NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F030332

Metagenome / Metatranscriptome Family F030332

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030332
Family Type Metagenome / Metatranscriptome
Number of Sequences 185
Average Sequence Length 101 residues
Representative Sequence MDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILNRAHNPGRAPQVECRRDR
Number of Associated Samples 113
Number of Associated Scaffolds 185

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 35.14 %
% of genes near scaffold ends (potentially truncated) 34.59 %
% of genes from short scaffolds (< 2000 bps) 96.76 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.757 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(70.270 % of family members)
Environment Ontology (ENVO) Unclassified
(83.243 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(61.081 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.71%    β-sheet: 4.65%    Coil/Unstructured: 73.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 185 Family Scaffolds
PF13456RVT_3 16.76
PF00665rve 9.19
PF00078RVT_1 2.70
PF03732Retrotrans_gag 0.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 185 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 9.19
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 9.19
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 9.19
COG4584TransposaseMobilome: prophages, transposons [X] 9.19

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.30 %
UnclassifiedrootN/A2.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005353|Ga0070669_100762189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum820Open in IMG/M
3300005365|Ga0070688_101800560All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300005719|Ga0068861_102182977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum554Open in IMG/M
3300005844|Ga0068862_102004344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum590Open in IMG/M
3300009092|Ga0105250_10472567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum565Open in IMG/M
3300009101|Ga0105247_10593806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii820Open in IMG/M
3300009177|Ga0105248_11161690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum873Open in IMG/M
3300009177|Ga0105248_11963345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum664Open in IMG/M
3300009553|Ga0105249_12539217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300009553|Ga0105249_13412849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300009553|Ga0105249_13413244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum511Open in IMG/M
3300009971|Ga0105127_10409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1006Open in IMG/M
3300009972|Ga0105137_104120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum672Open in IMG/M
3300009973|Ga0105136_102272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum930Open in IMG/M
3300009975|Ga0105129_120669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum511Open in IMG/M
3300009976|Ga0105128_113676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum590Open in IMG/M
3300009977|Ga0105141_125879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300009981|Ga0105133_125886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum541Open in IMG/M
3300009985|Ga0105036_123748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum553Open in IMG/M
3300009990|Ga0105132_104016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1001Open in IMG/M
3300009992|Ga0105120_1047405All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300009994|Ga0105126_1053705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum514Open in IMG/M
3300009995|Ga0105139_1001914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1868Open in IMG/M
3300009995|Ga0105139_1026126All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum911Open in IMG/M
3300009995|Ga0105139_1068462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum655Open in IMG/M
3300009995|Ga0105139_1070950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum646Open in IMG/M
3300009995|Ga0105139_1098049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300009995|Ga0105139_1115506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300009995|Ga0105139_1124367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300010267|Ga0134101_1064251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum638Open in IMG/M
3300010371|Ga0134125_13034445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300010373|Ga0134128_11866314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum661Open in IMG/M
3300010373|Ga0134128_12236807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300010396|Ga0134126_11931116All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300010396|Ga0134126_12039612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum627Open in IMG/M
3300010396|Ga0134126_12200161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum602Open in IMG/M
3300010399|Ga0134127_13022054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300010399|Ga0134127_13274387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum530Open in IMG/M
3300010400|Ga0134122_12780670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300010401|Ga0134121_12939372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300010401|Ga0134121_12977863All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300010403|Ga0134123_11998322All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum638Open in IMG/M
3300010403|Ga0134123_12923686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300012949|Ga0153798_10259077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum580Open in IMG/M
3300013306|Ga0163162_12250930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum626Open in IMG/M
3300014325|Ga0163163_10995631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii901Open in IMG/M
3300014325|Ga0163163_13224352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300014326|Ga0157380_11408467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum748Open in IMG/M
3300014326|Ga0157380_13419757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015270|Ga0182183_1007772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1033Open in IMG/M
3300015270|Ga0182183_1084412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300015278|Ga0182099_1036426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum615Open in IMG/M
3300015278|Ga0182099_1037602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300015280|Ga0182100_1064533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum587Open in IMG/M
3300015284|Ga0182101_1075609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum556Open in IMG/M
3300015284|Ga0182101_1096259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300015293|Ga0182103_1060513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum603Open in IMG/M
3300015293|Ga0182103_1077638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300015297|Ga0182104_1039297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum741Open in IMG/M
3300015297|Ga0182104_1039557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum739Open in IMG/M
3300015297|Ga0182104_1052538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum674Open in IMG/M
3300015301|Ga0182184_1049567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum642Open in IMG/M
3300015301|Ga0182184_1072141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015306|Ga0182180_1045685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum653Open in IMG/M
3300015306|Ga0182180_1054926All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum612Open in IMG/M
3300015310|Ga0182162_1082717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum596Open in IMG/M
3300015310|Ga0182162_1124284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300015312|Ga0182168_1039226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum796Open in IMG/M
3300015312|Ga0182168_1080892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300015312|Ga0182168_1096054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300015313|Ga0182164_1068118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum658Open in IMG/M
3300015316|Ga0182121_1061458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum710Open in IMG/M
3300015316|Ga0182121_1087377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum621Open in IMG/M
3300015317|Ga0182136_1036839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum818Open in IMG/M
3300015317|Ga0182136_1042950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum778Open in IMG/M
3300015317|Ga0182136_1135826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum510Open in IMG/M
3300015318|Ga0182181_1106331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300015319|Ga0182130_1062971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum668Open in IMG/M
3300015319|Ga0182130_1101943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum563Open in IMG/M
3300015320|Ga0182165_1056597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum725Open in IMG/M
3300015320|Ga0182165_1061753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum704Open in IMG/M
3300015320|Ga0182165_1075396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum654Open in IMG/M
3300015324|Ga0182134_1046725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum773Open in IMG/M
3300015324|Ga0182134_1149903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300015327|Ga0182114_1062733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum734Open in IMG/M
3300015327|Ga0182114_1137250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015328|Ga0182153_1043022All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum802Open in IMG/M
3300015328|Ga0182153_1071979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum671Open in IMG/M
3300015328|Ga0182153_1078250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum652Open in IMG/M
3300015329|Ga0182135_1030767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii906Open in IMG/M
3300015329|Ga0182135_1134251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015329|Ga0182135_1139774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum525Open in IMG/M
3300015330|Ga0182152_1092543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300015330|Ga0182152_1130705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300015331|Ga0182131_1052462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum763Open in IMG/M
3300015331|Ga0182131_1150005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300015332|Ga0182117_1155908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300015332|Ga0182117_1162432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300015333|Ga0182147_1119478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300015334|Ga0182132_1105818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum613Open in IMG/M
3300015334|Ga0182132_1120940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum580Open in IMG/M
3300015334|Ga0182132_1160285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum514Open in IMG/M
3300015335|Ga0182116_1074576Not Available728Open in IMG/M
3300015336|Ga0182150_1122014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum571Open in IMG/M
3300015336|Ga0182150_1128628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300015336|Ga0182150_1163359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015337|Ga0182151_1093973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum633Open in IMG/M
3300015337|Ga0182151_1094736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300015337|Ga0182151_1116652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300015338|Ga0182137_1128949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum581Open in IMG/M
3300015339|Ga0182149_1168873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300015340|Ga0182133_1030998All Organisms → Viruses → Predicted Viral1018Open in IMG/M
3300015340|Ga0182133_1167662All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300015340|Ga0182133_1178957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300015340|Ga0182133_1193452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300015348|Ga0182115_1023177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1613Open in IMG/M
3300015348|Ga0182115_1205406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300015348|Ga0182115_1260762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300015349|Ga0182185_1010986All Organisms → cellular organisms → Eukaryota1806Open in IMG/M
3300015350|Ga0182163_1007461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2185Open in IMG/M
3300015350|Ga0182163_1168931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum683Open in IMG/M
3300015352|Ga0182169_1169913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum713Open in IMG/M
3300015352|Ga0182169_1201053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum651Open in IMG/M
3300015353|Ga0182179_1000803All Organisms → cellular organisms → Eukaryota4271Open in IMG/M
3300015353|Ga0182179_1068607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1009Open in IMG/M
3300015353|Ga0182179_1124876All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum787Open in IMG/M
3300015353|Ga0182179_1196052All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum642Open in IMG/M
3300015353|Ga0182179_1216173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum613Open in IMG/M
3300015353|Ga0182179_1233659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
3300015353|Ga0182179_1238667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum585Open in IMG/M
3300015354|Ga0182167_1365823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300017412|Ga0182199_1195622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum512Open in IMG/M
3300017421|Ga0182213_1134951All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum692Open in IMG/M
3300017422|Ga0182201_1050032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum722Open in IMG/M
3300017432|Ga0182196_1085388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum621Open in IMG/M
3300017432|Ga0182196_1093891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum601Open in IMG/M
3300017439|Ga0182200_1002628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2042Open in IMG/M
3300017692|Ga0182210_1102280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300017694|Ga0182211_1071651Not Available802Open in IMG/M
3300020023|Ga0182178_1006031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum792Open in IMG/M
3300025925|Ga0207650_11294939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum620Open in IMG/M
3300026088|Ga0207641_11096210All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum795Open in IMG/M
3300028056|Ga0268330_1021415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum732Open in IMG/M
3300028062|Ga0268342_1019493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum664Open in IMG/M
3300028473|Ga0268319_1001177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1239Open in IMG/M
3300028529|Ga0268311_1004040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum920Open in IMG/M
3300032464|Ga0214492_1076008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum641Open in IMG/M
3300032465|Ga0214493_1008913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1895Open in IMG/M
3300032466|Ga0214503_1211663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300032466|Ga0214503_1219594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300032468|Ga0214482_1015406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1345Open in IMG/M
3300032490|Ga0214495_1146408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii524Open in IMG/M
3300032502|Ga0214490_1099612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum664Open in IMG/M
3300032514|Ga0214502_1004122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii3644Open in IMG/M
3300032514|Ga0214502_1058986Not Available1408Open in IMG/M
3300032551|Ga0321339_1146264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300032589|Ga0214500_1052382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1126Open in IMG/M
3300032589|Ga0214500_1072754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii967Open in IMG/M
3300032589|Ga0214500_1129872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum718Open in IMG/M
3300032593|Ga0321338_1019920Not Available1940Open in IMG/M
3300032698|Ga0214485_1042021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii875Open in IMG/M
3300032699|Ga0214494_1103545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300032758|Ga0314746_1099076All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum670Open in IMG/M
3300032759|Ga0314720_1029970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
3300032761|Ga0314733_1002538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2326Open in IMG/M
3300032761|Ga0314733_1014995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1345Open in IMG/M
3300032789|Ga0314725_1027765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum688Open in IMG/M
3300032791|Ga0314748_1002876Not Available2521Open in IMG/M
3300032791|Ga0314748_1084179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum673Open in IMG/M
3300032811|Ga0314718_1036634All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum581Open in IMG/M
3300032821|Ga0314719_1021517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum815Open in IMG/M
3300032821|Ga0314719_1028477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum700Open in IMG/M
3300032821|Ga0314719_1040366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300032822|Ga0314740_1074102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum506Open in IMG/M
3300032823|Ga0314723_1055795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum756Open in IMG/M
3300032889|Ga0314751_1044709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum897Open in IMG/M
3300032913|Ga0314739_1096791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300032959|Ga0314738_1100588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300032976|Ga0314752_1106285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300033525|Ga0314758_1164428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300033525|Ga0314758_1179091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300033530|Ga0314760_1095948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum733Open in IMG/M
3300033532|Ga0314767_1152291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum580Open in IMG/M
3300033533|Ga0314770_1286181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300033539|Ga0314762_1052996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum764Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere70.27%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated9.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil7.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.78%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere2.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.62%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.08%
Switchgrass DegradingEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading1.08%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.54%
Switchgrass LeafHost-Associated → Plants → Phylloplane → Endophytes → Unclassified → Switchgrass Leaf0.54%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009971Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_174 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009985Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_101 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010267Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 12_48_3.3_201_A2 metaGEngineeredOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012949Switchgrass enrichment cultures co-assemblyEngineeredOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028473Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032759Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032811Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032821Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032823Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032913Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032976Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033525Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033539Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070669_10076218913300005353Switchgrass RhizosphereMTSTLASMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVSRILNSAHNPGRAPRMECRRDR*
Ga0070688_10180056023300005365Switchgrass RhizosphereALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGRIVIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVSRILNSAHNPGQAPRMECRWDR*
Ga0068861_10218297713300005719Switchgrass RhizosphereMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRIAFSQSDYALSGHIVIREDVIFQVAPDLGDPCIGSSQSRWGWLCEVTRFLNRAHSPGR
Ga0068862_10200434413300005844Switchgrass RhizosphereMDLREQLATLFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLHEVSRILDRAHNPERAPQVVCRRDR*
Ga0105250_1047256713300009092Switchgrass RhizosphereMDLCEQLVALFLGKAPHEDTIGATAVEIPFYHRVAFSQSYCALSGHIIIRKDIVFQVAPDPGDPCIGTSLSRWEGLYEVSRILDRAHNPGRAPQVECRRDR*
Ga0105247_1059380613300009101Switchgrass RhizosphereMTFTLASMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSDYALSGHIVIREDVIFQVAPDLGDPCIGSSLSRWGWLYEVSRILNRAHSPGWTP*
Ga0105248_1116169023300009177Switchgrass RhizosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILNRAHIPVRAPQVECRRDR*
Ga0105248_1196334513300009177Switchgrass RhizosphereMDLREQLAALFLGNAPHEDTIGVTAVEIPFFHRVAFIQSYYALSGYIVIRKDIVFQVVLDLGDPCIGTSLNRWEWLYEVSRVLDRAHNPGRAPQMECRRDR*
Ga0105249_1253921713300009553Switchgrass RhizosphereMTSTLASMDLREQLAALSLGNAPHEDPIGATAVEIPFYHRIAFSQSHYALSGYMVFRKDIIFQIVPNLGDPCIGTSLCRWEWLYEISRVLNSAH
Ga0105249_1341284913300009553Switchgrass RhizosphereMTSTLVSVDLREQLTALFLGNAPHEDTISATAVDIPFYHRVAFSQSYYALSGDIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILNRAHNPGRAPQVKCRRVR*
Ga0105249_1341324413300009553Switchgrass RhizosphereMTPTLASMDLHEQLAALFLGNAPHEDTIGAMVVEISFYHSVAFSQSYYVLSGHIVIRKDIVFQIVPNLGDPCIGTSLRRWEWRYEVSRVLNSAH
Ga0105127_1040923300009971Switchgrass AssociatedMPKGLANKRARGGMTSALASMDFREQFAALSLGNASHEDSVGATAVEIPFYHRVAFSQSDYALSGHIVIREDVIFQVVPDLGDPCIGSSQSRWGWLCEVTRILNRAHSPGRAP
Ga0105137_10412023300009972Switchgrass AssociatedMDLREQLAGLFLGNATHEDTIGATAVEIPFYHRIAFSQSYYALSGHIVIREDVVFQVAPDLGDPCIGTSLSRWEWLYEVSRILDRARNPGRAPQVECHPDR*
Ga0105136_10227223300009973Switchgrass AssociatedMDLREQLAALSLGDASHEDTIGATMVEIPFYHRVSFSQSDYALNGHIIIREDIMFQVVPDLGDPGIGGSLSWWGRLYEVTRIPDRAHI
Ga0105129_12066913300009975Switchgrass AssociatedMDLREQFATLSLGNAPHEDTVGATAVEIPFYHHLAFSQSYYALSGCVVIRKDIVFQVIPDLGDPCIGSYLSKWEWLYEVSRIINRAHNL
Ga0105128_11367623300009976Switchgrass AssociatedMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQPDYALSGHIVIREDVIFQVVPDLGDPCIGSSLSRWVWPCEVTRILNRAHGPGWAP
Ga0105141_12587913300009977Switchgrass AssociatedMPKGLANKRARGGMTSALASMDFREQFAALSLGNAPHEDTVGATAVEIPFYHRVAFSQSDYALSGHIIIREDVIFQVVPDLGDPCIGSSQSRWGWLCEVTRFLNRTHSPSWAP*
Ga0105133_12588613300009981Switchgrass AssociatedMTSTLVSMDLREQLAALFLGNAPHGDTIGATTVEIPFYHRVAFSQSYYALSGHIIIREDIVFQVVPALRDPCVGSSLSRWKWLYEVSRILNRAHSLGRAP*
Ga0105036_12374813300009985Switchgrass LeafMDLREQLAALFLGNAPHEDTVGATAVEIPFYHRVAFSQPDYALSGHIVIREDVIFQVVPDLGDPCIGSSLSRWVWPCEVTRILNRAHGPS*
Ga0105132_10401613300009990Switchgrass AssociatedMTSTLASMDLREQLAALFLGNAPHEDTIGATTVEIPFYHRVAFSQSYYALSRHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVSRILN
Ga0105120_104740513300009992Switchgrass AssociatedMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRIAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVSRVLNSAHNPGRAPRMECRRDR*
Ga0105126_105370513300009994Switchgrass AssociatedMTSTLASMDLREQLAALFLGNSPHEDTVGATVVEIPFYLRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVSRILNSAHNPGRAPRMECRRDR*
Ga0105139_100191413300009995Switchgrass AssociatedMDLCEQVAALFLGDAPHEDAIGATAVEIPFYHHVSLSQSHYALNGYMVFRKDVVFQVDPDLRDPCIGTPLRIWTWLHEVFGTLSGAHNPWWTPRMERRRDR*
Ga0105139_102612623300009995Switchgrass AssociatedMASTLASMDLCEQFAALFLGNAPHEDTTGATAVEIPFYHRVAFSQSDYALSGHIVIRKDVIFQVAPDLGDPCIGSSLSRWGWLYEVSRILNRAHSPGRT
Ga0105139_106846213300009995Switchgrass AssociatedMDVREQLAALFLGNALHEDTIGATAVEIPFYHRIAFSQSYYALSGLIVIRKDIVIQVVPYLGDPCIGTSLRRWEWHYVVSRILNSAHYPGRAPWMECRRDR*
Ga0105139_107095023300009995Switchgrass AssociatedMDLRKKLTALFPKNAPHDDAIGATAEEIPFYHRVAFSQPHYTLNRHMVFGKDVVFQVVPDLKDPYVGTSLRSWAWLQEVLGILCGAHN
Ga0105139_109804913300009995Switchgrass AssociatedMTTTLASMDLREQLATLFLGNAPYEDTIGATALEIPFYHRVAFSQSYYALTGHIVIRKDIVFKVVPDLGDPCIGTSLSRWEWLYEVSR
Ga0105139_111550613300009995Switchgrass AssociatedMDLREQLAALSLGNAPHEDIIGATAVEIPFYHRVAFSQLYYALSGHIVIRKDIVSQVVPDLRDPCIGSFLSRWEWLHEVSRILNRAHNPGRAPQVECRRDR*
Ga0105139_112436713300009995Switchgrass AssociatedMDLREQLAALFLGNAPHEDTIGVTAVEIPFYHHVSFSQSYYVLSGHIVIRKDIVFQVVSDLRDPCIGTSLRRWEWCYEVSRVLNSAHNHGRAPQMECRRDC*
Ga0134101_106425113300010267Switchgrass DegradingMPKGLANKRARGGMTSALTSMDLREQFAALSLGNAPHEDTIGATAVEIPFYHRIAFSQSDYALSRHIVIREDVILQVAPDLGDPCIGSSLSRWGWLYEVTRILNRAHSPGRAP*
Ga0134125_1303444513300010371Terrestrial SoilMPKGLANKRARGGMTSALTSMDLREQLAALILGNAPHEDTVGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILNRAHNPGRAPQVECRRDR*
Ga0134128_1186631413300010373Terrestrial SoilMTSALASMDLREQLAALSLGNAPHEDTVGATAVEIPFYHRVAFSQSDYALSRHIVTRKDVIFQVAPDLGDPCIGSFLSRWGWLYEVSRILNRAHNPGRAQQVECRRDR*
Ga0134128_1223680713300010373Terrestrial SoilMDLREQLAALSLGNAPQEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIVSSLSRWEWLYEVSRILNRAHNPGRAPQVECRR
Ga0134126_1193111623300010396Terrestrial SoilMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSDYALSGHIVIREDVIFHVAPDLGDPCIGSSLSKWGWLYEVSRILNRT
Ga0134126_1203961213300010396Terrestrial SoilMDLREQLVALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVYRVLNSAHNPGWAPWMECRWDR*
Ga0134126_1220016113300010396Terrestrial SoilMTSTLSSMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDVVFQVAPDLRDPCIGSSLSRWKWLCEVSRILDRAHNPERAPQVVCRRNR*
Ga0134127_1302205413300010399Terrestrial SoilMDLCEQLAALSLGNAPHEDTVGAVAVEIPFYHRVAFSQSDYALSGHIVIREDVIFQVAPDLGDPCIGSFLSRWEWLYEVTRILNRAHSPGWAP*
Ga0134127_1327438713300010399Terrestrial SoilVALFPGNAPHEDTIGATTVEIPFYHCVAFSQSYYALNGHIIIRKDIVFQVVPDLGDPCIGTSLRRWEWIYEVSRILNSAHNPGRAPRMECRRDQ*
Ga0134122_1278067013300010400Terrestrial SoilILECCWPVEAMPKGLANKRARGGMTSALASMDLRKQFTALSLGNASHEDSVGATAVEIPFYHRVAFSQSDYALSGHIVIREDVIFQVVPDLGDPCIGSSQSR*
Ga0134121_1293937213300010401Terrestrial SoilMPKGLANKCARGGMTSALASMDLREQLAALSPGNAPHEDTIGATAVEIPFYHRVAFSQSDYALSGHIVIREDVMFQVVPDLGDPCIGSSQSRWGWLCEVTRFLNRAHSPGRAP*
Ga0134121_1297786323300010401Terrestrial SoilREQLAALSLGNAPHEDTISAMAVEIPFYHRVAFSQSYYALSGHIVIREDIVFQVVPDLGDPCIGSFLSRWEWLYEVSRILNRAHNPGRAPQVEYRRDR*
Ga0134123_1199832213300010403Terrestrial SoilMPKGLANKRARGGMTSALASMDLREQLAALSLGNAPHEDTVGATAVEIPFYHRVTFSQSDYALSGHIVIREDVILQVVPDLGDPCIGSSQSRWGWLCEVTRFPNRTHSPGRAP*
Ga0134123_1292368613300010403Terrestrial SoilMPKGLANKRARCGMASTLVSMDLREQLAALFLGNAPHEETIGATAVEIPFYHRVAFSQSDYALSGHIVIRKDVIFQVAPDLGDPCIGSSLSRWRWLYEVSRILNRAHTPGW
Ga0153798_1025907713300012949Switchgrass DegradingMDLREQLVAFFLGNAPHEDTIGATAVEIPFHIRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIRTSLSRWEWLYEVSRVLNSAHKPRRAPWMKCCRDR*
Ga0163162_1225093013300013306Switchgrass RhizosphereMTSTLASMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSDYALSGHIVIREDVIFQVTPDLGDPCIGSSLSRWGWLYEVSRILNRAHSPGWAP*
Ga0163163_1099563113300014325Switchgrass RhizosphereMDLREQLTALFLGNAPHEDTIGATAVEIPLYHRIAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILDRAHNPGRAPQVECRRDR*
Ga0163163_1322435213300014325Switchgrass RhizosphereMDLREQFAALSLGNASHEDSVGATAVEIPFYHRVAFSQSDYALSGHIVIREDVIFQVVPDLGDPCIGSSQSRWGWLCEVTRFLNRAHSPGRAP*
Ga0157380_1140846713300014326Switchgrass RhizosphereMELREQLVALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIREDVIFQVAPDLGDPCIGSSLSRWGWLYEVTRILNRAHSPGRAP*
Ga0157380_1341975713300014326Switchgrass RhizosphereANKRARGGMTSALASMYLHEQLAALSLGNAPHEDTVGATAVEIPFYHRIASSQSDYALSRDIVVREDVIFQVVPDLGDPCIGSSQSRWGWLCEVARFLNRAHSPGRAP*
Ga0182183_100777213300015270Switchgrass PhyllosphereMPKGLANKRARGGMTSALASMDLREQFAALSLGNASHEDSVGATAVEIPFYHRVAFSQSDYALSGHIVIREDVIFQVVPDLGDPCIGSSLSRWGWLCEVTRILNRAHSPGRAP*
Ga0182183_108441213300015270Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQPYYALSSYIIIRKDVVFQVVPDLGDPCIGGSLSRWGWLHEVSRILDRAHNPERAPKVVCCRDR*
Ga0182099_103642613300015278Switchgrass PhyllosphereMPKGLANKRARGGMTSALASMDLREQFAALSLRNAPHEDTVGATAVETPFYHRVAFSQSDYALSGHIVIREDVIFQVAPDLGDPCIGSSLSRWGWLYEVSRILNRAHSPGRAP*
Ga0182099_103760213300015278Switchgrass PhyllosphereMTSTLASMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGCIIFRKDVVFQVVPDLGDPCIGTSLSNWGWPYEVSGILGSAHDPWRDPRMDWRWDR*
Ga0182100_106453313300015280Switchgrass PhyllosphereMPKGLANKRARGGMTSALASMDLREQFAALSLGNAPHEDTVGATAVEIPFYHRVTFSQSDYALSGHIVIREDVILQVVPDLGDPCIGSSQSRWGWLCEVTRFLNRAHSPGRAP*
Ga0182101_107560923300015284Switchgrass PhyllosphereDLREQLAALFLGNAPHEDTIGTTAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVLDLGDPCIGISLSRWEWLYEVSRVLNSAHNPGRAPRMECRRDR*
Ga0182101_109625913300015284Switchgrass PhyllosphereMTSTLASMDLRDQLAALFLEKAPHEDTIGAMAEEFPFYHRVAFSQSYYALSGYIIFRKDVVFQVVPDLGDPCIGTSLSNWGWPYEVSGILGSAHDPWPAPRMDCCRDR*
Ga0182103_106051313300015293Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDQCIGSSLSRWEWLYEVSRILNRAHNPGRAPQVECRRDR*
Ga0182103_107763823300015293Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDTVGATVVEIPFYHRVAFSQSYYALNRRIIIRKDIVFQVVPDLGDPCIETSLSRWDWLYEVSRVLN
Ga0182104_103929723300015297Switchgrass PhyllosphereMDLCEKVAALLLGDAPHEDIIGATVVEIPFYHRVVFSQSDYALSGHIVIREDVIFQVVPDLGDPCIGIPLRIWMWLHEVFGTLSGAHNPWRTPRMER
Ga0182104_103955723300015297Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLRRWEWRYEVSRVLNSAHNPGRVPRMECHRDR*
Ga0182104_105253823300015297Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSDYALSRHIVIRKDVIFQVAPDLGDPCIESSQSRWEWLYEVSRILNRAHNPGRAPQVKCRRDR*
Ga0182184_104956713300015301Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILNRAHNPGRAPQVECRRDR*
Ga0182184_107214113300015301Switchgrass PhyllosphereMDLRQQLAALFLGNAPHEDTIGATAVEIPFYHGVAFSQSDYALSGHIVIREDVIFQAAPDLEDPCIGSSLSRWGWLYEFTRILNRARNPGWAP*
Ga0182180_104568513300015306Switchgrass PhyllosphereKRARGGMTSALASMDLREQLAALSLGNAPHEDTVGAAAVEIPFYHRVAFSQSDYALSRHIVIREDIMFQVVPDLGDPCIGGSLSWWGRLYEVTRILDRAHSPDRAPYVECCRDH*
Ga0182180_105492613300015306Switchgrass PhyllosphereLREQLAALSLGNAPHEDNIGTTAIEIPFYHRVAISQSYYALSEHIVIRKDIVFQVVPDVRDPCIGTSLSRWEWNYEVSSVLNSAHNPGRAPRMECRRDR*
Ga0182162_108271723300015310Switchgrass PhyllosphereMRNDFHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIKKDIVFQVAPDLGDPCIGTSLSRWEGLYEVSRILDRAHNPGRAPQVECRRDR*
Ga0182162_112428413300015310Switchgrass PhyllosphereMPKGLANKRARGGMTFALTSMDLREQLAALFLGNVPHEDTIGATAVEIPFYHRVAFSQLDYALNGHIIREDVIFQVAPDLGDLCIGSSLSRRGWLYEVTRILNRARNPGRAP*
Ga0182168_103922623300015312Switchgrass PhyllosphereMTSTLASMDLRKQLAALFLGNAPHEDTIGATAVEIPFYHRVACSQSDYALSGHIVIREDVIFQVAPDLGDPCIGSSLSRWGWLYEVSRILNRAHNSGWTP*
Ga0182168_108089213300015312Switchgrass PhyllosphereMDLRKQLAALFLGNAPHEDTISATAVEIPFYHHVAFSQLYYALSGHIVIRKDIVFQVVPDLRDPSIGTSLSRREWLYEVSRVLNSAHNPGRAPRMECRRDR*
Ga0182168_109605413300015312Switchgrass PhyllosphereMDLREQLAALPLGNAPHEDTIGATAVEIPFYHRVTFSQSYYALSGHIVIREDIVFQVAPDLGDPCIGSSLSRWKWLYEVFRILD*
Ga0182164_106811813300015313Switchgrass PhyllosphereMPKGLANKRARGGMTSALASMDLHEQLAALSLGNAPHEDTVGAAAVEIPFYHRVAFSQSDYALSRHIVIREDIMFQVVPDLGDPCIGGSLSWWGRLYEVTRILDRAYSPDRAPYVECCRDH*
Ga0182121_106145813300015316Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVEFSQSYYALSGHIIIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVSRILNGAHNPGRAPQVECRRDR*
Ga0182121_108737723300015316Switchgrass PhyllosphereMDLREQLAALPLGNTPHEDTIGATAVEIPFYHRVALSQSDYALSGHIVIREDIVFQVVPDLGGPCIGSSLSRWEWLYEVSRILDRA
Ga0182136_103683923300015317Switchgrass PhyllosphereMTSTLASMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVIPDLGDPCIETSLSRWEWLYDVSRVLNSAHNTDGMSLGPIASRY*
Ga0182136_104295023300015317Switchgrass PhyllosphereMDLHEQLAALFLGNAPHEDTIGATVVEIPFYYRVAFSQSYYALNGHIVIRKDIVFQVVPDLGDPCIERSLSRWEWLHEVSRILDRAHNPGRAPQVECRRDR*
Ga0182136_113582613300015317Switchgrass PhyllosphereMTPTLASMDLREQLTALFLGNEPHEDTIGATAVEIPFYHRVAFSQSYYALSRYIIIRKDIVFQVVPDLGDPCIGSSLSRWEWLCEVSRILDRAHNPGQAPQVECHQDR*
Ga0182181_110633113300015318Switchgrass PhyllosphereLSLGNAPHEDTIGATVVEIPFYHRVAFSQSYYALSRHIIIRKDIVFQVVPDLGDPCIGSSLSRWEWLCEVSRILNRAHNPGRAPQVECRWDR*
Ga0182130_106297113300015319Switchgrass PhyllosphereMDVREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSDYALSRHIVIREDIIFEVVPDLGDPCIGSSLSRWGWLYEVTRILNRAHSPGRAPKVECCRDR*
Ga0182130_110194313300015319Switchgrass PhyllosphereILECCWPVEAMPKGLANKRARGGMTSALASMDLRKQFAALSLGNASHEDSVGATAVEIPFYHRVAFSQSDYALSGHIVIREDVILQVVPDLGDPCIGSSQSR*
Ga0182165_105659723300015320Switchgrass PhyllosphereMASKLASMDLHEQLAILFPGNAQHEDAIGATVVKILFYHRVVFSQPHYALSRHMVFGKDVVLQVVPDLGDPCIGTSLSNWEWIYEVSEILDSVHNLWRA
Ga0182165_106175313300015320Switchgrass PhyllosphereMRNDFHEDTIGTTAVEIPFYHRIAFSQSYDALSGHIVIKKDIVFRVVPDLEDPCIGTTLSRWKWRYEVSRVLNSAHNHWWAPQMEWRRDR*
Ga0182165_107539623300015320Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLRDPCIGTSLSRWEWLYEVSRVLNSAHNPGRAPRMECRRDC*
Ga0182134_104672523300015324Switchgrass PhyllosphereMDLREQLTALFPAIAPHEDATGATAVEIPFYHRIAFSQSHYALSGYMFIRKDVVLQVVLDLGDPCIGIPLRIWTWLHEVFGTLSGAHNPWGP
Ga0182134_114990313300015324Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDTIGATVVEIPFYYRVAFSQSYYPLSEHIVNREDIVFQVVPDLRDPCIGSSLSRREWLYEVSRILNRAHNPGRAPQVECRRDR*
Ga0182114_106273313300015327Switchgrass PhyllosphereMVLREQLTAFFLENAPHEDTIGATAVEIPFYHRVVFSQSYYALSGHIVIRKDIVFQVIPDLRDPCIGTSLSKWEWLYEVSRILNSAHNPGRAPRMECRRDRKL*
Ga0182114_113725013300015327Switchgrass PhyllosphereMTSTLASMDLREQLAALFLENASHEDAIGVTAVEIPFYHRVAFSQSHYALSGHMIFGKDIVFQVVLDLGDPCIGTSLSSWEWFQEVPGILSGAHNPWRAPRMDCRRDC*
Ga0182153_104302223300015328Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNAPHEDTIGATTVEIPFYHHIAFSQSYDALSGHIVIKKDIVFQVVLDLGDPCIGTSLSRCEWLYEVSRVLNSAHNPGRAPRMECRRDR*
Ga0182153_107197923300015328Switchgrass PhyllosphereMTSALASMDLREQLVALLLGDAQHEDAIGATAVEIPLYYRVSLSQLHYALSGHIIIRKHIIFQVVSDLEDPCIGTSLSRWEWLYEVSRILNRAHNPGRAPQVECRWDH*
Ga0182153_107825013300015328Switchgrass PhyllosphereMDLREQLAALFLENASHEDAIGVTAVEIPFYHRIAFSQSHYALSGHMIFGKDIVFQVVLDLRDPCIGTSLSSWEWLQEVPGILSGAHN
Ga0182135_103076713300015329Switchgrass PhyllosphereASTLASMDLREQLAALFLENASHEDAIGVTAVEIPFYHRVAFSQSHYALSGHMIFGKDIVFQVVLDLGDPCIGTSLSSWEWFQEVPGILSGAHNPWRAPRMDCRRDC*
Ga0182135_113425123300015329Switchgrass PhyllosphereSMDLREQLAALFLENASHEDAIGVTAVEIPFYHRIAFSQSYYALSGYITFRKDVVFQVVLDLGDPCIGTSLSNWGWPYEVSGILGSAHDPWPAPRMDCCRDR*
Ga0182135_113977413300015329Switchgrass PhyllosphereMPEGLANKRARGGMTSALASMDLREQFAALSLGNAPHEDTVGATAVEIPFYHRVTFSQSDYALSGHIVIREEVILQVVPDLGDPCIGSSQSGWEWLCEVTRFLNRTHSPGRAP*
Ga0182152_109254313300015330Switchgrass PhyllosphereMDLHQQLEALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGYIIFRKDVVFQVVPDLGDPCIGTSLSNWGWPYEVSGILGSAHDPSRAPRMDCRRDH*
Ga0182152_113070513300015330Switchgrass PhyllosphereMASTLATMDLREQLAALFLGNALHEDTIGATAVEIPFYHRVAFSQSDYALSGLIVIREDVIFQVVPDLGDPCISSSLSRWGWLCEVTRILNRAHSPGRAP*
Ga0182131_105246213300015331Switchgrass PhyllosphereMASTLASMDLREQLAALFLGNAPHEDTIGTTAVEIPFYHHVAFSQSYYALSGHIVIRKDVVFQVVPDLRDPCIGSSPSRWGWLHEVSKILD*
Ga0182131_115000513300015331Switchgrass PhyllosphereASMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQPYYALRGHIIIREDIVFQVVPDLGDPCIGSSLSKWEWLYEVSRILNRAHNPGRSPQVECRRDC*
Ga0182117_115590813300015332Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFRQSYYALRGHIIIREDIVFQVAPDLRDPCIGSSLSRWKWLYEVSRILDGAHNPRRPPQVECRRDL*
Ga0182117_116243213300015332Switchgrass PhyllosphereARGGMTSALASMDLREQLAALSLGNAPHEDTVGAAAVEIPFYHRVAFSQSDYALSRHIVIREDIMFQVVPDLGDPCIGGSLSWWGRLYEVTRILDRAHSPDRAPYVECCRDH*
Ga0182147_111947813300015333Switchgrass PhyllosphereGMTSALASMDLREQLVALSLGNAPHEDTVGAAAVEIPFYHRVAFSQSDYALSRHIVIREDIMFQVVPDLGDPCIGGSLSWWGRLYEVTRILDRAHSPDRAPYVEC*
Ga0182132_110581813300015334Switchgrass PhyllosphereMDLREQLTALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGRIVIRKDIVFQVVPDLRDPCIWTSLSRWKWLYEVSKILNRAHNPGRAPQVECRQDR*
Ga0182132_112094013300015334Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGAMAVEIPFYHRVAFSQSYYALSGRIIIRKDIVFQAVPDLGDPCIGTSLSRWEWLYEVSRILNRAHNPGRAQQVECRRDL*
Ga0182132_116028513300015334Switchgrass PhyllosphereMDLREQLVALSLGNAPHEDTIGATAVEIPFYYRVAFSQPDYALSGHIVIREDVIFQVAPDLGDPCIGSFLSRWEWLYEVTRILNRAHSPGWAP*
Ga0182116_107457613300015335Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRIAFSQSYYVLSGHIVIRKDIVFQVVPDVRDPCIGTSLSRWEWLYEVSTVLNRAHNPGRAPQVKCRRDR*
Ga0182150_112201413300015336Switchgrass PhyllosphereAALFLENASHEDAIGVTVVEIPFYHRVAFSQSHYALSGHMIFGKDIVFQVVLDLGDPCIGTSLSSWEWFQEVPGILSGAHNPWRAPRMDCRRDC*
Ga0182150_112862813300015336Switchgrass PhyllosphereMTSTLASMDLREQLAALSLGNALHEDTISATAVEIPFYHRVAFSQSYYALNGHIVIREDIVFQVVSDLGDPCFGSSLSRWEWLYEVSRILNRAHNTGRAPQV
Ga0182150_116335913300015336Switchgrass PhyllosphereNAPHEDTFGATVVEIPFYHHIAFSQSYYALSGCIIFRMDVVFQVVPDLGDSCIETSLSNWGWPYEVSGILGSAHDPWRAPRMDCRRDR*
Ga0182151_109397323300015337Switchgrass PhyllosphereMASTLASMDLREQLAALSLGNASHEDTIGATAVEIPFYHCVAFSQSYYALSGHIVIRKDVGFQVVPDLGDPCIGSSLSRWGWLHEVSRILDRAHNPERAPKVVCRRDR*
Ga0182151_109473613300015337Switchgrass PhyllosphereLTSMDLREQLAALFLENASHEDAIGVTAVEIPFYHRVAFSQSHYALSGHMIFGKDIVFQVVLDLGDPCIGTSLSSWEWFQEVPGILSGAHNPWRAPRMDCRRDC*
Ga0182151_111665213300015337Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNTPHEDTIGTTAVEIPFYHRVAFSQSYYALSGRIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILNRAHNPGR
Ga0182137_112894913300015338Switchgrass PhyllosphereMTSTLASMDVREQFAALFLGNAPHEDTIGATVVEIPFYNRVAFIQSYYALSGHIVIRKDIVFQVVPNLGDPCIGTSLRRWEWRYEVSRVLNSAHNPGRAPWMQCRRDR*
Ga0182149_116887313300015339Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVVILFYHRVAFSQSYYALNGHIVIRKDIVFQVVPDIGDPCIGTSMSWWEWRYEVSRVLNSAHNPGRAPQLEYRRDR*
Ga0182133_103099823300015340Switchgrass PhyllosphereMDLREQLAALFLENASHEDAIGVTAVEIPFYHRVAFSQSHYALSGHMIFGKDIVFQVVLDLGDPCIGTSLSSWEWFQEVPGILSGAHNPWRAPRMDCRRDC*
Ga0182133_116766213300015340Switchgrass PhyllosphereMTPTLASMDLREKLAALFLENAPHEDTIGATAVEIPFYHHVAFSQLDYALSGHIIIREDVIFQVAPDLGDPCIGSFLSRWEWLYEVTRILNRAHSPGWAP*
Ga0182133_117895713300015340Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDPIGATAVEIPFYHRVAFSQSYYALSGHIVIREDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRIINRAHNLGQAPQVECRRDR*
Ga0182133_119345213300015340Switchgrass PhyllosphereMDIREQLAALSLGNAPHEDTIGATVVEIPFYHRVAFSQSYYALSSCIIFRKDVVFQVVPDLGDPCIGTSLSNWGWPYEVSRILGSAHDPWRPPWMECRRDR*
Ga0182115_102317713300015348Switchgrass PhyllosphereDTIGATVVEIPFYHRIAFSQSYYALSGYIIFRKDVVFQVVPDLGDPCIGTSLSNWEWIYEVSEILDSAHNLWRAPRMDCHRDR*
Ga0182115_120540623300015348Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATVVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIMTSLSRSEWLYEVSRVLNSAQNPGRAPRMECRRDR*
Ga0182115_126076213300015348Switchgrass PhyllosphereMPKGFANKRARGGMTSALASMDLREQFAALSLGNAPHEDTVGATAVEIPFYHRVTFSQSDYALSGHIVIREEVILQVVPDLGDPCIGSSQSGWEWLCEVTRFLNRTHSPGRAP*
Ga0182185_101098613300015349Switchgrass PhyllosphereLASMDLREQLAALSLGNTPHEDTIGATAVEIPFYHRVAFSQSHYALSGHMIFGKDIVFQVVLDLGDPCIGTSLSSWEWFQEVPGILSGAHNPWRAPRMDCRRDC*
Ga0182163_100746123300015350Switchgrass PhyllosphereMTSTLASMDLREQLAALFLENASHEDAIGVTAVEIPFYHRIAFSQSHYALSGHMIFGKDIVFQVVLDLRDPCIGTSLSSWEWLQEVPGILSGAHNPWRAPRMDCRRDC*
Ga0182163_116893123300015350Switchgrass PhyllosphereMDLREQLAALSLGYTPHADTIGATAVEIPFYHRVAFSQSYYTLSGHIVIRKDIVFQVVPDLGDLCIGSSLSRREWLYEVSRILNRAHNPGRAPQVECRRDR*
Ga0182169_116991323300015352Switchgrass PhyllosphereMTSTLASMDLREQLAALSLGNAPHEDTIGATAVEIPFYHHVAFSQSYYALSGCIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILN
Ga0182169_120105313300015352Switchgrass PhyllosphereMPKSLANKRARGGMTSALASMDLREQLAALSLGNAPHEDTVGAAAVEIPFYHRVAFSQSDYALSRHIVIREDIMFQVVPDLGDPCIGGSLSWWGRLYEVTRILDRAYSPDRAPYVECCRDH*
Ga0182179_100080333300015353Switchgrass PhyllosphereMTSTLASMDLREQLAALFLENASHEDAIGITAVEIPFYHRVAFSQSHYALSGHMIFGKDIVFQVVLDLGDPCIGTSLSSWEWFQEVPGILSGAHNPWRAPRMDCRRDC*
Ga0182179_106860723300015353Switchgrass PhyllosphereMTSTLASMDLREQLAALSLGNAPHEDTIGATAVEIPFYHHVAFSQSYYALSGCIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILNRAHNPGRAPQVECRRDR*
Ga0182179_112487613300015353Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVVFSQSDYALSGHIVIREDVIFQVAPDLGDPCIGSFLSRWEWLYEVTRILNRAHSPGWAP*
Ga0182179_119605213300015353Switchgrass PhyllosphereMPEGLANKRARGGMTSTLASMDLRDQLAALSLGNAPHEDTIGSTAVEIPFYHRVAFGQSDFALSRHIVIREDVIFQVAPDLGDPCIGSSLSRWG*
Ga0182179_121617313300015353Switchgrass PhyllosphereMTPALASMDLCEQLAALSLGNTPHEDAIGATAVEIPFYHRVAFSQLDYALNGHIIREDVIFQVAPDLGDLCIGSSLSRRGWLYEVTRILNRARNPGRAP*
Ga0182179_123365913300015353Switchgrass PhyllosphereMDLYEQLAALFLDNAPHENAIGATVVEIPFYHHVAFSQSDYALSGYMVFRKDIVFQVGPDLGDPCIGAFLRSWEWLHEASWILSGAHSLWRAPR
Ga0182179_123866713300015353Switchgrass PhyllosphereMDLREQLTALFLGNEPHEDTIGATAVEIPFYHRVAFSQSYYALSRYIIIRKDIVFQVVPDLGDPCIGSSLSRWEWLCEVSRILDRAHNPGQAPQVECHQDR*
Ga0182167_136582313300015354Switchgrass PhyllospherePKSLANKRARGGMTSALASMDLREQLAALSLGNAPHEDTVGAAAVEIPFYHRVAFSQLDYALSRHIVIREDIMFQVVPDLGDPCIGGSLSWWGRLYEVTRILDRAHSPDRAPYVECCRDH
Ga0182199_119562223300017412Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNSPHEDTVGATAVEIPFYHRVAFSQSYYVLSGHIIIRKDIVFQVVPDLGDPCIGNSLSRWEWLYEVSRILDRAHNP
Ga0182213_113495113300017421Switchgrass PhyllospherePREDTIGVTAVEIPFYHRVVFSQSYYALSGHIVIRKDIVLQVVPDLVDPCIGTSLSNWEWLYEGSGILDSTHNLWRAPRMDCRWDR
Ga0182201_105003213300017422Switchgrass PhyllosphereMYLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIIIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILNRAHNPGRAPQVECRRDR
Ga0182196_108538813300017432Switchgrass PhyllosphereMTSTLASMDLHEQLAALFLGNAPHEDTIGATVVEIPFYYRVAFSQSYYALNGHIVIRKDIVFQVVPDIGDPCIGTSMSWWEWRYEVSRVLNSAHNPGRAPRMECRRDR
Ga0182196_109389113300017432Switchgrass PhyllosphereMTSTLASMDLREQLTALSLGNASHEDTIGATAVEIPFYHRVAFRQSYYALSGYIIFRKDVVFQAVPDLVDPCTGTSLSNWGWPYEVSGILGSAHDPWPAPRMDCCRDR
Ga0182200_100262813300017439Switchgrass PhyllosphereMASKLASMDLHEQLAILFPGNAQHEDAIGATVVKILFYHRVVFSQPHYALSRHMVFGKDVVLQVVPDLGDPCIGTSLSNWEWIYEVSEILDSAHNLWRAPRMDCHRDR
Ga0182210_110228023300017692Switchgrass PhyllosphereMASKLASMDLREQLTILFPGNAQHEDAIGATVVKILFYHRVVFSQPHYALSRHMVFRKDVVLQVVPDLGDPCIGTFLSNWGWPYEVSGILDSTHDPWW
Ga0182211_107165123300017694Switchgrass PhyllosphereMTSTLASMDLREQLAAFFLGNAPHEDTNGATVVEIPFYHRVAFSQSYYALSGHNVIRKDIVFQVVPDLGDPCIGTSLIRWEWLYEVSRILNRAHNSGRAPQVECRRDR
Ga0182178_100603113300020023Switchgrass PhyllosphereMILFPGNAQHEDAIGATVVKILFYHRVVFSQPHYALSRHMVFGKDVVLQVVPDLGDPCIGTSLSNWEWIYEVSEILDSAHNLWRAP
Ga0207650_1129493913300025925Switchgrass RhizosphereLFLGNAPHEDTIGATAVEIPFYHRVAFSQSDYALSGHIVIRKDVIFQVAPDLGDPCIGSSLSRWGWLYEVSRILNRAHTPGWTP
Ga0207641_1109621023300026088Switchgrass RhizosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGYIIFRKDVVFQVVPDLRDPCIGTSLSNWGWPYEVSGILGSAHDPWPAPRMDCHRDR
Ga0268330_102141513300028056PhyllosphereMDLHEQLAILFPGNAQHEDAIGATVVKILFYHRVVFSQPHYALSRHMVFGKDVVLQVVPDLGDPCIGTSLSNWEWIYEVSEILDSVHNLWRAPRMDCHRDR
Ga0268342_101949323300028062PhyllosphereMDLREQLTILFPGNAQHEDAIGATVVKILFYHRVVFSQPHYALSRHMVFGKDVVLQVVPDLGDPCIGTSLSNWEWIYEVSEILDSAHNLWRAPRMDCHRDR
Ga0268319_100117723300028473PhyllosphereMASKLASMDLHEQLAILFPGNAQHEDAIGATVVKILFYHRVVFSQPHYALSRHMVFGKDVVLQVVPDLGDPCIGTSLSNWEWIYEVSEILDSVHNLWRAPRMDCHRDR
Ga0268311_100404023300028529PhyllosphereMASKLASMDLREQLTILFPGNAQHEDAIGATVVKILFYHRVVFSQPHYALSRHMVFGKDVVLQVVPDLGDPCIGTSLSNWEWIYEVSEILDS
Ga0214492_107600823300032464Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWRYEVSRVLNSPHNPGRAPRMECRRDR
Ga0214493_100891313300032465Switchgrass PhyllosphereMVPALASMDLCEQVAALLLGNAPHEDAIGATAVEIPLYHCVAFSQSHYALSGHIVFGKNVVFQVVPNLGDPCIGTFLSSREWLYEISGILSSAHNPWRAPWLDSHRNH
Ga0214503_121166323300032466Switchgrass PhyllosphereMPEGLTNKRARLEMTSTLASMDLREQLAALFLGNAPHEDTIGAMAVEIPFYHRVAFRQLYYALSGHIIIRKDIVFKIVPDLGDPCIGTSLRRGEWCYEVSRVLNSAHNPGRAPRMECRRD
Ga0214503_121959413300032466Switchgrass PhyllosphereSMDLREQLAALFLGNAPHEDTIDAMAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVLDLGDPCIGTSLSRWEWLYEVSRVLNSAHNPGRAPRMECRRDR
Ga0214482_101540623300032468Switchgrass PhyllosphereMDLREQLTALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGRIVIKKDIVFQVVPDLGEPCIGTSLSRWERLYEVSRILNRAHNPGRAPQMECRRDR
Ga0214495_114640813300032490Switchgrass PhyllosphereCWPVETMPKGLANKRARGGMTSALASMYLREQFAALSLRNAPHEDTVDATAVEIPFYHRVTFSQSDYALSRDIVIREDVIFQVVLDLGDPCIGSSLSRWGWLCEVTRILNSAHSLGGAP
Ga0214490_109961213300032502Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTISATVVEIPFYHRIAFSQSYYALSRHIIIMKDIVFQVAPDLGDPCIGSSLSRWEWLYEVSRILNRAHNLGRAPQVECRRDR
Ga0214502_100412213300032514Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALNRRIVIREDIVFQVVPDLGDPCIETFLSSREWLYEISGILSSAHNPWQAPRLDSHRNH
Ga0214502_105898623300032514Switchgrass PhyllosphereMDLREQVTVLLPGNAPHEDAIGATAVEIPLYHCVAFSQSHYALSGHIVFGKNVVFQVVPDLGYPCIGTFQSSREWLYKISGILSSAHNLWRAPRLDSHQNH
Ga0321339_114626413300032551Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVSRVLNRAHNPGRVPRMECRRDR
Ga0214500_105238213300032589Switchgrass PhyllosphereMDLREQLTALLLGNAPHEDAIGTTVVEIPLYHRVAFSQSHYALGGSTIFRKDIIFQVVPNLGDPCIGTFLSTWKWRLEVSGILGGAHIPWRTPQMERRRDR
Ga0214500_107275423300032589Switchgrass PhyllosphereTLASMDLREQLAALSLGNAPHEDTIGATAVEILFYHRVAFSQSYYALSGRIVIKKDIVFQVVPDLGEPCIGTSLSRWERLYEVSRILNRAHNPGRAPQMECRRDS
Ga0214500_112987223300032589Switchgrass PhyllosphereMDLRELLAALFLGNAPHEDTIGAMAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWRYEVSRVLNSPHNPGRAPRMECRRDR
Ga0321338_101992013300032593Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNAPHEDTIGAMAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGSSLSRWEWLYEVSRILDRAHNPGRAPQVVCRRDR
Ga0214485_104202113300032698Switchgrass PhyllosphereLAALFLGTALHEDTISATVVEIPFYHRIAFSQSYYALSRHIIIMKDIVFQVVPDLGDPCIGTSLSRWEWRYEVSRVLNSAHNLGWAPRMECRRDR
Ga0214494_110354513300032699Switchgrass PhyllosphereMTFTLASMDLREQLAALSLGNASHEDTIGAMVVEISFYHRIAFSQSYYALSGHIVIKKDIVFQVVPDLGDPSIGTSLSRWEWLYEVSRVL
Ga0314746_109907623300032758Switchgrass PhyllosphereMTSTLASVDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQLVLDLGDPCIGTSLSRWEWRYEVSRVLNSAHNPGRAPRMECRRDR
Ga0314720_102997013300032759Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGYIIFRKDVVFQVVPDLGDPCIGTSLSNWGWPYEVSGILGSAHDPWRAPRMECRRDH
Ga0314733_100253853300032761Switchgrass PhyllosphereAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGYIIFRKDVGFQVVPDLGDPCIGTSLSNWGWPYEVSGILGSAHDP
Ga0314733_101499523300032761Switchgrass PhyllosphereMVPALASMDLREQVTALLPGNAPHEDAISAMAVEIPLYHCIAFSQSHYALSGHIVFGKNVVFQVVPDLGDPCIETFLSSREWLYEISGILSSAHNPWRAPHLDIHRNH
Ga0314725_102776513300032789Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTTGTTAVEIPFYHRVAFSQSDYALSRDIVVREDVIFQVSPDLGDPCIGSFQSRWRWLREVTRILNRAHSPGRAP
Ga0314748_100287653300032791Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGYIIFRKDVGFQVVPDLGDPCIGTSLSNWGWPYEVSGILGSAHDP
Ga0314748_108417923300032791Switchgrass PhyllosphereAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLSRWEWLYEVSRVLNRAHNPGRVPRMECRRDR
Ga0314718_103663423300032811Switchgrass PhyllosphereCEQLAALFLGNAPHEDTIGAMAVEIPFYHRVAFRQLYYALSGHIIIRKDIVFKVVPDLGDPCIGTSLRRWEWRYEVSRVLNSAHNPGRAPLMECRRTASFEVLT
Ga0314719_102151713300032821Switchgrass PhyllosphereMTSTLASMDLREQLAALTLGNVPHDDPIGATAVEIPFYHRVAFSQSYYALNGHIIIRKDIVFQVVPDLGDPCIGASLSRWEWLYEVCRILNSAHNPGRAPRMECRRDR
Ga0314719_102847713300032821Switchgrass PhyllosphereLGNAPHEDTIGTTAVEIPFYHRVAFSQSYYALSSSIIFRKDIVFQVVSDLGDPCIGTSLSRWEWLYEVSRVLNRAHNPERSSRC
Ga0314719_104036613300032821Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGYIIFRKDVVFQVVPDLGDPCIGTSLSNWGWPYEVSGILGSAHDPWRAPRMDCRWDR
Ga0314740_107410213300032822Switchgrass PhyllosphereMDLREQLVALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGSSLNRWEWLYEVSRILNRAHNPGRAPQVECRRDC
Ga0314723_105579513300032823Switchgrass PhyllosphereMTSTLASMDLREQLATLFLGNAPHVDTIGATAVEIPFYHCVAFSQSYYALSGRIVIKKDIVFQVVPDLGDPCIGSSLSRLEWLYAVSRILDRAHNPGRAPQV
Ga0314751_104470913300032889Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGHIVIRKDIVFQVVPDLGDPCIGTSLRRWEWRYEVSRVLNSAHNPGRVPRMECRRDR
Ga0314739_109679113300032913Switchgrass PhyllosphereMDLREQLAALSLGDAPHEDTIGATAVEIPFYHRVAFSQPDYALSGHIVIREDVIFQVAPDLGDPCIGSFLSRWEWLYEVSRILDRAHNLERAPQVVCRRDR
Ga0314738_110058813300032959Switchgrass PhyllosphereMDLREQLAALSLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALNRRIVIREDIVFEVVPDLGDPCIGTSLSRWEWLYEVCRILNSAHNPGRAPRMECRRDR
Ga0314752_110628513300032976Switchgrass PhyllosphereMDLREQLAALFLGNAPQEDTIGAMAVEIPFYHRVAFRQLYYALSGHIVIRKDIVFQIVPDLGDPCIGTSLSRWEWRYEVSRVLNSAHNPGRAPRMECRRDR
Ga0314758_116442823300033525Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNAPHEDTIGATAVEIPFYHHVAFSQSYYALSGHIVIRKDIVFQVVSDLGDPCIRSSLSRWEWLYEVSRILDR
Ga0314758_117909113300033525Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGATAVEIHFYHCVAFSQSYYALNGHIIIRKDIVFQVVPDLGDPCIGTSVRRWEWRYEISRVLNSAHNASFEVLA
Ga0314760_109594823300033530Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGAMAVEIPFYHRVAFRQLYYALSGHIVIRKDIVFKVVPDLGDPCIGTSLRRWEWRYEVSRVLNSAQPWAATTDGMPPGPLASRC
Ga0314767_115229113300033532Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGAMAVEIPFYHRVAFRQLYYALSGHIVIRKDIVFKVVPDLGDPCIGTSLRRWEWRYEVSRVLNSAHNPG
Ga0314770_128618113300033533Switchgrass PhyllosphereMTSTLASMDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALNRRIVIREDIVFQVVPDLGDPCIRSSLSRWEWLYEVSRILDSSQPRAGTTGGMPPGPLALRC
Ga0314762_105299623300033539Switchgrass PhyllosphereMDLREQLAALFLGNAPHEDTIGAMAVEIPFYHRVAFRQLYYALSGHIIIRKDIVFKVVPDLGDPCIGTSLRRGEWCYEVSRVLNSTQPWAGTTDGMPPGLLASRC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.