Basic Information | |
---|---|
Family ID | F030822 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 184 |
Average Sequence Length | 44 residues |
Representative Sequence | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFG |
Number of Associated Samples | 149 |
Number of Associated Scaffolds | 184 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 28.80 % |
% of genes near scaffold ends (potentially truncated) | 92.39 % |
% of genes from short scaffolds (< 2000 bps) | 88.04 % |
Associated GOLD sequencing projects | 140 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.196 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (10.870 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.370 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 184 Family Scaffolds |
---|---|---|
PF07676 | PD40 | 2.72 |
PF00903 | Glyoxalase | 2.17 |
PF13592 | HTH_33 | 1.09 |
PF00069 | Pkinase | 1.09 |
PF05960 | DUF885 | 1.09 |
PF04397 | LytTR | 1.09 |
PF00773 | RNB | 0.54 |
PF00149 | Metallophos | 0.54 |
PF14833 | NAD_binding_11 | 0.54 |
PF03551 | PadR | 0.54 |
PF00850 | Hist_deacetyl | 0.54 |
PF00400 | WD40 | 0.54 |
PF07228 | SpoIIE | 0.54 |
PF00578 | AhpC-TSA | 0.54 |
PF13286 | HD_assoc | 0.54 |
PF01593 | Amino_oxidase | 0.54 |
PF02492 | cobW | 0.54 |
PF00486 | Trans_reg_C | 0.54 |
PF13305 | TetR_C_33 | 0.54 |
PF13826 | DUF4188 | 0.54 |
PF06127 | Mpo1-like | 0.54 |
PF01435 | Peptidase_M48 | 0.54 |
PF02954 | HTH_8 | 0.54 |
PF08327 | AHSA1 | 0.54 |
PF00890 | FAD_binding_2 | 0.54 |
PF00005 | ABC_tran | 0.54 |
PF00150 | Cellulase | 0.54 |
PF12679 | ABC2_membrane_2 | 0.54 |
PF10067 | DUF2306 | 0.54 |
PF02843 | GARS_C | 0.54 |
PF01833 | TIG | 0.54 |
PF02517 | Rce1-like | 0.54 |
PF03352 | Adenine_glyco | 0.54 |
PF14534 | DUF4440 | 0.54 |
PF07687 | M20_dimer | 0.54 |
PF13358 | DDE_3 | 0.54 |
PF00679 | EFG_C | 0.54 |
PF13469 | Sulfotransfer_3 | 0.54 |
PF13683 | rve_3 | 0.54 |
PF04012 | PspA_IM30 | 0.54 |
PF02786 | CPSase_L_D2 | 0.54 |
PF12838 | Fer4_7 | 0.54 |
PF00753 | Lactamase_B | 0.54 |
PF12850 | Metallophos_2 | 0.54 |
PF12704 | MacB_PCD | 0.54 |
PF02687 | FtsX | 0.54 |
PF13366 | PDDEXK_3 | 0.54 |
PF07593 | UnbV_ASPIC | 0.54 |
PF01433 | Peptidase_M1 | 0.54 |
PF01663 | Phosphodiest | 0.54 |
PF07301 | DUF1453 | 0.54 |
PF14310 | Fn3-like | 0.54 |
PF00326 | Peptidase_S9 | 0.54 |
PF13365 | Trypsin_2 | 0.54 |
PF07920 | DUF1684 | 0.54 |
PF07519 | Tannase | 0.54 |
PF13490 | zf-HC2 | 0.54 |
PF11188 | DUF2975 | 0.54 |
COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.35 |
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.09 |
COG1842 | Phage shock protein A | Transcription [K] | 1.09 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.09 |
COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.54 |
COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.54 |
COG0557 | Exoribonuclease R | Transcription [K] | 0.54 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.54 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.54 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.54 |
COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.54 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.54 |
COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.54 |
COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.54 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.54 |
COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 0.54 |
COG4776 | Exoribonuclease II | Transcription [K] | 0.54 |
COG4846 | Cytochrome c biogenesis protein CcdC | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.20 % |
Unclassified | root | N/A | 3.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001124|JGI12692J13336_1005212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 689 | Open in IMG/M |
3300001131|JGI12631J13338_1033921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 522 | Open in IMG/M |
3300001989|JGI24739J22299_10120966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101126988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101781636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300004082|Ga0062384_100944174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 613 | Open in IMG/M |
3300004092|Ga0062389_101309188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 910 | Open in IMG/M |
3300004633|Ga0066395_10080442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1524 | Open in IMG/M |
3300004635|Ga0062388_102034284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 595 | Open in IMG/M |
3300005093|Ga0062594_100318475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1197 | Open in IMG/M |
3300005445|Ga0070708_101173493 | Not Available | 718 | Open in IMG/M |
3300005534|Ga0070735_10450200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300005610|Ga0070763_10015637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3244 | Open in IMG/M |
3300005610|Ga0070763_10923962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300005644|Ga0075036_1720798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 788 | Open in IMG/M |
3300005764|Ga0066903_103608437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 833 | Open in IMG/M |
3300005843|Ga0068860_100344198 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
3300005921|Ga0070766_11310810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300006028|Ga0070717_11817729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 550 | Open in IMG/M |
3300006175|Ga0070712_101843874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300006755|Ga0079222_10943121 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300006755|Ga0079222_11542153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 626 | Open in IMG/M |
3300009137|Ga0066709_100784339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1379 | Open in IMG/M |
3300009518|Ga0116128_1026837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1930 | Open in IMG/M |
3300009635|Ga0116117_1106608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300009639|Ga0116122_1038483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1647 | Open in IMG/M |
3300009644|Ga0116121_1004932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4718 | Open in IMG/M |
3300009660|Ga0105854_1070474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 1071 | Open in IMG/M |
3300009826|Ga0123355_11448210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300010048|Ga0126373_10809847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 999 | Open in IMG/M |
3300010048|Ga0126373_10905547 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300010048|Ga0126373_11424278 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300010048|Ga0126373_11797314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300010159|Ga0099796_10562759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300010358|Ga0126370_11082509 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300010361|Ga0126378_11555189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
3300010361|Ga0126378_12728852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300010361|Ga0126378_13002598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300010366|Ga0126379_10983414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
3300010366|Ga0126379_11685859 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300010376|Ga0126381_102496155 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300010376|Ga0126381_105014828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300010379|Ga0136449_100148017 | All Organisms → cellular organisms → Bacteria | 4618 | Open in IMG/M |
3300010398|Ga0126383_13641031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300012205|Ga0137362_11316989 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300012923|Ga0137359_10998073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 719 | Open in IMG/M |
3300012924|Ga0137413_11352262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 574 | Open in IMG/M |
3300012971|Ga0126369_12819045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300012971|Ga0126369_12930159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300012972|Ga0134077_10178506 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300013105|Ga0157369_11372071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300013306|Ga0163162_12123959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300014158|Ga0181521_10410879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300014160|Ga0181517_10622404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300014169|Ga0181531_10835890 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300014200|Ga0181526_10526070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 748 | Open in IMG/M |
3300014489|Ga0182018_10167235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1248 | Open in IMG/M |
3300014489|Ga0182018_10207852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
3300014489|Ga0182018_10224561 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300014495|Ga0182015_10013613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7090 | Open in IMG/M |
3300014495|Ga0182015_10815981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300014657|Ga0181522_10135613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
3300016270|Ga0182036_10148825 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300016270|Ga0182036_10647962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 851 | Open in IMG/M |
3300016341|Ga0182035_11073184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300016357|Ga0182032_10095589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2083 | Open in IMG/M |
3300016357|Ga0182032_11599854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 567 | Open in IMG/M |
3300016371|Ga0182034_10935236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. KBS0703 | 747 | Open in IMG/M |
3300016371|Ga0182034_11042307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300016750|Ga0181505_11144261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2221 | Open in IMG/M |
3300017822|Ga0187802_10283319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300017925|Ga0187856_1136200 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300017927|Ga0187824_10337255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300017931|Ga0187877_1039160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2266 | Open in IMG/M |
3300017937|Ga0187809_10389364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 529 | Open in IMG/M |
3300017940|Ga0187853_10188717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
3300017946|Ga0187879_10318458 | Not Available | 863 | Open in IMG/M |
3300017946|Ga0187879_10498278 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300017948|Ga0187847_10037479 | All Organisms → cellular organisms → Bacteria | 2842 | Open in IMG/M |
3300017959|Ga0187779_10785435 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300017970|Ga0187783_10027518 | All Organisms → cellular organisms → Bacteria | 4212 | Open in IMG/M |
3300018006|Ga0187804_10449558 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300018018|Ga0187886_1388548 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300018030|Ga0187869_10107346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1406 | Open in IMG/M |
3300018033|Ga0187867_10020751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4235 | Open in IMG/M |
3300018034|Ga0187863_10436810 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300018034|Ga0187863_10817137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300018038|Ga0187855_10281770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 973 | Open in IMG/M |
3300018040|Ga0187862_10459751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 771 | Open in IMG/M |
3300018042|Ga0187871_10116163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1532 | Open in IMG/M |
3300018043|Ga0187887_10059279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2339 | Open in IMG/M |
3300018043|Ga0187887_10680101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300018046|Ga0187851_10116897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1642 | Open in IMG/M |
3300018057|Ga0187858_10088726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2125 | Open in IMG/M |
3300018057|Ga0187858_10646399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 634 | Open in IMG/M |
3300018085|Ga0187772_10881145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300018085|Ga0187772_11247033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300018086|Ga0187769_10104404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2039 | Open in IMG/M |
3300018086|Ga0187769_11257700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300018088|Ga0187771_10295531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1356 | Open in IMG/M |
3300019361|Ga0173482_10623914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300019879|Ga0193723_1119769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
3300021168|Ga0210406_10062154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3236 | Open in IMG/M |
3300021171|Ga0210405_10704896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 780 | Open in IMG/M |
3300021181|Ga0210388_10060053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3184 | Open in IMG/M |
3300021358|Ga0213873_10047135 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
3300021358|Ga0213873_10200396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300021401|Ga0210393_10634049 | Not Available | 873 | Open in IMG/M |
3300021401|Ga0210393_10875550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300021401|Ga0210393_11430138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300021420|Ga0210394_11379595 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300021433|Ga0210391_10430721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
3300021479|Ga0210410_11081198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300021560|Ga0126371_10197693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2104 | Open in IMG/M |
3300021560|Ga0126371_10853294 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300021560|Ga0126371_11707508 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300021861|Ga0213853_10476610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300025576|Ga0208820_1009141 | All Organisms → cellular organisms → Bacteria | 3630 | Open in IMG/M |
3300025905|Ga0207685_10490998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 645 | Open in IMG/M |
3300025906|Ga0207699_11335473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 531 | Open in IMG/M |
3300025915|Ga0207693_10234673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
3300025916|Ga0207663_10331421 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300025922|Ga0207646_10974493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300025941|Ga0207711_10428385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1231 | Open in IMG/M |
3300026078|Ga0207702_10449274 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300026514|Ga0257168_1061514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 827 | Open in IMG/M |
3300027432|Ga0209421_1058571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 772 | Open in IMG/M |
3300027459|Ga0207505_114174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300027604|Ga0208324_1100996 | Not Available | 806 | Open in IMG/M |
3300027609|Ga0209221_1089979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 794 | Open in IMG/M |
3300027635|Ga0209625_1109935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300027671|Ga0209588_1070074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1133 | Open in IMG/M |
3300027692|Ga0209530_1003155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5942 | Open in IMG/M |
3300027765|Ga0209073_10423359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 550 | Open in IMG/M |
3300027812|Ga0209656_10166657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
3300027855|Ga0209693_10578894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300027903|Ga0209488_10276661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1256 | Open in IMG/M |
3300027905|Ga0209415_10166283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2171 | Open in IMG/M |
3300027908|Ga0209006_10036362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4452 | Open in IMG/M |
3300028017|Ga0265356_1035337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300028381|Ga0268264_10323746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1458 | Open in IMG/M |
3300029817|Ga0247275_1045482 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300029883|Ga0311327_10524985 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300029999|Ga0311339_10850017 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300030007|Ga0311338_11164964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300030057|Ga0302176_10371355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300030503|Ga0311370_10177737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 2896 | Open in IMG/M |
3300030524|Ga0311357_11433698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 587 | Open in IMG/M |
3300031057|Ga0170834_103344003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300031231|Ga0170824_117853373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300031234|Ga0302325_10082583 | All Organisms → cellular organisms → Bacteria | 6131 | Open in IMG/M |
3300031236|Ga0302324_100527793 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
3300031236|Ga0302324_101014145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1127 | Open in IMG/M |
3300031247|Ga0265340_10242123 | Not Available | 805 | Open in IMG/M |
3300031525|Ga0302326_10754296 | Not Available | 1411 | Open in IMG/M |
3300031525|Ga0302326_12442878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 658 | Open in IMG/M |
3300031573|Ga0310915_10498104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
3300031715|Ga0307476_11185740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300031781|Ga0318547_10666997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300031823|Ga0307478_11214331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300031859|Ga0318527_10235872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 777 | Open in IMG/M |
3300031890|Ga0306925_10316397 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
3300031890|Ga0306925_11364082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 701 | Open in IMG/M |
3300031910|Ga0306923_10295251 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300031941|Ga0310912_11305813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300031942|Ga0310916_10451361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
3300031946|Ga0310910_10930046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 681 | Open in IMG/M |
3300031962|Ga0307479_10311844 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300031962|Ga0307479_10385949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1385 | Open in IMG/M |
3300032001|Ga0306922_12245964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 525 | Open in IMG/M |
3300032076|Ga0306924_12007800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300032160|Ga0311301_10738514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1371 | Open in IMG/M |
3300032261|Ga0306920_102943000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300032261|Ga0306920_103461857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300032805|Ga0335078_11257027 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300032805|Ga0335078_11843697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 655 | Open in IMG/M |
3300032829|Ga0335070_10390942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1332 | Open in IMG/M |
3300032892|Ga0335081_11684091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 692 | Open in IMG/M |
3300032892|Ga0335081_12076574 | Not Available | 603 | Open in IMG/M |
3300032895|Ga0335074_10344670 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
3300032954|Ga0335083_10672693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300033290|Ga0318519_10349514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 874 | Open in IMG/M |
3300033405|Ga0326727_10742225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300033755|Ga0371489_0363644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.61% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.43% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.89% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.80% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.80% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.26% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.72% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.72% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.72% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.17% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.17% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.17% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.09% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.09% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.09% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.09% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.09% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.09% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.54% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.54% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.54% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.54% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.54% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001124 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 | Environmental | Open in IMG/M |
3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005644 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027459 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12692J13336_10052122 | 3300001124 | Forest Soil | MKTAIYGRVVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAILGG* |
JGI12631J13338_10339211 | 3300001131 | Forest Soil | WKLPMKTAIYGRVVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAILGG* |
JGI24739J22299_101209662 | 3300001989 | Corn Rhizosphere | MKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIG |
JGIcombinedJ26739_1011269882 | 3300002245 | Forest Soil | MKTALYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWSLPF |
JGIcombinedJ26739_1017816361 | 3300002245 | Forest Soil | MQTAFYGRIVFGASAVLFGVIALMWHDSDTWQNLQQIWRLPF |
Ga0062384_1009441741 | 3300004082 | Bog Forest Soil | LYENSVVRIIFGASAVLLGVLALMWYDSDTWQTLRQIWSLPFGTIIGG |
Ga0062389_1013091882 | 3300004092 | Bog Forest Soil | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPF |
Ga0066395_100804421 | 3300004633 | Tropical Forest Soil | MRTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAI |
Ga0062388_1020342841 | 3300004635 | Bog Forest Soil | LYENSVVRIIFGASAVLLGVLALMWYDSDTWQTLRQIWSLPF |
Ga0062594_1003184752 | 3300005093 | Soil | MKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMT |
Ga0070708_1011734932 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAALYGRVVFGASAVLFGVIALMWHDADTWQNLQHIWSLPFG |
Ga0070735_104502001 | 3300005534 | Surface Soil | VLLFLCMRTALYGRIVFGASAVLLGVIALMWYDADTWQTLRQIWSLP |
Ga0070763_100156376 | 3300005610 | Soil | MKTALYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWSLP |
Ga0070763_109239621 | 3300005610 | Soil | MKTALYGRIVFGASAVLFGVIALMWHDSDTWQSLTQIWSLPFGTIVGGCLM |
Ga0075036_17207981 | 3300005644 | Permafrost Soil | MKTGYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGG |
Ga0066903_1036084371 | 3300005764 | Tropical Forest Soil | MRTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAIIGACL |
Ga0068860_1003441981 | 3300005843 | Switchgrass Rhizosphere | MKTALYGRIFFGASAVLFGVIALMWHDADIWQNLQHIWSLPFGT |
Ga0070766_113108101 | 3300005921 | Soil | MKTALYGRIFFGASAVLFGVIAVMWHDADTWQNLQHIWSLP |
Ga0070717_118177292 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTAAYGRFVFGASAVLFGVIALTWHDPDTWQNLQHIW |
Ga0070712_1018438742 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTALYGRIFFGASAVLFGFIALMWHDADTWQNLQHIWSLPFGTVIGGCLMIAQ |
Ga0079222_109431211 | 3300006755 | Agricultural Soil | MIFGASAVLFGFIALMWHDADTWQTLRQIWSLPFGAIIGAC |
Ga0079222_115421532 | 3300006755 | Agricultural Soil | MKAALYGRIVFGACAVLFGVIALMWHDSDTWQALRKIWSLPLAQPLAGVS* |
Ga0066709_1007843392 | 3300009137 | Grasslands Soil | MKTGLYARIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTVIGGCLMAA* |
Ga0116128_10268371 | 3300009518 | Peatland | MKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTIIGGCLMTAQ |
Ga0116117_11066082 | 3300009635 | Peatland | MKTELYGRIVFGASAVLLGVIALMWYDPDTWQTLRQIWSLPFG |
Ga0116122_10384832 | 3300009639 | Peatland | MKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLRQ |
Ga0116121_10049322 | 3300009644 | Peatland | MKTAIYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGV |
Ga0105854_10704741 | 3300009660 | Permafrost Soil | MKTEYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWS |
Ga0123355_114482102 | 3300009826 | Termite Gut | MKTRRYGRIVFGASAALFGGIALLWHDADTWQNLRQIWSFPFGIVI |
Ga0126373_108098472 | 3300010048 | Tropical Forest Soil | MKTVQFGRIVFGASAVLFGVIALRWHDADTWQTLREIW |
Ga0126373_109055472 | 3300010048 | Tropical Forest Soil | MKTALYGRIVFGASAVLFGVIALIWHDAETWQNLR |
Ga0126373_114242782 | 3300010048 | Tropical Forest Soil | VNTAVYGRLVFGASAVLFGIIALLWHDSDTWQNLQQIWSLPFGTI |
Ga0126373_117973142 | 3300010048 | Tropical Forest Soil | MKTVLYGRIVFGASAVLFGSVAPMWHDSHTWQTLRQIWSLPFGIIIGGCLTFRIQ* |
Ga0099796_105627591 | 3300010159 | Vadose Zone Soil | MKTALYGRIVFGASAVLFGVITLLWHDADTWQNLLHIWSLPFGTI |
Ga0126370_110825091 | 3300010358 | Tropical Forest Soil | VKKVLYGRFVFGASAVLFGVMALMWHDADTWQALQQIWSLPFG |
Ga0126378_115551893 | 3300010361 | Tropical Forest Soil | VKAALYGRIVFVGPAVLFGIIALMWHDSDTWQNLQHIWSLPFGTIIG |
Ga0126378_127288521 | 3300010361 | Tropical Forest Soil | MKTSFYGRVVFGASAVLFGVIALMWHDTETWQTLQHLWSLP |
Ga0126378_130025981 | 3300010361 | Tropical Forest Soil | MKTALYGRIVFGASAVLFGVIALIWHDAETWQNLRHIWR |
Ga0126379_109834141 | 3300010366 | Tropical Forest Soil | MKTALYERMAFGAAAVLFGVIALLWYDSATWQALRQIWSLP |
Ga0126379_116858592 | 3300010366 | Tropical Forest Soil | MKTALYGRIVFGASAVLFGVIALIWHDAETWQNLRHIWRL |
Ga0126381_1024961551 | 3300010376 | Tropical Forest Soil | VQTALYGRLVFGASAVLFGVIALLWHDSDTWQTLQQIRSLPFGTVIGGCLMAAQ |
Ga0126381_1050148282 | 3300010376 | Tropical Forest Soil | MKTAFYGRMVFGAAAVLFGVIALMWHDADAWQNLQHIWSAPFGTI |
Ga0136449_1001480176 | 3300010379 | Peatlands Soil | MKTALYGRVVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTIIGACL |
Ga0126383_136410311 | 3300010398 | Tropical Forest Soil | MKTALYGRIVFGASLFGVIALMWYDSDTWQTLRQIWRLPFGAIIGGCLM |
Ga0137362_113169891 | 3300012205 | Vadose Zone Soil | MKTGLYARLVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPF |
Ga0137359_109980731 | 3300012923 | Vadose Zone Soil | MKTALYGRIFFGASAVLFGVIALMWDDANTWQNLQHI |
Ga0137413_113522622 | 3300012924 | Vadose Zone Soil | MKTALYGRIFFGASAVLFGVIALLWHDADTWQNLQHIW |
Ga0126369_128190452 | 3300012971 | Tropical Forest Soil | MKTALYGRIVFGASAVLFGVIALIWHDAETWQNLRHIWRLPLG |
Ga0126369_129301591 | 3300012971 | Tropical Forest Soil | MKTALYGRIVFGGSAVLFGVIALMWHDADTWQPCG |
Ga0134077_101785062 | 3300012972 | Grasslands Soil | MKTALYGRIVFGASAVLFGAIALMWYDSDTWQTLRQIWTL |
Ga0157369_113720712 | 3300013105 | Corn Rhizosphere | MKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGC |
Ga0163162_121239591 | 3300013306 | Switchgrass Rhizosphere | MKTALYGRIFFGASAVLFGVIALMWHDADIWQNLQHIW |
Ga0181521_104108791 | 3300014158 | Bog | MRTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGAIIGGCLM |
Ga0181517_106224041 | 3300014160 | Bog | MKAASYGRIVFGASAVLFGVIALMWYDPDTWQTLHQIWSLPF |
Ga0181531_108358902 | 3300014169 | Bog | MKTASYGRIVLGASAVLSGVIALLWYDSDTWQTLR |
Ga0181526_105260701 | 3300014200 | Bog | MRTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPFGTIVGGC |
Ga0182018_101672352 | 3300014489 | Palsa | MKTALYGRIVFGASAALSGVIALMWYDSDTWQTLRQLW |
Ga0182018_102078521 | 3300014489 | Palsa | MKTALYGRIVFGGSAVLLGVIALMWYDSDTWQTLRQLWS |
Ga0182018_102245612 | 3300014489 | Palsa | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTI |
Ga0182015_100136139 | 3300014495 | Palsa | MKTALYGRIVFGAAAVLFGVIALMWHDADTWQDLQHIW |
Ga0182015_108159811 | 3300014495 | Palsa | MKTALYGRIVFGGSAVLFGVIALIWHDADTWQSLHRILRLPFG |
Ga0181522_101356131 | 3300014657 | Bog | MKTAIYGRMVFGASAVLFGFIALLWHDADTWQNLQHIWNLPFG |
Ga0182036_101488251 | 3300016270 | Soil | MKTALYGRIVFGASAVLFGIIALMWYDPDTWQTLRHIWSLPFGTIIGGS |
Ga0182036_106479621 | 3300016270 | Soil | VLLFPGKKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQI |
Ga0182035_110731841 | 3300016341 | Soil | MKTALYGRILFGASAVLFGVIALMWHDPDTWQNLQQVWRLPFGALI |
Ga0182032_100955891 | 3300016357 | Soil | MKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQ |
Ga0182032_115998541 | 3300016357 | Soil | MKTALYGGIVFGASAVLFGVIPLMWYDSDTWQTLRQIW |
Ga0182034_109352361 | 3300016371 | Soil | MKTALYGRIVFGASAVLFGVIALMWHDPDTWQNLQQIWRVPF |
Ga0182034_110423071 | 3300016371 | Soil | MKTALYGRILFGASAVLFGVIALMWHDPDTWQNLRQVWRLPFGALIGGCLMTEVLQTEEE |
Ga0181505_111442612 | 3300016750 | Peatland | MKTALYGRIVFGAAAVLFSVIALMWHDADTWQNLQYIWSLPFGTIIG |
Ga0187802_102833191 | 3300017822 | Freshwater Sediment | MKTALYGRVVFGAAAVLFAVIALMWHDADTLQNLQHIWSLP |
Ga0187856_11362003 | 3300017925 | Peatland | MKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGT |
Ga0187824_103372552 | 3300017927 | Freshwater Sediment | MRTTLLGCLVFAASTVLFGVIALMWHDADTWQTAFRILSLPFGTAIG |
Ga0187877_10391601 | 3300017931 | Peatland | MKTAIYGRMVFGASAVLFGVIALLWHDADTWQNLQH |
Ga0187809_103893642 | 3300017937 | Freshwater Sediment | MKTALFGRILFGASAVLLGVIALMWYDADTWQTLRQIWSLPFG |
Ga0187853_101887173 | 3300017940 | Peatland | MKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTIIG |
Ga0187879_103184582 | 3300017946 | Peatland | MKTALCGRIVFGASAVLFGVIALMWHDADTWQNLQHIWSLPFGTLIGGCLM |
Ga0187879_104982782 | 3300017946 | Peatland | MKAALYGRIVFGASAVLLGVVALMWYDSDTWQTLRQIWTLPFG |
Ga0187847_100374793 | 3300017948 | Peatland | MKTAIYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGVILGDCLMIAEIA |
Ga0187779_107854351 | 3300017959 | Tropical Peatland | MKTASYGRLVFGGSAMLSGVIALMWYDSDTWQTLRQIW |
Ga0187783_100275186 | 3300017970 | Tropical Peatland | MKTASYGRVVFGASAVLFGIIALMWHDADTWQSLQHLWSLPFGTIIG |
Ga0187804_104495581 | 3300018006 | Freshwater Sediment | MKTASYGRILLGASAVLFGIIALMWHDSDTWQTLRQIWSLPFG |
Ga0187886_13885481 | 3300018018 | Peatland | MKTALYGRIVFGASAVLFGVIALIWHDADTWQNLQHIWSLPLGVIIGG |
Ga0187869_101073462 | 3300018030 | Peatland | MKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLRQIWSLPFGTIIGGCL |
Ga0187867_100207511 | 3300018033 | Peatland | MKTAIYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGVILGDCLMIAEI |
Ga0187863_104368101 | 3300018034 | Peatland | MKTAFYGRIVFGASAVLFGAIALMWHDADTWQNLQHIWSLPLGVIIG |
Ga0187863_108171371 | 3300018034 | Peatland | MKTALYGRIVFGAAAVLFGVIALMWHDADTWQDLQHIWNLPFGAIIGGCLMTAQI |
Ga0187855_102817702 | 3300018038 | Peatland | MKTVIYGRIVFGAPAVLFGVIALLWHDADTWQNLQH |
Ga0187862_104597512 | 3300018040 | Peatland | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQSLSQIWSL |
Ga0187871_101161633 | 3300018042 | Peatland | MKTALYGRIVFGASAVLCGVIALMWYDSDTWQTLRQIWSLPFGTI |
Ga0187887_100592791 | 3300018043 | Peatland | MKTAIYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGVILGDCL |
Ga0187887_106801011 | 3300018043 | Peatland | MKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFG |
Ga0187851_101168971 | 3300018046 | Peatland | MKTVSYGRIVFGASAAFFGVIAMMWHDTDTWQTLSQIWSLPLGAIL |
Ga0187858_100887261 | 3300018057 | Peatland | MKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLRQIWS |
Ga0187858_106463991 | 3300018057 | Peatland | MKSLYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWT |
Ga0187772_108811451 | 3300018085 | Tropical Peatland | MKTALYRRIVFGASAVLFGAIALMWHDADTWQTLREIWRLPFG |
Ga0187772_112470332 | 3300018085 | Tropical Peatland | MKRALYGRIVFGASAVLFGVIALMWHDPDTWQNLQ |
Ga0187769_101044041 | 3300018086 | Tropical Peatland | MKTALYGRIVFGASAVLFGVIALMWHDPDTLQNLQQIWHLPFGLIIGGCLMAV |
Ga0187769_112577002 | 3300018086 | Tropical Peatland | MKTAWFGRMVFGAAAVLFGVIALMWHDAETWQSVQHIWSLPF |
Ga0187771_102955314 | 3300018088 | Tropical Peatland | MKSAVYGRMVFGASAVLFGAIALMWHDSATWQTLQQIWSLPFGVLIGGCLMA |
Ga0173482_106239141 | 3300019361 | Soil | MKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMTLKSRAGSHYSRPVPCA |
Ga0193723_11197693 | 3300019879 | Soil | MKAALYGRVVFGASAVLFGVIALMWHDADTWQNLQHIWSLPFGTV |
Ga0210406_100621545 | 3300021168 | Soil | MKTTLHGRIVFGASAVLFGVIALMWHDSETWQTLRQIWSLPFGVI |
Ga0210405_107048962 | 3300021171 | Soil | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPF |
Ga0210388_100600533 | 3300021181 | Soil | MKTAFYGRVVFGASAVLFGVIALMWHDADTWQRLQH |
Ga0213873_100471353 | 3300021358 | Rhizosphere | MTRALYGRIVFGASAVMFGVVGLMWRSSDMWQYLHPIPG |
Ga0213873_102003961 | 3300021358 | Rhizosphere | MKPAYYARILFGLSAVLFGVIALMWHDADTWQTLRRIWSVPFGTLI |
Ga0210393_106340491 | 3300021401 | Soil | MKMYGRIVYGASAVLLGVIALMWYDSDTWQTLSQI |
Ga0210393_108755501 | 3300021401 | Soil | MKTAFYGRVVFGASAVLFGVIALMWHDADTWQSLQHL |
Ga0210393_114301382 | 3300021401 | Soil | MKTASYGRIVFGAAAVLFGVIALVWHDADTWQNLQHIWSLPFGTIIG |
Ga0210394_113795952 | 3300021420 | Soil | MKTALSGRIVFGASAVLLGVIALLWYDSDTWQTLRQIWSLP |
Ga0210391_104307211 | 3300021433 | Soil | MKTAFYGRVIFGASAVLFGVIALMWHDADTWQSLQHLWSLPF |
Ga0210410_110811982 | 3300021479 | Soil | MKTALYGRVVFGASAVLFGGIALMWHDADTWQNLQHIWSLPFGTVIG |
Ga0126371_101976931 | 3300021560 | Tropical Forest Soil | VKTALCGRIVFGASAVLFGVIALMWHDSDTWQNLKHIW |
Ga0126371_108532941 | 3300021560 | Tropical Forest Soil | MKTALYGRIVFGASAVLFGVIALIWHDAETWQNLRHIWRLPLGTIIGGCLM |
Ga0126371_117075082 | 3300021560 | Tropical Forest Soil | MKTAFYGRIVFGASAVLFGVIALIWHDAETWQNLRHIW |
Ga0213853_104766102 | 3300021861 | Watersheds | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMIVQ |
Ga0208820_10091411 | 3300025576 | Peatland | MKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLRQIWSLPFGTIIGGCLMTAQI |
Ga0207685_104909982 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRALYGRVVFGASAVLFGVIALMWHDADTWQNLQHIWSLP |
Ga0207699_113354731 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTALYGRIVFGASAVLFGVIALMWHDPETWQTLR |
Ga0207693_102346733 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTALYGRIFFGASAVLFGFIALMWHDADTWQNLQHIWSLPFGTVIGGCLM |
Ga0207663_103314212 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTALYGRIFFGTSAVLFGVIALMWNDADTWQNLQHIWSLPFGTVIG |
Ga0207646_109744933 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTALYGRIVFGAAAVLFGVIALLWHDVDTWQNLQHIWSLPFGAIIGGC |
Ga0207711_104283851 | 3300025941 | Switchgrass Rhizosphere | MKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMTL |
Ga0207702_104492742 | 3300026078 | Corn Rhizosphere | MKTASYGRFVFGASAVLFGVIALTWHDPDTWQNLQHIWALPFGTVIGGC |
Ga0257168_10615142 | 3300026514 | Soil | MKTALYGRIFFGASAVLFGVIALMWHDANTWQNLQHIWSLPFG |
Ga0209421_10585712 | 3300027432 | Forest Soil | MKTALYGRIVFGASAVLFGVIALLWYDADTWQTLRQMWSLPFGTIIGG |
Ga0207505_1141741 | 3300027459 | Soil | MRTTLFGCLVFAASTVLFGVIALMWHDADTWQTPFRILSLPF |
Ga0208324_11009962 | 3300027604 | Peatlands Soil | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLP |
Ga0209221_10899791 | 3300027609 | Forest Soil | MKTAIYGRVVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAILGG |
Ga0209625_11099351 | 3300027635 | Forest Soil | MKTALYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWSLPFG |
Ga0209588_10700742 | 3300027671 | Vadose Zone Soil | MKTALYGRIFFGASMVLFGVIALMWHDANTWQNLEHIWSLPFGTVIG |
Ga0209530_10031551 | 3300027692 | Forest Soil | WKLPMKTAIYGRVVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAILGG |
Ga0209073_104233592 | 3300027765 | Agricultural Soil | MKAALYGRIVFGACAVLFGVIALMWHDSDTWQALRKIWSLPLAQPLAGVS |
Ga0209656_101666571 | 3300027812 | Bog Forest Soil | MKTALYGRIVFGASAVLFGVIALMWCDSDTWQTLRQIWSLPFGTIIG |
Ga0209693_105788942 | 3300027855 | Soil | MKTAWYGRRVFGASAVLFGIIALMWWDADTWQTLSQIW |
Ga0209488_102766611 | 3300027903 | Vadose Zone Soil | MKTALYGRIFFGASAVLFGVIALMWDDANTWQTCNISGDCLL |
Ga0209415_101662831 | 3300027905 | Peatlands Soil | MKTALYGRIVFGAAAVLFAVIALMWRDADTWQNLQH |
Ga0209006_100363621 | 3300027908 | Forest Soil | VRGCYCFRMKPELCGRIVFGGSAVLFGVIALMWYDADTWQTLRQIWSVPFGTIIG |
Ga0265356_10353371 | 3300028017 | Rhizosphere | MKTALYGRIVFGASAVLFGVIALMWHDSDTWQNLQQIWRLPFGTLIGGCLMAAL |
Ga0268264_103237461 | 3300028381 | Switchgrass Rhizosphere | MKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMTLKS |
Ga0247275_10454821 | 3300029817 | Soil | MKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTISGGCLM |
Ga0311327_105249851 | 3300029883 | Bog | MKAASYGRIVFGAAAVLFGVIALMWYDAATWQTLREIWNLPFGATIGGCLM |
Ga0311339_108500171 | 3300029999 | Palsa | MRTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRRIWSLPFGTIVG |
Ga0311338_111649642 | 3300030007 | Palsa | MKTALYGRIVFGGSAVLFGAIALMWHDADTWQSVHRILRLP |
Ga0302176_103713551 | 3300030057 | Palsa | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPFG |
Ga0311370_101777373 | 3300030503 | Palsa | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLP |
Ga0311357_114336982 | 3300030524 | Palsa | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPFGTIIGG |
Ga0170834_1033440031 | 3300031057 | Forest Soil | MKTALYGRIVIGASAVLFGVIALMWHDANTWQNLQHIWSLPFGT |
Ga0170824_1178533731 | 3300031231 | Forest Soil | MKTALYGRIVIGASAVLFGVIALMWHDSDTWQNLQQIWRL |
Ga0302325_100825831 | 3300031234 | Palsa | MKTALYGRIVFGSSAVLFGVIALMWYDSDTWQTLRQIWSLPFGNIIGGCL |
Ga0302324_1005277933 | 3300031236 | Palsa | MKTALYGRIVFGSSAVLFGVIALMWYDSDTWQTLRQIWSLPFGNIIGG |
Ga0302324_1010141451 | 3300031236 | Palsa | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFG |
Ga0265340_102421231 | 3300031247 | Rhizosphere | MKAALYGRIVFGASAVLFGVIALFWHDPDTWQSLVRIWRLPFGTVIGQCLMIVL |
Ga0302326_107542961 | 3300031525 | Palsa | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGC |
Ga0302326_124428781 | 3300031525 | Palsa | VKPTALRVLLFSYMKTALYGRIVFGASAVLLGVIALMWYDSDTWQTLRQIWS |
Ga0310915_104981041 | 3300031573 | Soil | MKGVQYGRLAFGIAAVLFGVIALMWHDADTWQALTKIWSLPSGTIIGECL |
Ga0307476_111857402 | 3300031715 | Hardwood Forest Soil | MKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLSQIWSMPFGIIV |
Ga0318547_106669971 | 3300031781 | Soil | MKTATYGRILFGASAVLFGVIALMWHDADTWQSLI |
Ga0307478_112143312 | 3300031823 | Hardwood Forest Soil | MKTPLCGRIVFGAAAALFGVIALMWHDADTWQNLQ |
Ga0318527_102358723 | 3300031859 | Soil | MKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAVIGACLM |
Ga0306925_103163971 | 3300031890 | Soil | MKTALYGRIVFGTSAVLVGVIALMWYDSDTWQTLRQIWSLPF |
Ga0306925_113640822 | 3300031890 | Soil | MKTGLYERIVFGRPAVLFGVIALMWHDPETWQNVH |
Ga0306923_102952514 | 3300031910 | Soil | MKTGLYERIVFGTPAVLFGVIALMWHDPETWQNVH |
Ga0310912_113058132 | 3300031941 | Soil | MKTALYGRILFGASAVLFGVIALMWHDPDTWQNLQQVWRLPFGAL |
Ga0310916_104513612 | 3300031942 | Soil | MKTALYGRIVFGASAVLFGVIALMWHDADTWQNLRQIWSLPSGIVI |
Ga0310910_109300462 | 3300031946 | Soil | MRKAVYGRIVFGASAVLFGVIALMWHDPETWQNVH |
Ga0307479_103118444 | 3300031962 | Hardwood Forest Soil | MKTALYGRIVFGASAVLFGMIALMWYDSDTWQTLRQIWS |
Ga0307479_103859493 | 3300031962 | Hardwood Forest Soil | MKTALYGRIFFGASAVLFGVIALMWHDANTWQNLQHIWSLPFGTVIGGCLMIAQI |
Ga0306922_122459641 | 3300032001 | Soil | MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWRLPFGITIGGCLMT |
Ga0306924_120078001 | 3300032076 | Soil | MNTRLYGRIVFGASAVLFGVIALMWHDADTWQTLRQIWSWPFGAIIGACL |
Ga0311301_107385141 | 3300032160 | Peatlands Soil | MKTALHGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWS |
Ga0306920_1029430001 | 3300032261 | Soil | MKTALYGRILLGASAVLFGVIALMWHDPDTWQNLQQVWRLPFGALIGGCLMT |
Ga0306920_1034618572 | 3300032261 | Soil | MKTALYGRILFGASAVLFGVIALMWHDPDTWQNLQQVWRLPFGALIGGCLMT |
Ga0335078_112570272 | 3300032805 | Soil | MKVPLCGRTVFGASAVLSGVIALMWHDSDTWQTLRQ |
Ga0335078_118436972 | 3300032805 | Soil | MVDRGRYLFSMKTELYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPFGAIIGG |
Ga0335070_103909421 | 3300032829 | Soil | MGTAVYGRIVFGASAVLFGVIALLWHDADTWQELQHIWGLPFGIIVGESLM |
Ga0335081_116840912 | 3300032892 | Soil | METAWHGRLAFGASAVLFGSIALLWHDADTWQTLR |
Ga0335081_120765741 | 3300032892 | Soil | MVFGASAVLFGVIALMWHDSDTWQSLRQIWSLPFGAIIGEVLMAAQI |
Ga0335074_103446704 | 3300032895 | Soil | MKTAGRIVLGAAAVLFGIIALRWHDTDTWQNVHHV |
Ga0335083_106726931 | 3300032954 | Soil | MKTAQYGRIVFGGSAVLFGVLALIWPDSDTWQTLRQL |
Ga0318519_103495141 | 3300033290 | Soil | MKTGLYERIVLGTPAVLFGVIALMWHDPETWQNVH |
Ga0326727_107422252 | 3300033405 | Peat Soil | MKTAIYGRIVFGASAVLFGVIALLWHDLDTWQNLQHIWKWPFGAILGG |
Ga0371489_0363644_528_674 | 3300033755 | Peat Soil | MKTALWGRILFGGSAVLFGVIALMWHDADTVQNLLRIWMLPFGIVIGGG |
⦗Top⦘ |