMSKSA* |
Ga0132257_1031184221 | 3300015373 | Arabidopsis Rhizosphere | EDILESKAVTTVAKVIEFYIPNHFRRSLKWVSAEGRGKIIEFARPMSKSA* |
Ga0182038_118107091 | 3300016445 | Soil | MSGLAGILEEKSGMTMAKIIEFYTPNIFRRRVKWVSSEQRGKIIEFPSQMKKSA |
Ga0187818_102763411 | 3300017823 | Freshwater Sediment | MTVAEVIEFYIPNNFQGSVKWVSPEQRGKIIEFPAKVKKSA |
Ga0187814_100770592 | 3300017932 | Freshwater Sediment | MTVAKVIDFYIPNNFRKNVKWVPPEQRGKIIEFASQIKKSA |
Ga0187819_106025641 | 3300017943 | Freshwater Sediment | GMTVAEVIEFYIPNNFQGNVKWVSPERRGRIIEFPSQIKKSA |
Ga0187817_104561702 | 3300017955 | Freshwater Sediment | GLEEKAGMTMAKIIEFYIPNNFRKRVKWVSPEQRGKIIEFPSEMKKSA |
Ga0187777_111916761 | 3300017974 | Tropical Peatland | MMQGILKEKAEMIVAKIIEFYIPGNFRKSVTWVPPQQRGKIIQFPSQVKKSA |
Ga0187804_103626071 | 3300018006 | Freshwater Sediment | LSVRVGVAGLEEKAGTTVAKVIEFYIPNNFRKRVKWVSPEQRGKIIEFPSEMKKSA |
Ga0187805_102644611 | 3300018007 | Freshwater Sediment | VGSLEKKAEITVAKIIAFYIPNNFRKSVKWISPEQRGKIIEFPAQVQ |
Ga0187805_105479791 | 3300018007 | Freshwater Sediment | MTVAKVIEFYVPNSFRKSTKWISPEQRGKIIEFALQTK |
Ga0187862_104178392 | 3300018040 | Peatland | VAKVIEFYIPKKFRKTMKWVSPEQRGKIIEFASHQR |
Ga0187766_112901921 | 3300018058 | Tropical Peatland | MMQGILKDKAEMIVAKVIEFYIPGNFRKSVTWVPPQQRGKIIQFPSQVKKSA |
Ga0187773_100154941 | 3300018064 | Tropical Peatland | MAKIIQFYIPNNFRKSGKWIPQENRGKIIEFPLPAKKTA |
Ga0193751_10222911 | 3300019888 | Soil | MTVAKVIEFYIPNNFRKSVKWVSPEQRGKIVEFVSQPKKSA |
Ga0179594_103831252 | 3300020170 | Vadose Zone Soil | SVRELEGKTGMTVAKVIEFYIPNNFRKSVKWVSPQRRGKIIEFASQIKKSA |
Ga0210407_100398742 | 3300020579 | Soil | VAKVIEFYIPKNFRKQSKWISPELRGKIVQFAPPVKKSA |
Ga0210407_111997751 | 3300020579 | Soil | MTMAKIIEFYIPNHFRKRVKWVSPAERGKIIEFPSEMKKSA |
Ga0210403_101930572 | 3300020580 | Soil | VAKVIEFYIPDNSRKSMKWVPPELRGKIIEFDSQIKKSA |
Ga0210403_106231782 | 3300020580 | Soil | MTMAKIIEFYIPNNFRKRVKWVSPEQRGKIIEFPSEMKKSA |
Ga0210403_109408751 | 3300020580 | Soil | VRVGVAGLEEKAGMTMAKIIEFYIPNNFRKRVKWVSLQQRGKIIEFPSEMKKSA |
Ga0210403_110054111 | 3300020580 | Soil | MRPKSGLDEKAGMTMAKIIEFYIPNNFRKRVKWVAPEQRGKIVAFPSELKKSA |
Ga0210399_102736232 | 3300020581 | Soil | VGVAGLEEKAGMTVAKVIEFYIPNNFRKRVKWVSPQQRGKIIEFASQMKKSA |
Ga0210399_104969491 | 3300020581 | Soil | RRAGMTVAKVIEFYIPNNFRKKVKWVSPAERGKIIEFASEIKKSA |
Ga0210399_115289371 | 3300020581 | Soil | MTMAKIIEFYIPNNFRKRVKWVSPEQCGKIIEFPSEMKKSA |
Ga0210401_1000164112 | 3300020583 | Soil | MAKVIEFYIPNNFRKKVKWVSPERRGKIIEFPSQMKKSA |
Ga0210401_102378993 | 3300020583 | Soil | IEFYIPKNFRKSSKWVSAEQRGKIIEFAPPVNKSA |
Ga0210401_107435031 | 3300020583 | Soil | MTVAKVIEFYIPNNFRKRVKWVSPEQRGKIIEFASQMKKSA |
Ga0215015_111129222 | 3300021046 | Soil | MNVAKVIEFYIPNTFRKSVKWVSPEQRGKIIEFASQIKKSA |
Ga0210404_108617241 | 3300021088 | Soil | MTVAKVIEFYIPNNFRKSVKWVSPEQRGKVVEFVSQPKKSA |
Ga0210400_102510611 | 3300021170 | Soil | IARGNLEGKEGMAVGKVIEFYIPKNFQKSVKWVSPEQRGKIVEFVPQTKKSA |
Ga0210405_100014838 | 3300021171 | Soil | VGVAGLEEKAGMTMAKIIEFYIPNNFRKRVTWVSPEQRGKIIEFSSPMKKSA |
Ga0210405_102315852 | 3300021171 | Soil | MTMAKIIEFYIPNNFRKSVKWVSPERRGKIIEFPSEMKKSA |
Ga0210405_103756122 | 3300021171 | Soil | VAKVIEFYIPKNFRKSSKWVSAEQRGKIIEFAPPVNKSA |
Ga0210408_101141813 | 3300021178 | Soil | MTMARIIEFYIPNNFRKRVKWVSPEQRGKIIEFASPMKKSA |
Ga0210408_101310613 | 3300021178 | Soil | EGRQTVAKVIEFYIPNNFRKSMKWVSPEQRGKIIEFASQIKKSA |
Ga0210396_100040977 | 3300021180 | Soil | MAKVIEFYIPNNFRKRVKWVSPERRGKIIEFPSQMKKSA |
Ga0210387_103919762 | 3300021405 | Soil | VGVAGLEEKAGMTMAKIIEFYIPNNFRKREKWVCPEQRGKIIEFPSQMKKSA |
Ga0210387_113200571 | 3300021405 | Soil | SGLEEKVETTMAKIIGFYIPNNFRKMVKCVSPEQRGKIIEFPSPMKKSA |
Ga0210394_106588312 | 3300021420 | Soil | IEFYIPNNFRKRVKWVSPEQRGKIIEFASPMKKSA |
Ga0210384_101621422 | 3300021432 | Soil | MTMAKIIEFYIPNNFRKRVKWVSPEKRGKVIEFASPMKKSA |
Ga0210402_100652863 | 3300021478 | Soil | MCSALSVRVGVAGLRVEEKAGMTVAKVIEFYIPNNFRKRVKWVSPERRGKIIEFPSELKKSA |
Ga0210402_101426101 | 3300021478 | Soil | GLEEKAGMTMAKIIEFYIPNNFRKRVKWVSLQQRGKIIEFPSEMKKSA |
Ga0210402_104175383 | 3300021478 | Soil | MAMAKIIEFYIPNNFRKRVKWVAPEQRGKIIEFPAELKKSA |
Ga0210402_107393011 | 3300021478 | Soil | MTVAKVIEFYIPNNFRKRVEWVSPEQRGKIIVFPSEMKKSA |
Ga0210402_108222072 | 3300021478 | Soil | MFHKTESGLEEKAGMTMAKIIEFYVPNNFRKRVKWVSPEQRGKIIEFASPMKKSA |
Ga0210402_108510811 | 3300021478 | Soil | MTMAKIIEFYIPNNFRKRVKWVAPEQRGKIVAFPSELKKSA |
Ga0210402_112903291 | 3300021478 | Soil | MAKIIEFYIPNNFRNRVKWVSPEQRGKIIEFPSQMKKSA |
Ga0210410_103304552 | 3300021479 | Soil | MAVGKVIEFYIPKNFQKSVKWVSPEQRGKIVEFVPQTKKSA |
Ga0210410_106482791 | 3300021479 | Soil | MAKIIEFYIPDQFRSTVKWVSREERGKIIEFVPPAKKSA |
Ga0210409_101345941 | 3300021559 | Soil | MTVAKVIEFYIPKNFRKNVKWVSPEQRGKIVEFVSQPKKSA |
Ga0212123_103814621 | 3300022557 | Iron-Sulfur Acid Spring | MAVGKVIEFYIPKNFQKSVKWVSPEQRGKIVEFVSPTKKSA |
Ga0224563_10221511 | 3300022731 | Soil | VGVAGLEKKAGMTMAKIIEFYIPNKFRKRVKWVSPEQRGKIIEFASPMKKSA |
Ga0247794_102614351 | 3300024055 | Soil | TTVAKVIEFYIPNHFRRSLKWVSAEGRGKIIEFARPMSKSA |
Ga0207688_107002022 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | KAGRTVAKVIEFYIPNNFRKNPKWVSREQRGKVIEFAPAVKKSA |
Ga0207684_1000964111 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVAKVIEFYIPNNFRKSVKWVSPQRRGKIIEFASQIKKSA |
Ga0207684_1001485710 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVAKVIEFYIPNTFRKSMKWVSSEQRGKIIEFASQTKKSA |
Ga0207660_114662691 | 3300025917 | Corn Rhizosphere | MKAVTTVAKVIEFYIPNHFRRSLKWVSAEGRGKIIEFARPMS |
Ga0207646_116588951 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TEAGTTVAKVIEFYIPNTFRKSMKWVSSEQRGKIIEFASQTKKSA |
Ga0207694_108846062 | 3300025924 | Corn Rhizosphere | IEFYRPNNFRKSVKWVSPEQRGKIIEFAPQVKKSA |
Ga0207689_113777022 | 3300025942 | Miscanthus Rhizosphere | MTVAKIIKFYIPNNFQKSVKWISSEQRGKIIEIASPVKKSA |
Ga0207639_103567171 | 3300026041 | Corn Rhizosphere | EQKAGLAVSKVIEFYRPNNFRKSVKWVSPEQRGKIIEFAPQVKKSA |
Ga0207702_119107051 | 3300026078 | Corn Rhizosphere | ANSERNLRREGRQTVAKVIEFYTPNNFRKSPKWVSAEQRGKIIEFAPPVKKSA |
Ga0257170_10366531 | 3300026351 | Soil | VAKVIEFYIPNNLRKSLKWVSPEQRGKIIEFVPPVKKSA |
Ga0209056_103795281 | 3300026538 | Soil | ETAGRTVAKVIEFYLPNRFRKSVKWVSPEQCGKIIEFASEIKKSA |
Ga0209805_11444123 | 3300026542 | Soil | MTVAKVIEFYIPGTFRKSVKWVSREQRGKIIEFASPIKKSA |
Ga0209648_104222721 | 3300026551 | Grasslands Soil | LTVAKVIEFYIPDNSRKSMKWVPPELRGKIIEFDSQIKKSA |
Ga0209332_10639651 | 3300027439 | Forest Soil | VAKVIEFYIPNQFRRAVKWVSREQRGKIIEFAPPAKKSA |
Ga0209219_10001886 | 3300027565 | Forest Soil | MTVAKVIEFYIPNTFRKSVKWVCPEQRGKIIEFVSQIKKSA |
Ga0209219_11493621 | 3300027565 | Forest Soil | MTVAKVIEFYIPNNFRKSVKWVSPEQRGKIVEFVSQTKKSA |
Ga0209220_10248181 | 3300027587 | Forest Soil | GILEEKAGMTVAKVIEFYIPNNFRKSVKWVSPEQRGKIVEFVSQTKKSA |
Ga0209076_10618253 | 3300027643 | Vadose Zone Soil | MTVAKVIEFYIPRNFRKTVKWDSREQRGKIIEFASPIKKSA |
Ga0209118_11770431 | 3300027674 | Forest Soil | MTVAKVIEFYIPNTFRKSVKWVSPEQRGKIIEFVSQIKKSA |
Ga0209693_100539563 | 3300027855 | Soil | MMMAKIIEFYIPNNFRKRVKWVSLQQRGKIIEFASPMKKSA |
Ga0209590_108499741 | 3300027882 | Vadose Zone Soil | MRESLGEKSGLTVAKVIEFYIPNSFRKSMKWVSPEQRGRIIEFVPQVKKSA |
Ga0209275_107282471 | 3300027884 | Soil | ENAGMTMAKIIEFYIPNSFRKRVKWVSPERRGKIIEFPSQMKKSA |
Ga0209488_109260701 | 3300027903 | Vadose Zone Soil | MTVAKVIEFYIPNTFRKSMKWVSSGQRGKIIEFASQTKKSA |
Ga0209006_100149725 | 3300027908 | Forest Soil | MTVAKLIEFYIPDQFQRTVKWLSREERGKIIEFVPPAKKSA |
Ga0209526_100087302 | 3300028047 | Forest Soil | MTVAKVIEFYIPNTFRKSVKWVSPEQRGKIIEFVLQIKKSA |
Ga0307504_101977632 | 3300028792 | Soil | MRESLGEKAELTVAKVIEFYIPTNFRKSVKWGSPEQRGKIIEFAPQVKKSA |
Ga0170834_1098450412 | 3300031057 | Forest Soil | MRESLVEKAELTVAKVIEFYIPTNFRKSVKWGSPEQRGRIIEFAPSVKKSA |
Ga0170824_1119075311 | 3300031231 | Forest Soil | QIDLRYSIFHATERCLAKAGMTMAKIIEFYIPNNFRKRVKWISPEQRGKIIEFASQMKKS |
Ga0310686_1033587401 | 3300031708 | Soil | MTVAKVIEFYIPNNFRKRVKWISREQRGKIIEFASQMKKSA |
Ga0310686_1044017223 | 3300031708 | Soil | TMAKIIEFYMPNNFRKRVKWVSPERRGKIIEFPSQMKKSA |
Ga0310686_1060877951 | 3300031708 | Soil | MIVAKVIKFYIPNNFRRSVKWVSPEQRGKILEFAVQTKKSA |
Ga0310686_10628633310 | 3300031708 | Soil | MAKIIKFYMPNNFRKRVKWVSPERRGKIIEFPAQMKKSA |
Ga0310686_1066137972 | 3300031708 | Soil | VGVAGLEVKAGMTMAKIIEFYIPNNFRKRVKWVSPEQRGKIIEFASPMKKSA |
Ga0310686_1095175862 | 3300031708 | Soil | TPIVHTTESGLEEDAGMTMAKIIEFYIPNSFRKRVKWVSPERRGKIIEFPSQMKKSA |
Ga0310686_1140869871 | 3300031708 | Soil | MTMAKIIEFYIPNNFRKSVKWVAPEQRGKIIEFPSEMKKSA |
Ga0307474_1000296310 | 3300031718 | Hardwood Forest Soil | MARVIEFYIPSNYRKSMKWVAPELRGKILEFPSPVKKSA |
Ga0307474_104031052 | 3300031718 | Hardwood Forest Soil | MAKIIEFYIPTAFRKSEKWVPPRKRGKIIEFVPETKKTA |
Ga0307469_103811522 | 3300031720 | Hardwood Forest Soil | MRESLGEKAGLTVAKVIEFYIPTNFRKSVKWGSPEQRGKIIEFAPQVKKSA |
Ga0307477_100355254 | 3300031753 | Hardwood Forest Soil | MTMARVIEFYIPSNYRKSMKWVAPELRGKILEFPSPVKKSA |
Ga0307475_103968332 | 3300031754 | Hardwood Forest Soil | ARGNLRKEGRQTVAKVIGFYIPNNFRKSVKWVSPEQRGKIIEFASQIKKSA |
Ga0307479_106358302 | 3300031962 | Hardwood Forest Soil | MTVAKVIEFYIPKNVRKSVKWVSAEHRGKIIEFASPIKKSA |
Ga0307479_116527271 | 3300031962 | Hardwood Forest Soil | MTVAKVIEFYIPNSFRKSAKWISPEQRGKIIEFALQTK |
Ga0307471_1008515323 | 3300032180 | Hardwood Forest Soil | ARVIEFYIPKNFRKCSKWVSAEQRGKVIEFAPPVKKSA |
Ga0307471_1014278241 | 3300032180 | Hardwood Forest Soil | LPGATPIVHATESGLDEKAGMTMAKIIEFYIPNNFRKRVKWVSPEQRGKIIEFPSEMKKS |
Ga0307472_1001183181 | 3300032205 | Hardwood Forest Soil | MRESSGEKAGLTVAKVIEFYIPTNFRKSVKWGSPEQRGKIIEFAPQVKKSA |
Ga0307472_1002470292 | 3300032205 | Hardwood Forest Soil | NSVRELEGKTGMTVAKVIEFYIPNNFRKSVKWVSPQRRGKIIEFASQIKKSA |
Ga0307472_1008761922 | 3300032205 | Hardwood Forest Soil | MTMAKIIKFYIPNNFRKRVKWVSPEKRGKIIEFHSEMKKSA |
Ga0335079_113401452 | 3300032783 | Soil | VAKIIEFYIPNRFRKNVKWVSPEERGKVIEFPQPIKKSA |
Ga0335078_121299641 | 3300032805 | Soil | IQFYIPSNFRRSTKWVPPELRGKIIEFPAQIKKSA |
Ga0335080_102398182 | 3300032828 | Soil | MTVAKIIEFYIPNNFRKSVKWVAPEQRGKIIQFPPQVKKSA |
Ga0335077_108755242 | 3300033158 | Soil | MAKLIEFYIPATFRKNGKWIPPEQRGKIIEFPVEAKKSA |
⦗Top⦘ |