NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F030559

Metagenome / Metatranscriptome Family F030559

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030559
Family Type Metagenome / Metatranscriptome
Number of Sequences 185
Average Sequence Length 117 residues
Representative Sequence MKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKN
Number of Associated Samples 155
Number of Associated Scaffolds 185

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.49 %
% of genes near scaffold ends (potentially truncated) 98.92 %
% of genes from short scaffolds (< 2000 bps) 93.51 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.297 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(26.487 % of family members)
Environment Ontology (ENVO) Unclassified
(74.054 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.270 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 14.41%    β-sheet: 33.90%    Coil/Unstructured: 51.69%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 185 Family Scaffolds
PF00037Fer4 1.62
PF01467CTP_transf_like 0.54



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2222084003|2222351359All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium586Open in IMG/M
3300000101|DelMOSum2010_c10069942All Organisms → Viruses → Predicted Viral1622Open in IMG/M
3300000117|DelMOWin2010_c10056409All Organisms → Viruses → Predicted Viral1685Open in IMG/M
3300000117|DelMOWin2010_c10059318All Organisms → Viruses → Predicted Viral1619Open in IMG/M
3300000137|LP_F_10_SI03_10DRAFT_c1059141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium501Open in IMG/M
3300000153|SI39nov09_135mDRAFT_c1059014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium531Open in IMG/M
3300001354|JGI20155J14468_10079475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1229Open in IMG/M
3300001460|JGI24003J15210_10057521All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1267Open in IMG/M
3300001472|JGI24004J15324_10020195All Organisms → Viruses → Predicted Viral2265Open in IMG/M
3300001589|JGI24005J15628_10091523All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1043Open in IMG/M
3300001748|JGI11772J19994_1039099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium592Open in IMG/M
3300001963|GOS2229_1016233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium843Open in IMG/M
3300001965|GOS2243_1005113All Organisms → Viruses → Predicted Viral1492Open in IMG/M
3300002488|JGI25128J35275_1029896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1278Open in IMG/M
3300002488|JGI25128J35275_1103732All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium572Open in IMG/M
3300002488|JGI25128J35275_1119058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium527Open in IMG/M
3300004110|Ga0008648_10179455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium578Open in IMG/M
3300004457|Ga0066224_1227419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium691Open in IMG/M
3300005432|Ga0066845_10221478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium730Open in IMG/M
3300005522|Ga0066861_10308946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium536Open in IMG/M
3300005971|Ga0066370_10229631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium654Open in IMG/M
3300006164|Ga0075441_10166328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium828Open in IMG/M
3300006165|Ga0075443_10096831All Organisms → Viruses → Predicted Viral1015Open in IMG/M
3300006165|Ga0075443_10202454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium711Open in IMG/M
3300006334|Ga0099675_1079781All Organisms → Viruses → Predicted Viral2178Open in IMG/M
3300006345|Ga0099693_1036944All Organisms → Viruses → Predicted Viral1697Open in IMG/M
3300006565|Ga0100228_1341605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium897Open in IMG/M
3300006735|Ga0098038_1042673All Organisms → Viruses → Predicted Viral1659Open in IMG/M
3300006735|Ga0098038_1045734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1593Open in IMG/M
3300006749|Ga0098042_1035465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1398Open in IMG/M
3300006789|Ga0098054_1295714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium579Open in IMG/M
3300006793|Ga0098055_1088645All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300006793|Ga0098055_1112715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1058Open in IMG/M
3300006793|Ga0098055_1124731All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium999Open in IMG/M
3300006919|Ga0070746_10115102All Organisms → Viruses → Predicted Viral1332Open in IMG/M
3300006919|Ga0070746_10544063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium504Open in IMG/M
3300006924|Ga0098051_1118548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium706Open in IMG/M
3300006924|Ga0098051_1163539All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium586Open in IMG/M
3300006928|Ga0098041_1240061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium578Open in IMG/M
3300006929|Ga0098036_1055414All Organisms → Viruses → Predicted Viral1230Open in IMG/M
3300006929|Ga0098036_1108679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium851Open in IMG/M
3300007236|Ga0075463_10069344All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300007538|Ga0099851_1338779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium526Open in IMG/M
3300007647|Ga0102855_1046543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1181Open in IMG/M
3300007725|Ga0102951_1231315All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium525Open in IMG/M
3300007963|Ga0110931_1023935All Organisms → Viruses → Predicted Viral1843Open in IMG/M
3300008012|Ga0075480_10232704All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium960Open in IMG/M
3300008097|Ga0111541_10168022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium911Open in IMG/M
3300009000|Ga0102960_1136140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium887Open in IMG/M
3300009001|Ga0102963_1150479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium938Open in IMG/M
3300009001|Ga0102963_1288149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium647Open in IMG/M
3300009026|Ga0102829_1017407All Organisms → Viruses → Predicted Viral2029Open in IMG/M
3300009027|Ga0102957_1160603All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium798Open in IMG/M
3300009027|Ga0102957_1265761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium623Open in IMG/M
3300009071|Ga0115566_10499196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium690Open in IMG/M
3300009071|Ga0115566_10535622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium661Open in IMG/M
3300009071|Ga0115566_10538047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium659Open in IMG/M
3300009172|Ga0114995_10712651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium549Open in IMG/M
3300009193|Ga0115551_1343107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium648Open in IMG/M
3300009409|Ga0114993_11289239All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium512Open in IMG/M
3300009420|Ga0114994_10140758All Organisms → Viruses → Predicted Viral1635Open in IMG/M
3300009449|Ga0115558_1024802All Organisms → Viruses → Predicted Viral2915Open in IMG/M
3300009476|Ga0115555_1339034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium602Open in IMG/M
3300009476|Ga0115555_1421718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium530Open in IMG/M
3300009481|Ga0114932_10652870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium614Open in IMG/M
3300009505|Ga0115564_10057750All Organisms → Viruses → Predicted Viral2287Open in IMG/M
3300009508|Ga0115567_10709193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium602Open in IMG/M
3300009512|Ga0115003_10149610All Organisms → Viruses → Predicted Viral1418Open in IMG/M
3300009593|Ga0115011_11372138All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium618Open in IMG/M
3300009601|Ga0114914_1010132All Organisms → Viruses → Predicted Viral1749Open in IMG/M
3300010149|Ga0098049_1267612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium518Open in IMG/M
3300010151|Ga0098061_1245459All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium625Open in IMG/M
3300010151|Ga0098061_1265977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium595Open in IMG/M
3300010300|Ga0129351_1122986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1034Open in IMG/M
3300010300|Ga0129351_1364094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium541Open in IMG/M
3300011254|Ga0151675_1009347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1031Open in IMG/M
3300012919|Ga0160422_10652970All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium669Open in IMG/M
3300012952|Ga0163180_10117942All Organisms → Viruses → Predicted Viral1719Open in IMG/M
3300012952|Ga0163180_10579427All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium851Open in IMG/M
3300012954|Ga0163111_12227987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium555Open in IMG/M
3300013181|Ga0116836_1046345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium504Open in IMG/M
3300016771|Ga0182082_1511213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium761Open in IMG/M
3300017709|Ga0181387_1019449All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1318Open in IMG/M
3300017709|Ga0181387_1079805All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium662Open in IMG/M
3300017713|Ga0181391_1071977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium796Open in IMG/M
3300017713|Ga0181391_1141308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium535Open in IMG/M
3300017721|Ga0181373_1035347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium920Open in IMG/M
3300017726|Ga0181381_1029217All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1241Open in IMG/M
3300017726|Ga0181381_1044627All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium979Open in IMG/M
3300017727|Ga0181401_1147354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium575Open in IMG/M
3300017730|Ga0181417_1024352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1508Open in IMG/M
3300017731|Ga0181416_1026524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1360Open in IMG/M
3300017732|Ga0181415_1065352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium824Open in IMG/M
3300017739|Ga0181433_1103331All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium690Open in IMG/M
3300017764|Ga0181385_1144987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium722Open in IMG/M
3300017772|Ga0181430_1117513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium784Open in IMG/M
3300017776|Ga0181394_1058967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1276Open in IMG/M
3300017824|Ga0181552_10285709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium818Open in IMG/M
3300017967|Ga0181590_10701785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium682Open in IMG/M
3300018426|Ga0181566_10949428All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium581Open in IMG/M
3300018428|Ga0181568_10108134All Organisms → Viruses → Predicted Viral2336Open in IMG/M
3300019732|Ga0194014_1036462All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium658Open in IMG/M
3300019756|Ga0194023_1001597All Organisms → Viruses → Predicted Viral4457Open in IMG/M
3300020055|Ga0181575_10221077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1105Open in IMG/M
3300020249|Ga0211635_1051597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium669Open in IMG/M
3300020252|Ga0211696_1033302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium634Open in IMG/M
3300020259|Ga0211633_1048575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium704Open in IMG/M
3300020279|Ga0211634_1112669All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium589Open in IMG/M
3300020360|Ga0211712_10064308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium906Open in IMG/M
3300020365|Ga0211506_1148821All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium660Open in IMG/M
3300020367|Ga0211703_10199341All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium524Open in IMG/M
3300020379|Ga0211652_10273724All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium519Open in IMG/M
3300020387|Ga0211590_10309761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium500Open in IMG/M
3300020409|Ga0211472_10189930All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium824Open in IMG/M
3300020421|Ga0211653_10196365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium886Open in IMG/M
3300020422|Ga0211702_10038327All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1303Open in IMG/M
3300020433|Ga0211565_10257976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium759Open in IMG/M
3300020437|Ga0211539_10242562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium743Open in IMG/M
3300020439|Ga0211558_10133436All Organisms → Viruses → Predicted Viral1202Open in IMG/M
3300020441|Ga0211695_10083474All Organisms → Viruses → Predicted Viral1052Open in IMG/M
3300020442|Ga0211559_10180974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium999Open in IMG/M
3300020448|Ga0211638_10393669All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium649Open in IMG/M
3300020450|Ga0211641_10516659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium569Open in IMG/M
3300020457|Ga0211643_10631321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium524Open in IMG/M
3300020459|Ga0211514_10318967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium765Open in IMG/M
3300020475|Ga0211541_10641923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium515Open in IMG/M
3300020595|Ga0206126_10264543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium783Open in IMG/M
3300021364|Ga0213859_10006707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium5148Open in IMG/M
3300021368|Ga0213860_10180089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium932Open in IMG/M
3300021957|Ga0222717_10362116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium811Open in IMG/M
3300021959|Ga0222716_10095702All Organisms → Viruses → Predicted Viral2015Open in IMG/M
3300021964|Ga0222719_10219812All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1284Open in IMG/M
3300022058|Ga0224905_102375All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium523Open in IMG/M
3300022068|Ga0212021_1005410All Organisms → Viruses → Predicted Viral1936Open in IMG/M
3300022072|Ga0196889_1045095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium865Open in IMG/M
3300022925|Ga0255773_10265227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium724Open in IMG/M
3300022929|Ga0255752_10104333All Organisms → Viruses → Predicted Viral1531Open in IMG/M
3300022939|Ga0255754_10438968All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium574Open in IMG/M
3300023084|Ga0255778_10107068All Organisms → Viruses → Predicted Viral1563Open in IMG/M
3300024235|Ga0228665_1134172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium509Open in IMG/M
3300024248|Ga0228676_1094075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium655Open in IMG/M
3300024348|Ga0244776_10652721All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium656Open in IMG/M
3300024428|Ga0233396_1077013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium847Open in IMG/M
3300025079|Ga0207890_1021359All Organisms → Viruses → Predicted Viral1246Open in IMG/M
3300025099|Ga0208669_1057432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium875Open in IMG/M
3300025101|Ga0208159_1061534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium747Open in IMG/M
3300025108|Ga0208793_1055418All Organisms → Viruses → Predicted Viral1207Open in IMG/M
3300025110|Ga0208158_1047099All Organisms → Viruses → Predicted Viral1067Open in IMG/M
3300025110|Ga0208158_1142517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium547Open in IMG/M
3300025127|Ga0209348_1113879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium827Open in IMG/M
3300025127|Ga0209348_1200281All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium557Open in IMG/M
3300025128|Ga0208919_1112720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium868Open in IMG/M
3300025128|Ga0208919_1128858All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium797Open in IMG/M
3300025128|Ga0208919_1241072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium528Open in IMG/M
3300025132|Ga0209232_1076242All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1170Open in IMG/M
3300025151|Ga0209645_1198316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium594Open in IMG/M
3300025151|Ga0209645_1221760All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium544Open in IMG/M
3300025610|Ga0208149_1149895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium532Open in IMG/M
3300025641|Ga0209833_1115709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium751Open in IMG/M
3300025665|Ga0209360_1128876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium717Open in IMG/M
3300025699|Ga0209715_1062389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1528Open in IMG/M
3300025727|Ga0209047_1074494All Organisms → Viruses → Predicted Viral1219Open in IMG/M
3300025759|Ga0208899_1042382All Organisms → Viruses → Predicted Viral2017Open in IMG/M
3300025759|Ga0208899_1259442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium511Open in IMG/M
3300025803|Ga0208425_1036750All Organisms → Viruses → Predicted Viral1253Open in IMG/M
3300025803|Ga0208425_1149110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium520Open in IMG/M
3300025886|Ga0209632_10097730All Organisms → Viruses → Predicted Viral1721Open in IMG/M
3300026138|Ga0209951_1046806All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium932Open in IMG/M
3300026187|Ga0209929_1133040All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium620Open in IMG/M
3300026187|Ga0209929_1141933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium592Open in IMG/M
3300027367|Ga0208801_1040952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium718Open in IMG/M
3300027668|Ga0209482_1167346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium634Open in IMG/M
3300027830|Ga0209359_10212530All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium869Open in IMG/M
3300027833|Ga0209092_10155703All Organisms → Viruses → Predicted Viral1315Open in IMG/M
3300028132|Ga0228649_1144864All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium568Open in IMG/M
3300028284|Ga0257120_1039994All Organisms → Viruses → Predicted Viral1288Open in IMG/M
3300028600|Ga0265303_10227291All Organisms → Viruses → Predicted Viral1437Open in IMG/M
3300029319|Ga0183748_1017619All Organisms → Viruses → Predicted Viral2637Open in IMG/M
3300029319|Ga0183748_1033382All Organisms → Viruses → Predicted Viral1630Open in IMG/M
3300029448|Ga0183755_1005846All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium5621Open in IMG/M
3300031143|Ga0308025_1090848All Organisms → Viruses → Predicted Viral1130Open in IMG/M
3300031519|Ga0307488_10194111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1381Open in IMG/M
3300031630|Ga0308004_10176490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium880Open in IMG/M
3300031774|Ga0315331_10161698All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1669Open in IMG/M
3300031775|Ga0315326_10621935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium685Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.49%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.68%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater8.11%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.49%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.95%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.41%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water4.32%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.24%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.24%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine2.16%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.16%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.62%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.62%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.08%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.08%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.08%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.08%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.08%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.54%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.54%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.54%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.54%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.54%
MarineEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine0.54%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.54%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.54%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.54%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.54%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.54%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.54%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.54%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.54%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.54%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2222084003Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Ctl_5_microcosmEnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000137Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10EnvironmentalOpen in IMG/M
3300000153Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 135mEnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001748Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m)EnvironmentalOpen in IMG/M
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300001965Marine microbial communities from Coastal Floreana, Equador - GS028EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300004110Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNAEnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005432Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78EnvironmentalOpen in IMG/M
3300005522Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257EnvironmentalOpen in IMG/M
3300005971Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_AEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006334Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025mEnvironmentalOpen in IMG/M
3300006345Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075mEnvironmentalOpen in IMG/M
3300006565Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125mEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008097Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2)EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009601Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013181Marine hypoxic microbial communities from the Gulf of Mexico, USA - 9m_Station6_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019732Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020249Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556038-ERR599056)EnvironmentalOpen in IMG/M
3300020252Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX555968-ERR599022)EnvironmentalOpen in IMG/M
3300020259Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556041-ERR599103)EnvironmentalOpen in IMG/M
3300020279Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX555939-ERR599017)EnvironmentalOpen in IMG/M
3300020360Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX555918-ERR599165)EnvironmentalOpen in IMG/M
3300020365Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143)EnvironmentalOpen in IMG/M
3300020367Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020387Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556119-ERR599023)EnvironmentalOpen in IMG/M
3300020409Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020448Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020459Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022058Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300022939Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaGEnvironmentalOpen in IMG/M
3300023084Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaGEnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024248Seawater microbial communities from Monterey Bay, California, United States - 48D_rEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024428Seawater microbial communities from Monterey Bay, California, United States - 32DEnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025641Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes)EnvironmentalOpen in IMG/M
3300025665Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025727Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027367Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027830Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028132Seawater microbial communities from Monterey Bay, California, United States - 61DEnvironmentalOpen in IMG/M
3300028284Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031630Marine microbial communities from water near the shore, Antarctic Ocean - #38EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22224034542222084003MarineMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFR
DelMOSum2010_1006994233300000101MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFEMTARVVYLGKPRTSTT
DelMOWin2010_1005640933300000117MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNXVNQAEIEGLXXSRVFLGITNILTENIMDSRYDLVEQDSDFEITARVVYLGKPRTXTTILGLFRRETTTTEVRVVVEIKNKKTG
DelMOWin2010_1005931833300000117MarineMKKLWSIILLCGIVFGQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTID
LP_F_10_SI03_10DRAFT_105914123300000137MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGKVVSGNGVGTI
SI39nov09_135mDRAFT_105901423300000153MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNK
JGI20155J14468_1007947523300001354Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVV
JGI24003J15210_1005752123300001460MarineMKKLWSVILLIGLVNAQMPQPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRR
JGI24004J15324_1002019543300001472MarineMKKLWLIVLLIGLVNAQMPQPTLVGQDRLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTT
JGI24005J15628_1009152313300001589MarineMKKLWSVILLIGLVNAQMPEPTXVGQDKLQIPTLSINNFVNQAEIEGXEDTRVFLGITNILXENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGVGTID
JGI11772J19994_103909923300001748Saline Water And SedimentMKKLWSIVLLCGIVFGQLPQPTMVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKK
GOS2229_101623323300001963MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGN
GOS2243_100511353300001965MarineMKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTF
JGI25128J35275_102989623300002488MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFL
JGI25128J35275_110373223300002488MarineMKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIV
JGI25128J35275_111905823300002488MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTF
Ga0008648_1017945513300004110MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTE
Ga0066224_122741913300004457MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELK
Ga0066845_1022147823300005432MarineMKKLWSIILLCGVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVIVELKNKKTG
Ga0066861_1030894623300005522MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLSINNFVNQAEIQGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLN
Ga0066370_1022963123300005971MarineMKKLWSIILLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRE
Ga0075441_1016632823300006164MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIR
Ga0075443_1009683123300006165MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIAGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVE
Ga0075443_1020245423300006165MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVE
Ga0099675_107978113300006334MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTRTEVRVIVELKNKKTGQVVS
Ga0099693_103694443300006345MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYELVEQDSDFEMTARIIYLGRPRTSTTFLGLFRRETTTTEVRVVVEL
Ga0100228_134160513300006565MarineMKKLWLIVLLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTT
Ga0098038_104267333300006735MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGV
Ga0098038_104573433300006735MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVI
Ga0098042_103546513300006749MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRPRKATTVLG
Ga0098054_129571423300006789MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGN
Ga0098055_108864513300006793MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGL
Ga0098055_111271523300006793MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVK
Ga0098055_112473123300006793MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVR
Ga0070746_1011510213300006919AqueousMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREI
Ga0070746_1054406323300006919AqueousMKKLWSIVLLCGIVFGQLPQPTMVGQDELKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRV
Ga0098051_111854823300006924MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKS
Ga0098051_116353923300006924MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQIPTLSISNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYIGRP
Ga0098041_124006113300006928MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSNFEITARVVYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNK
Ga0098036_105541423300006929MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRV
Ga0098036_110867913300006929MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKAT
Ga0075463_1006934423300007236AqueousLEQTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVV
Ga0099851_133877923300007538AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILAENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKI
Ga0102855_104654323300007647EstuarineLYLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVV
Ga0102951_123131523300007725WaterMKKLWSIVLLCGIVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTEVRVAVE
Ga0110931_102393513300007963MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGKVVSGN
Ga0075480_1023270423300008012AqueousLEQTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVE
Ga0111541_1016802223300008097MarineLYLELIFKEIKMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVDVSLLN
Ga0102960_113614033300009000Pond WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFR
Ga0102963_115047933300009001Pond WaterMKKLWSIAILLSVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDR
Ga0102963_128814913300009001Pond WaterLEQTFKEIKMKKLWSVAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIK
Ga0102829_101740743300009026EstuarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVV
Ga0102957_116060313300009027Pond WaterMKKLWSIVLLCGIVFAQLPQPTMVGQDDLQVPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRT
Ga0102957_126576113300009027Pond WaterLEQTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVV
Ga0115566_1049919623300009071Pelagic MarineLELTFKEMKMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKT
Ga0115566_1053562213300009071Pelagic MarineLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTG
Ga0115566_1053804723300009071Pelagic MarineLEQTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKT
Ga0114995_1071265123300009172MarineLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGKVVSGNGVGTID
Ga0115551_134310723300009193Pelagic MarineLEQTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIK
Ga0114993_1128923923300009409MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGQPRTSTTFLGLFRRETSTTEVRVVVELKN
Ga0114994_1014075833300009420MarineLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGV
Ga0115558_102480253300009449Pelagic MarineLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFR
Ga0115555_133903423300009476Pelagic MarineMKMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLG
Ga0115555_142171823300009476Pelagic MarineLEQTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVE
Ga0114932_1065287013300009481Deep SubsurfaceLELIFKEIKMKKLWLIVLLIGLVNAQMPEPTMVGQEKLQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRE
Ga0115564_1005775013300009505Pelagic MarineLELTFKEIKMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKK
Ga0115567_1070919323300009508Pelagic MarineLELTFKEMKMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVE
Ga0115003_1014961023300009512MarineVKEILIIPLYLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKKTGT
Ga0115011_1137213813300009593MarineMKKLWSIAILLSVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRKATTFLGLFRRETNTTEVRV
Ga0114914_101013233300009601Deep OceanLELIFKEKKMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTT
Ga0098049_126761223300010149MarineMGLVNAQMPAPTMVGQDELKIPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNK
Ga0098061_124545923300010151MarineLEQTFRRQQMKKLWSIAILLSVVFAQLPQPTLVGQDELKIPTLSINHFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSNFEITARVIYIGRPRKSTTVLGLFR
Ga0098061_126597723300010151MarineMGLVNAQMPAPTMVGQDELKIPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGVGTID
Ga0129351_112298613300010300Freshwater To Marine Saline GradientMKKLWSIILLCGVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGL
Ga0129351_136409413300010300Freshwater To Marine Saline GradientLELIFKEKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQ
Ga0151675_100934723300011254MarineMKKLWSIILLIGVVFAQLPQPTMVGQDKLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTILGLFRRETTTTEVRVVVELKNK
Ga0160422_1065297013300012919SeawaterMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSRTEVRVIV
Ga0163180_1011794213300012952SeawaterMKKLWSIILLCGVVFAQLPQPTIVGQDDLQIPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFL
Ga0163180_1057942713300012952SeawaterMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGNVVSGNGTGTIDRDI
Ga0163111_1222798713300012954Surface SeawaterMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVIVELKEKKTGVVKTGN
Ga0116836_104634523300013181MarineMKKLWSIILLCGIVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRKSATILGLFRRETTTTEVRVV
Ga0182082_151121323300016771Salt MarshMKKLWSIVLLCGIVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVEIKNKKTGKVVSG
Ga0181387_101944913300017709SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRV
Ga0181387_107980513300017709SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRV
Ga0181391_107197713300017713SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRV
Ga0181391_114130823300017713SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGISNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNG
Ga0181373_103534733300017721MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGV
Ga0181381_102921723300017726SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGT
Ga0181381_104462723300017726SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGT
Ga0181401_114735423300017727SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGT
Ga0181417_102435233300017730SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRE
Ga0181416_102652413300017731SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGISNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTG
Ga0181415_106535213300017732SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGV
Ga0181433_110333123300017739SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNK
Ga0181385_114498713300017764SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKK
Ga0181430_111751313300017772SeawaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEITARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVE
Ga0181394_105896723300017776SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNK
Ga0181552_1028570923300017824Salt MarshMKKLWSIILLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRE
Ga0181590_1070178523300017967Salt MarshMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRV
Ga0181566_1094942823300018426Salt MarshMKKLWSIVLLCGVVFGQLPQPTLVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTILGLFRRETTTTE
Ga0181568_1010813453300018428Salt MarshMKKLWSIILLCGIVFGQLPQPTMVGQDELKIPTLSINNFDNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTTTE
Ga0194014_103646213300019732SedimentMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKV
Ga0194023_100159713300019756FreshwaterMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRE
Ga0181575_1022107713300020055Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQEKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATI
Ga0211635_105159713300020249MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKK
Ga0211696_103330213300020252MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELRNKKTGKVVSGNGI
Ga0211633_104857523300020259MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELK
Ga0211634_111266913300020279MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETSTTEVRVIVELKNKK
Ga0211712_1006430823300020360MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTAT
Ga0211506_114882113300020365MarineMKKLWSIILLCGIVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTSTTFLGLFRRETTT
Ga0211703_1019934113300020367MarineMKKLWSIAILFSVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRKSATILGLFRRETSTT
Ga0211652_1027372413300020379MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELK
Ga0211590_1030976123300020387MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTRTEVRVIVELKDKKTGVIKSG
Ga0211472_1018993023300020409MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATT
Ga0211653_1019636513300020421MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLG
Ga0211702_1003832713300020422MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRT
Ga0211565_1025797613300020433MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDKLQVPTLSISKFVNEAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVIYLGRPRKSTTILGLFRRETTTTEVRVVVELKNKKTG
Ga0211539_1024256223300020437MarineMKKLWSVVLLFGVVFAQLPEPTMVGQDKLQVPTLSVNNFVNQAEIEGLEDSRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYVGRPRKSTTFLGLF
Ga0211558_1013343633300020439MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDELRVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLIEGGSSDFELTARVVYLGRPRTSTTIL
Ga0211695_1008347423300020441MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVV
Ga0211559_1018097433300020442MarineMKKLWSIVLLIGLVNAQMPEPTMVGQDELRVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLIEGGSSDFELTARVVYLGRPRTSTTILGLFRR
Ga0211638_1039366913300020448MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILEENVMDSRYELVESDSDFEMTARVVYLGRPRTSTTFLGLFRRESSTTEV
Ga0211641_1051665913300020450MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDYEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELLNKKTGV
Ga0211643_1063132123300020457MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINKFVNQAEVEGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGKPRKSTTILGLF
Ga0211514_1031896713300020459MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRTSTTFLG
Ga0211541_1064192313300020475MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTT
Ga0206126_1026454323300020595SeawaterMKKLWSIAILLSVVFAQLPQPTMVGQDNLKTPTLSINNFVNQAEIVGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTILGLFR
Ga0213859_1000670763300021364SeawaterMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTI
Ga0213860_1018008933300021368SeawaterMKKLWSVAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDREI
Ga0222717_1036211613300021957Estuarine WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTE
Ga0222716_1009570213300021959Estuarine WaterMKKLWSIAILLSVVFAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTE
Ga0222719_1021981213300021964Estuarine WaterMKKLWSITILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDRE
Ga0224905_10237523300022058SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVS
Ga0212021_100541013300022068AqueousMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGS
Ga0196889_104509533300022072AqueousMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVE
Ga0255773_1026522713300022925Salt MarshMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLF
Ga0255752_1010433313300022929Salt MarshMKKLWSIILLIGLVNAQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNK
Ga0255754_1043896823300022939Salt MarshMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVEIKNKKTGKVV
Ga0255778_1010706833300023084Salt MarshMKKLWSIVLLCGIVFGQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILG
Ga0228665_113417223300024235SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREI
Ga0228676_109407523300024248SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGTGTIDRD
Ga0244776_1065272113300024348EstuarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRE
Ga0233396_107701313300024428SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNG
Ga0207890_102135923300025079MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLQFPTLTINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEVRVVVELLNKKTGK
Ga0208669_105743223300025099MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVRVIVELKNKKTGVIKSGNGV
Ga0208159_106153423300025101MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNEAEVQGLEDSRVFLGITNILTENIMDSRYDLVEQDSDYEMTARVIYLGRPRKATTVLGLFRRETTTTEVRVVVELKNKKTGVIRSGNGVGTIDRVI
Ga0208793_105541833300025108MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTF
Ga0208158_104709933300025110MarineMKKLWSIAILFSVVFAQLPTPTMVGQDKLQVPTLSVNNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYELVENDSDFEMTARVVYLGRPRTSTTFLGLFRRETSTTEVRVVVELKNKKTGKVVSGNGTGTIDKEI
Ga0208158_114251723300025110MarineMKKLWLIVLLMGLVNAQMPAPTMVGQDELKIPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVELLNKKTGVVKSGNGV
Ga0209348_111387913300025127MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKN
Ga0209348_120028123300025127MarineMKRLLIILLIGFAQAQLPQPTMIGQDNLKVPTLSINNFVNQAEVQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGSPRKSATVLGLFRTQSQTTEVRVVVELKNNKTGKIVKGNGTGTVDKKIN
Ga0208919_111272013300025128MarineMKKIWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEIQGLEDTRVFLGITNILEENVMDSRYELVENDSDFEMTARVVYLGRPRKSTTILGLFRRETT
Ga0208919_112885813300025128MarineMKKLWSVILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKATTVLGLFRRETTTTEVR
Ga0208919_124107223300025128MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKRTGVIRSGNGVGTIDRVI
Ga0209232_107624213300025132MarineMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDR
Ga0209645_119831613300025151MarineMKKLWSIVLLCGIVFGQLPQPTMVGQDDLKVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELRNKKTGVVRTGNGTGTIDR
Ga0209645_122176013300025151MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETTRTEVRVI
Ga0208149_114989513300025610AqueousMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKV
Ga0209833_111570923300025641Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRVV
Ga0209360_112887613300025665MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELLNKKTGD
Ga0209715_106238933300025699Pelagic MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTTRVVYLGRPRTSTTFLGLFRRETTTTEVRV
Ga0209047_107449413300025727MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVEL
Ga0208899_104238233300025759AqueousMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTG
Ga0208899_125944223300025759AqueousMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRT
Ga0208425_103675023300025803AqueousMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVV
Ga0208425_114911013300025803AqueousMKKLWSIVLLCGIVFGQLPQPTMVGQDELKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTE
Ga0209632_1009773033300025886Pelagic MarineMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIVGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGNIV
Ga0209951_104680623300026138Pond WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGN
Ga0209929_113304023300026187Pond WaterMKKLWSIAILLSVVFAQLPQPTLVGQDDLKVPTLAINNFVNQAEVEGLEDSRVFLGITNILTENIMDSRYDLVEQDSDFELTARVVYLGKPRSSATILG
Ga0209929_114193313300026187Pond WaterMKKLWSVAILLSVVFAQLPQPTLVGQDDLKVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIK
Ga0208801_104095223300027367EstuarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQV
Ga0209482_116734613300027668MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRETT
Ga0209359_1021253013300027830MarineMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTATTFLGLFRRETTTTEVRVVVELKNKKTGVVVS
Ga0209092_1015570313300027833MarineMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRD
Ga0228649_114486413300028132SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGVVKSGNGT
Ga0257120_103999413300028284MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDELQIPTLTINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGLFRRESTTTEVRVVVELL
Ga0265303_1022729123300028600SedimentMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLAINNFVNQAEIVGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEITARVIYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVS
Ga0183748_101761963300029319MarineMKKLWTIAILFNVVFAQLPQPTIVGQDDLQIPTLSINNFVNEAEIVGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRKSTTFLGLFRRETTTTEVRVIVELKNKK
Ga0183748_103338233300029319MarineMKKLWSIILLCGVVFAQLPQPTMVGQDELKIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFELTARVIYLGRPRTATTFLGLFRXXXXPFDRSELGGALKEAIGNAVQELL
Ga0183755_100584653300029448MarineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVXXXXELGGALKEAIGNAVQEIL
Ga0308025_109084813300031143MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTT
Ga0307488_1019411123300031519Sackhole BrineMKKLWSVILLIGLVNAQMPEPTLVGQDKLQIPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVIYLGRPRTSTTFLGLFRRE
Ga0308004_1017649023300031630MarineMKKLWLIVLLIGLVNAQMPEPTMVGQDKLEIPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRTSTTILGIFKKQTTTTEIRVVVELLNKK
Ga0315331_1016169813300031774SeawaterMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSISNFVNQAEIEGLEDSRVFLGISNILTENVMDSRYDLVEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNK
Ga0315326_1062193513300031775SeawaterMKKLWLIVLLIGLVNAQMPTPTMVGQDELQVPTLTINNFVNQAEVEGLEDTRIFLGITNILTENVMDSRYDLVENESDFELTARVVYLGRPRKSTTILGLFRRETTTTEVRVVVGLLNK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.