NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F030822

Metagenome / Metatranscriptome Family F030822

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030822
Family Type Metagenome / Metatranscriptome
Number of Sequences 184
Average Sequence Length 44 residues
Representative Sequence MKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFG
Number of Associated Samples 149
Number of Associated Scaffolds 184

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 28.80 %
% of genes near scaffold ends (potentially truncated) 92.39 %
% of genes from short scaffolds (< 2000 bps) 88.04 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.196 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(10.870 % of family members)
Environment Ontology (ENVO) Unclassified
(23.370 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.11%    β-sheet: 0.00%    Coil/Unstructured: 47.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 184 Family Scaffolds
PF07676PD40 2.72
PF00903Glyoxalase 2.17
PF13592HTH_33 1.09
PF00069Pkinase 1.09
PF05960DUF885 1.09
PF04397LytTR 1.09
PF00773RNB 0.54
PF00149Metallophos 0.54
PF14833NAD_binding_11 0.54
PF03551PadR 0.54
PF00850Hist_deacetyl 0.54
PF00400WD40 0.54
PF07228SpoIIE 0.54
PF00578AhpC-TSA 0.54
PF13286HD_assoc 0.54
PF01593Amino_oxidase 0.54
PF02492cobW 0.54
PF00486Trans_reg_C 0.54
PF13305TetR_C_33 0.54
PF13826DUF4188 0.54
PF06127Mpo1-like 0.54
PF01435Peptidase_M48 0.54
PF02954HTH_8 0.54
PF08327AHSA1 0.54
PF00890FAD_binding_2 0.54
PF00005ABC_tran 0.54
PF00150Cellulase 0.54
PF12679ABC2_membrane_2 0.54
PF10067DUF2306 0.54
PF02843GARS_C 0.54
PF01833TIG 0.54
PF02517Rce1-like 0.54
PF03352Adenine_glyco 0.54
PF14534DUF4440 0.54
PF07687M20_dimer 0.54
PF13358DDE_3 0.54
PF00679EFG_C 0.54
PF13469Sulfotransfer_3 0.54
PF13683rve_3 0.54
PF04012PspA_IM30 0.54
PF02786CPSase_L_D2 0.54
PF12838Fer4_7 0.54
PF00753Lactamase_B 0.54
PF12850Metallophos_2 0.54
PF12704MacB_PCD 0.54
PF02687FtsX 0.54
PF13366PDDEXK_3 0.54
PF07593UnbV_ASPIC 0.54
PF01433Peptidase_M1 0.54
PF01663Phosphodiest 0.54
PF07301DUF1453 0.54
PF14310Fn3-like 0.54
PF00326Peptidase_S9 0.54
PF13365Trypsin_2 0.54
PF07920DUF1684 0.54
PF07519Tannase 0.54
PF13490zf-HC2 0.54
PF11188DUF2975 0.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 184 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 4.35
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.09
COG1842Phage shock protein ATranscription [K] 1.09
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 1.09
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.54
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.54
COG0557Exoribonuclease RTranscription [K] 0.54
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.54
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.54
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.54
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.54
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.54
COG28183-methyladenine DNA glycosylase TagReplication, recombination and repair [L] 0.54
COG3358Uncharacterized conserved protein, DUF1684 familyFunction unknown [S] 0.54
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.54
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.54
COG45392-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids)Lipid transport and metabolism [I] 0.54
COG4776Exoribonuclease IITranscription [K] 0.54
COG4846Cytochrome c biogenesis protein CcdCPosttranslational modification, protein turnover, chaperones [O] 0.54


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.20 %
UnclassifiedrootN/A3.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001124|JGI12692J13336_1005212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4689Open in IMG/M
3300001131|JGI12631J13338_1033921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4522Open in IMG/M
3300001989|JGI24739J22299_10120966All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300002245|JGIcombinedJ26739_101126988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300002245|JGIcombinedJ26739_101781636All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300004082|Ga0062384_100944174All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4613Open in IMG/M
3300004092|Ga0062389_101309188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4910Open in IMG/M
3300004633|Ga0066395_10080442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans1524Open in IMG/M
3300004635|Ga0062388_102034284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4595Open in IMG/M
3300005093|Ga0062594_100318475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1197Open in IMG/M
3300005445|Ga0070708_101173493Not Available718Open in IMG/M
3300005534|Ga0070735_10450200All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300005610|Ga0070763_10015637All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3244Open in IMG/M
3300005610|Ga0070763_10923962All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300005644|Ga0075036_1720798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae788Open in IMG/M
3300005764|Ga0066903_103608437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans833Open in IMG/M
3300005843|Ga0068860_100344198All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300005921|Ga0070766_11310810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300006028|Ga0070717_11817729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola550Open in IMG/M
3300006175|Ga0070712_101843874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300006755|Ga0079222_10943121All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300006755|Ga0079222_11542153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4626Open in IMG/M
3300009137|Ga0066709_100784339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41379Open in IMG/M
3300009518|Ga0116128_1026837All Organisms → cellular organisms → Bacteria → Acidobacteria1930Open in IMG/M
3300009635|Ga0116117_1106608All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300009639|Ga0116122_1038483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1647Open in IMG/M
3300009644|Ga0116121_1004932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4718Open in IMG/M
3300009660|Ga0105854_1070474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae1071Open in IMG/M
3300009826|Ga0123355_11448210All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300010048|Ga0126373_10809847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae999Open in IMG/M
3300010048|Ga0126373_10905547All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300010048|Ga0126373_11424278All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300010048|Ga0126373_11797314All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300010159|Ga0099796_10562759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300010358|Ga0126370_11082509All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300010361|Ga0126378_11555189All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300010361|Ga0126378_12728852All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300010361|Ga0126378_13002598All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300010366|Ga0126379_10983414All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300010366|Ga0126379_11685859All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300010376|Ga0126381_102496155All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300010376|Ga0126381_105014828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300010379|Ga0136449_100148017All Organisms → cellular organisms → Bacteria4618Open in IMG/M
3300010398|Ga0126383_13641031All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300012205|Ga0137362_11316989All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012923|Ga0137359_10998073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum719Open in IMG/M
3300012924|Ga0137413_11352262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum574Open in IMG/M
3300012971|Ga0126369_12819045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300012971|Ga0126369_12930159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300012972|Ga0134077_10178506All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300013105|Ga0157369_11372071All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300013306|Ga0163162_12123959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300014158|Ga0181521_10410879All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300014160|Ga0181517_10622404All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300014169|Ga0181531_10835890All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300014200|Ga0181526_10526070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4748Open in IMG/M
3300014489|Ga0182018_10167235All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41248Open in IMG/M
3300014489|Ga0182018_10207852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1092Open in IMG/M
3300014489|Ga0182018_10224561All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300014495|Ga0182015_10013613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7090Open in IMG/M
3300014495|Ga0182015_10815981All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300014657|Ga0181522_10135613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1434Open in IMG/M
3300016270|Ga0182036_10148825All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300016270|Ga0182036_10647962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4851Open in IMG/M
3300016341|Ga0182035_11073184All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300016357|Ga0182032_10095589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans2083Open in IMG/M
3300016357|Ga0182032_11599854All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4567Open in IMG/M
3300016371|Ga0182034_10935236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. KBS0703747Open in IMG/M
3300016371|Ga0182034_11042307All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300016750|Ga0181505_11144261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2221Open in IMG/M
3300017822|Ga0187802_10283319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300017925|Ga0187856_1136200All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300017927|Ga0187824_10337255All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300017931|Ga0187877_1039160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2266Open in IMG/M
3300017937|Ga0187809_10389364All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4529Open in IMG/M
3300017940|Ga0187853_10188717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium970Open in IMG/M
3300017946|Ga0187879_10318458Not Available863Open in IMG/M
3300017946|Ga0187879_10498278All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300017948|Ga0187847_10037479All Organisms → cellular organisms → Bacteria2842Open in IMG/M
3300017959|Ga0187779_10785435All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300017970|Ga0187783_10027518All Organisms → cellular organisms → Bacteria4212Open in IMG/M
3300018006|Ga0187804_10449558All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300018018|Ga0187886_1388548All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300018030|Ga0187869_10107346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1406Open in IMG/M
3300018033|Ga0187867_10020751All Organisms → cellular organisms → Bacteria → Acidobacteria4235Open in IMG/M
3300018034|Ga0187863_10436810All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300018034|Ga0187863_10817137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300018038|Ga0187855_10281770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius973Open in IMG/M
3300018040|Ga0187862_10459751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4771Open in IMG/M
3300018042|Ga0187871_10116163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1532Open in IMG/M
3300018043|Ga0187887_10059279All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2339Open in IMG/M
3300018043|Ga0187887_10680101All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300018046|Ga0187851_10116897All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1642Open in IMG/M
3300018057|Ga0187858_10088726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2125Open in IMG/M
3300018057|Ga0187858_10646399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4634Open in IMG/M
3300018085|Ga0187772_10881145All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300018085|Ga0187772_11247033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300018086|Ga0187769_10104404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2039Open in IMG/M
3300018086|Ga0187769_11257700All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300018088|Ga0187771_10295531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1356Open in IMG/M
3300019361|Ga0173482_10623914All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300019879|Ga0193723_1119769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300021168|Ga0210406_10062154All Organisms → cellular organisms → Bacteria → Acidobacteria3236Open in IMG/M
3300021171|Ga0210405_10704896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4780Open in IMG/M
3300021181|Ga0210388_10060053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3184Open in IMG/M
3300021358|Ga0213873_10047135All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300021358|Ga0213873_10200396All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300021401|Ga0210393_10634049Not Available873Open in IMG/M
3300021401|Ga0210393_10875550All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300021401|Ga0210393_11430138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300021420|Ga0210394_11379595All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300021433|Ga0210391_10430721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1035Open in IMG/M
3300021479|Ga0210410_11081198All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300021560|Ga0126371_10197693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2104Open in IMG/M
3300021560|Ga0126371_10853294All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300021560|Ga0126371_11707508All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300021861|Ga0213853_10476610All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300025576|Ga0208820_1009141All Organisms → cellular organisms → Bacteria3630Open in IMG/M
3300025905|Ga0207685_10490998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei645Open in IMG/M
3300025906|Ga0207699_11335473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4531Open in IMG/M
3300025915|Ga0207693_10234673All Organisms → cellular organisms → Bacteria → Acidobacteria1440Open in IMG/M
3300025916|Ga0207663_10331421All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300025922|Ga0207646_10974493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300025941|Ga0207711_10428385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1231Open in IMG/M
3300026078|Ga0207702_10449274All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300026514|Ga0257168_1061514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum827Open in IMG/M
3300027432|Ga0209421_1058571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4772Open in IMG/M
3300027459|Ga0207505_114174All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300027604|Ga0208324_1100996Not Available806Open in IMG/M
3300027609|Ga0209221_1089979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4794Open in IMG/M
3300027635|Ga0209625_1109935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300027671|Ga0209588_1070074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum1133Open in IMG/M
3300027692|Ga0209530_1003155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5942Open in IMG/M
3300027765|Ga0209073_10423359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4550Open in IMG/M
3300027812|Ga0209656_10166657All Organisms → cellular organisms → Bacteria → Acidobacteria1091Open in IMG/M
3300027855|Ga0209693_10578894All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300027903|Ga0209488_10276661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum1256Open in IMG/M
3300027905|Ga0209415_10166283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2171Open in IMG/M
3300027908|Ga0209006_10036362All Organisms → cellular organisms → Bacteria → Acidobacteria4452Open in IMG/M
3300028017|Ga0265356_1035337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300028381|Ga0268264_10323746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1458Open in IMG/M
3300029817|Ga0247275_1045482All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300029883|Ga0311327_10524985All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300029999|Ga0311339_10850017All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300030007|Ga0311338_11164964All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300030057|Ga0302176_10371355All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300030503|Ga0311370_10177737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42896Open in IMG/M
3300030524|Ga0311357_11433698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4587Open in IMG/M
3300031057|Ga0170834_103344003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300031231|Ga0170824_117853373All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300031234|Ga0302325_10082583All Organisms → cellular organisms → Bacteria6131Open in IMG/M
3300031236|Ga0302324_100527793All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300031236|Ga0302324_101014145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41127Open in IMG/M
3300031247|Ga0265340_10242123Not Available805Open in IMG/M
3300031525|Ga0302326_10754296Not Available1411Open in IMG/M
3300031525|Ga0302326_12442878All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter658Open in IMG/M
3300031573|Ga0310915_10498104All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300031715|Ga0307476_11185740All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300031781|Ga0318547_10666997All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300031823|Ga0307478_11214331All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300031859|Ga0318527_10235872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans777Open in IMG/M
3300031890|Ga0306925_10316397All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300031890|Ga0306925_11364082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4701Open in IMG/M
3300031910|Ga0306923_10295251All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300031941|Ga0310912_11305813All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300031942|Ga0310916_10451361All Organisms → cellular organisms → Bacteria → Acidobacteria1095Open in IMG/M
3300031946|Ga0310910_10930046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4681Open in IMG/M
3300031962|Ga0307479_10311844All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300031962|Ga0307479_10385949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum1385Open in IMG/M
3300032001|Ga0306922_12245964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4525Open in IMG/M
3300032076|Ga0306924_12007800All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300032160|Ga0311301_10738514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1371Open in IMG/M
3300032261|Ga0306920_102943000All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300032261|Ga0306920_103461857All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300032805|Ga0335078_11257027All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300032805|Ga0335078_11843697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4655Open in IMG/M
3300032829|Ga0335070_10390942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1332Open in IMG/M
3300032892|Ga0335081_11684091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4692Open in IMG/M
3300032892|Ga0335081_12076574Not Available603Open in IMG/M
3300032895|Ga0335074_10344670All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300032954|Ga0335083_10672693All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300033290|Ga0318519_10349514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4874Open in IMG/M
3300033405|Ga0326727_10742225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300033755|Ga0371489_0363644All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.61%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.26%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.72%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.72%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.72%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.17%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.17%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.09%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.09%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.09%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.09%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.09%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.09%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.09%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.54%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.54%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.54%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.54%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.54%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.54%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001124Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3EnvironmentalOpen in IMG/M
3300001131Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1EnvironmentalOpen in IMG/M
3300001989Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005644Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027459Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12692J13336_100521223300001124Forest SoilMKTAIYGRVVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAILGG*
JGI12631J13338_103392113300001131Forest SoilWKLPMKTAIYGRVVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAILGG*
JGI24739J22299_1012096623300001989Corn RhizosphereMKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIG
JGIcombinedJ26739_10112698823300002245Forest SoilMKTALYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWSLPF
JGIcombinedJ26739_10178163613300002245Forest SoilMQTAFYGRIVFGASAVLFGVIALMWHDSDTWQNLQQIWRLPF
Ga0062384_10094417413300004082Bog Forest SoilLYENSVVRIIFGASAVLLGVLALMWYDSDTWQTLRQIWSLPFGTIIGG
Ga0062389_10130918823300004092Bog Forest SoilMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPF
Ga0066395_1008044213300004633Tropical Forest SoilMRTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAI
Ga0062388_10203428413300004635Bog Forest SoilLYENSVVRIIFGASAVLLGVLALMWYDSDTWQTLRQIWSLPF
Ga0062594_10031847523300005093SoilMKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMT
Ga0070708_10117349323300005445Corn, Switchgrass And Miscanthus RhizosphereMKAALYGRVVFGASAVLFGVIALMWHDADTWQNLQHIWSLPFG
Ga0070735_1045020013300005534Surface SoilVLLFLCMRTALYGRIVFGASAVLLGVIALMWYDADTWQTLRQIWSLP
Ga0070763_1001563763300005610SoilMKTALYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWSLP
Ga0070763_1092396213300005610SoilMKTALYGRIVFGASAVLFGVIALMWHDSDTWQSLTQIWSLPFGTIVGGCLM
Ga0075036_172079813300005644Permafrost SoilMKTGYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGG
Ga0066903_10360843713300005764Tropical Forest SoilMRTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAIIGACL
Ga0068860_10034419813300005843Switchgrass RhizosphereMKTALYGRIFFGASAVLFGVIALMWHDADIWQNLQHIWSLPFGT
Ga0070766_1131081013300005921SoilMKTALYGRIFFGASAVLFGVIAVMWHDADTWQNLQHIWSLP
Ga0070717_1181772923300006028Corn, Switchgrass And Miscanthus RhizosphereMKTAAYGRFVFGASAVLFGVIALTWHDPDTWQNLQHIW
Ga0070712_10184387423300006175Corn, Switchgrass And Miscanthus RhizosphereMKTALYGRIFFGASAVLFGFIALMWHDADTWQNLQHIWSLPFGTVIGGCLMIAQ
Ga0079222_1094312113300006755Agricultural SoilMIFGASAVLFGFIALMWHDADTWQTLRQIWSLPFGAIIGAC
Ga0079222_1154215323300006755Agricultural SoilMKAALYGRIVFGACAVLFGVIALMWHDSDTWQALRKIWSLPLAQPLAGVS*
Ga0066709_10078433923300009137Grasslands SoilMKTGLYARIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTVIGGCLMAA*
Ga0116128_102683713300009518PeatlandMKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTIIGGCLMTAQ
Ga0116117_110660823300009635PeatlandMKTELYGRIVFGASAVLLGVIALMWYDPDTWQTLRQIWSLPFG
Ga0116122_103848323300009639PeatlandMKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLRQ
Ga0116121_100493223300009644PeatlandMKTAIYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGV
Ga0105854_107047413300009660Permafrost SoilMKTEYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWS
Ga0123355_1144821023300009826Termite GutMKTRRYGRIVFGASAALFGGIALLWHDADTWQNLRQIWSFPFGIVI
Ga0126373_1080984723300010048Tropical Forest SoilMKTVQFGRIVFGASAVLFGVIALRWHDADTWQTLREIW
Ga0126373_1090554723300010048Tropical Forest SoilMKTALYGRIVFGASAVLFGVIALIWHDAETWQNLR
Ga0126373_1142427823300010048Tropical Forest SoilVNTAVYGRLVFGASAVLFGIIALLWHDSDTWQNLQQIWSLPFGTI
Ga0126373_1179731423300010048Tropical Forest SoilMKTVLYGRIVFGASAVLFGSVAPMWHDSHTWQTLRQIWSLPFGIIIGGCLTFRIQ*
Ga0099796_1056275913300010159Vadose Zone SoilMKTALYGRIVFGASAVLFGVITLLWHDADTWQNLLHIWSLPFGTI
Ga0126370_1108250913300010358Tropical Forest SoilVKKVLYGRFVFGASAVLFGVMALMWHDADTWQALQQIWSLPFG
Ga0126378_1155518933300010361Tropical Forest SoilVKAALYGRIVFVGPAVLFGIIALMWHDSDTWQNLQHIWSLPFGTIIG
Ga0126378_1272885213300010361Tropical Forest SoilMKTSFYGRVVFGASAVLFGVIALMWHDTETWQTLQHLWSLP
Ga0126378_1300259813300010361Tropical Forest SoilMKTALYGRIVFGASAVLFGVIALIWHDAETWQNLRHIWR
Ga0126379_1098341413300010366Tropical Forest SoilMKTALYERMAFGAAAVLFGVIALLWYDSATWQALRQIWSLP
Ga0126379_1168585923300010366Tropical Forest SoilMKTALYGRIVFGASAVLFGVIALIWHDAETWQNLRHIWRL
Ga0126381_10249615513300010376Tropical Forest SoilVQTALYGRLVFGASAVLFGVIALLWHDSDTWQTLQQIRSLPFGTVIGGCLMAAQ
Ga0126381_10501482823300010376Tropical Forest SoilMKTAFYGRMVFGAAAVLFGVIALMWHDADAWQNLQHIWSAPFGTI
Ga0136449_10014801763300010379Peatlands SoilMKTALYGRVVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTIIGACL
Ga0126383_1364103113300010398Tropical Forest SoilMKTALYGRIVFGASLFGVIALMWYDSDTWQTLRQIWRLPFGAIIGGCLM
Ga0137362_1131698913300012205Vadose Zone SoilMKTGLYARLVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPF
Ga0137359_1099807313300012923Vadose Zone SoilMKTALYGRIFFGASAVLFGVIALMWDDANTWQNLQHI
Ga0137413_1135226223300012924Vadose Zone SoilMKTALYGRIFFGASAVLFGVIALLWHDADTWQNLQHIW
Ga0126369_1281904523300012971Tropical Forest SoilMKTALYGRIVFGASAVLFGVIALIWHDAETWQNLRHIWRLPLG
Ga0126369_1293015913300012971Tropical Forest SoilMKTALYGRIVFGGSAVLFGVIALMWHDADTWQPCG
Ga0134077_1017850623300012972Grasslands SoilMKTALYGRIVFGASAVLFGAIALMWYDSDTWQTLRQIWTL
Ga0157369_1137207123300013105Corn RhizosphereMKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGC
Ga0163162_1212395913300013306Switchgrass RhizosphereMKTALYGRIFFGASAVLFGVIALMWHDADIWQNLQHIW
Ga0181521_1041087913300014158BogMRTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGAIIGGCLM
Ga0181517_1062240413300014160BogMKAASYGRIVFGASAVLFGVIALMWYDPDTWQTLHQIWSLPF
Ga0181531_1083589023300014169BogMKTASYGRIVLGASAVLSGVIALLWYDSDTWQTLR
Ga0181526_1052607013300014200BogMRTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPFGTIVGGC
Ga0182018_1016723523300014489PalsaMKTALYGRIVFGASAALSGVIALMWYDSDTWQTLRQLW
Ga0182018_1020785213300014489PalsaMKTALYGRIVFGGSAVLLGVIALMWYDSDTWQTLRQLWS
Ga0182018_1022456123300014489PalsaMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTI
Ga0182015_1001361393300014495PalsaMKTALYGRIVFGAAAVLFGVIALMWHDADTWQDLQHIW
Ga0182015_1081598113300014495PalsaMKTALYGRIVFGGSAVLFGVIALIWHDADTWQSLHRILRLPFG
Ga0181522_1013561313300014657BogMKTAIYGRMVFGASAVLFGFIALLWHDADTWQNLQHIWNLPFG
Ga0182036_1014882513300016270SoilMKTALYGRIVFGASAVLFGIIALMWYDPDTWQTLRHIWSLPFGTIIGGS
Ga0182036_1064796213300016270SoilVLLFPGKKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQI
Ga0182035_1107318413300016341SoilMKTALYGRILFGASAVLFGVIALMWHDPDTWQNLQQVWRLPFGALI
Ga0182032_1009558913300016357SoilMKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQ
Ga0182032_1159985413300016357SoilMKTALYGGIVFGASAVLFGVIPLMWYDSDTWQTLRQIW
Ga0182034_1093523613300016371SoilMKTALYGRIVFGASAVLFGVIALMWHDPDTWQNLQQIWRVPF
Ga0182034_1104230713300016371SoilMKTALYGRILFGASAVLFGVIALMWHDPDTWQNLRQVWRLPFGALIGGCLMTEVLQTEEE
Ga0181505_1114426123300016750PeatlandMKTALYGRIVFGAAAVLFSVIALMWHDADTWQNLQYIWSLPFGTIIG
Ga0187802_1028331913300017822Freshwater SedimentMKTALYGRVVFGAAAVLFAVIALMWHDADTLQNLQHIWSLP
Ga0187856_113620033300017925PeatlandMKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGT
Ga0187824_1033725523300017927Freshwater SedimentMRTTLLGCLVFAASTVLFGVIALMWHDADTWQTAFRILSLPFGTAIG
Ga0187877_103916013300017931PeatlandMKTAIYGRMVFGASAVLFGVIALLWHDADTWQNLQH
Ga0187809_1038936423300017937Freshwater SedimentMKTALFGRILFGASAVLLGVIALMWYDADTWQTLRQIWSLPFG
Ga0187853_1018871733300017940PeatlandMKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTIIG
Ga0187879_1031845823300017946PeatlandMKTALCGRIVFGASAVLFGVIALMWHDADTWQNLQHIWSLPFGTLIGGCLM
Ga0187879_1049827823300017946PeatlandMKAALYGRIVFGASAVLLGVVALMWYDSDTWQTLRQIWTLPFG
Ga0187847_1003747933300017948PeatlandMKTAIYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGVILGDCLMIAEIA
Ga0187779_1078543513300017959Tropical PeatlandMKTASYGRLVFGGSAMLSGVIALMWYDSDTWQTLRQIW
Ga0187783_1002751863300017970Tropical PeatlandMKTASYGRVVFGASAVLFGIIALMWHDADTWQSLQHLWSLPFGTIIG
Ga0187804_1044955813300018006Freshwater SedimentMKTASYGRILLGASAVLFGIIALMWHDSDTWQTLRQIWSLPFG
Ga0187886_138854813300018018PeatlandMKTALYGRIVFGASAVLFGVIALIWHDADTWQNLQHIWSLPLGVIIGG
Ga0187869_1010734623300018030PeatlandMKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLRQIWSLPFGTIIGGCL
Ga0187867_1002075113300018033PeatlandMKTAIYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGVILGDCLMIAEI
Ga0187863_1043681013300018034PeatlandMKTAFYGRIVFGASAVLFGAIALMWHDADTWQNLQHIWSLPLGVIIG
Ga0187863_1081713713300018034PeatlandMKTALYGRIVFGAAAVLFGVIALMWHDADTWQDLQHIWNLPFGAIIGGCLMTAQI
Ga0187855_1028177023300018038PeatlandMKTVIYGRIVFGAPAVLFGVIALLWHDADTWQNLQH
Ga0187862_1045975123300018040PeatlandMKTALYGRIVFGASAVLFGVIALMWYDSDTWQSLSQIWSL
Ga0187871_1011616333300018042PeatlandMKTALYGRIVFGASAVLCGVIALMWYDSDTWQTLRQIWSLPFGTI
Ga0187887_1005927913300018043PeatlandMKTAIYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGVILGDCL
Ga0187887_1068010113300018043PeatlandMKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFG
Ga0187851_1011689713300018046PeatlandMKTVSYGRIVFGASAAFFGVIAMMWHDTDTWQTLSQIWSLPLGAIL
Ga0187858_1008872613300018057PeatlandMKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLRQIWS
Ga0187858_1064639913300018057PeatlandMKSLYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWT
Ga0187772_1088114513300018085Tropical PeatlandMKTALYRRIVFGASAVLFGAIALMWHDADTWQTLREIWRLPFG
Ga0187772_1124703323300018085Tropical PeatlandMKRALYGRIVFGASAVLFGVIALMWHDPDTWQNLQ
Ga0187769_1010440413300018086Tropical PeatlandMKTALYGRIVFGASAVLFGVIALMWHDPDTLQNLQQIWHLPFGLIIGGCLMAV
Ga0187769_1125770023300018086Tropical PeatlandMKTAWFGRMVFGAAAVLFGVIALMWHDAETWQSVQHIWSLPF
Ga0187771_1029553143300018088Tropical PeatlandMKSAVYGRMVFGASAVLFGAIALMWHDSATWQTLQQIWSLPFGVLIGGCLMA
Ga0173482_1062391413300019361SoilMKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMTLKSRAGSHYSRPVPCA
Ga0193723_111976933300019879SoilMKAALYGRVVFGASAVLFGVIALMWHDADTWQNLQHIWSLPFGTV
Ga0210406_1006215453300021168SoilMKTTLHGRIVFGASAVLFGVIALMWHDSETWQTLRQIWSLPFGVI
Ga0210405_1070489623300021171SoilMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPF
Ga0210388_1006005333300021181SoilMKTAFYGRVVFGASAVLFGVIALMWHDADTWQRLQH
Ga0213873_1004713533300021358RhizosphereMTRALYGRIVFGASAVMFGVVGLMWRSSDMWQYLHPIPG
Ga0213873_1020039613300021358RhizosphereMKPAYYARILFGLSAVLFGVIALMWHDADTWQTLRRIWSVPFGTLI
Ga0210393_1063404913300021401SoilMKMYGRIVYGASAVLLGVIALMWYDSDTWQTLSQI
Ga0210393_1087555013300021401SoilMKTAFYGRVVFGASAVLFGVIALMWHDADTWQSLQHL
Ga0210393_1143013823300021401SoilMKTASYGRIVFGAAAVLFGVIALVWHDADTWQNLQHIWSLPFGTIIG
Ga0210394_1137959523300021420SoilMKTALSGRIVFGASAVLLGVIALLWYDSDTWQTLRQIWSLP
Ga0210391_1043072113300021433SoilMKTAFYGRVIFGASAVLFGVIALMWHDADTWQSLQHLWSLPF
Ga0210410_1108119823300021479SoilMKTALYGRVVFGASAVLFGGIALMWHDADTWQNLQHIWSLPFGTVIG
Ga0126371_1019769313300021560Tropical Forest SoilVKTALCGRIVFGASAVLFGVIALMWHDSDTWQNLKHIW
Ga0126371_1085329413300021560Tropical Forest SoilMKTALYGRIVFGASAVLFGVIALIWHDAETWQNLRHIWRLPLGTIIGGCLM
Ga0126371_1170750823300021560Tropical Forest SoilMKTAFYGRIVFGASAVLFGVIALIWHDAETWQNLRHIW
Ga0213853_1047661023300021861WatershedsMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMIVQ
Ga0208820_100914113300025576PeatlandMKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLRQIWSLPFGTIIGGCLMTAQI
Ga0207685_1049099823300025905Corn, Switchgrass And Miscanthus RhizosphereMNRALYGRVVFGASAVLFGVIALMWHDADTWQNLQHIWSLP
Ga0207699_1133547313300025906Corn, Switchgrass And Miscanthus RhizosphereMKTALYGRIVFGASAVLFGVIALMWHDPETWQTLR
Ga0207693_1023467333300025915Corn, Switchgrass And Miscanthus RhizosphereMKTALYGRIFFGASAVLFGFIALMWHDADTWQNLQHIWSLPFGTVIGGCLM
Ga0207663_1033142123300025916Corn, Switchgrass And Miscanthus RhizosphereMKTALYGRIFFGTSAVLFGVIALMWNDADTWQNLQHIWSLPFGTVIG
Ga0207646_1097449333300025922Corn, Switchgrass And Miscanthus RhizosphereMKTALYGRIVFGAAAVLFGVIALLWHDVDTWQNLQHIWSLPFGAIIGGC
Ga0207711_1042838513300025941Switchgrass RhizosphereMKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMTL
Ga0207702_1044927423300026078Corn RhizosphereMKTASYGRFVFGASAVLFGVIALTWHDPDTWQNLQHIWALPFGTVIGGC
Ga0257168_106151423300026514SoilMKTALYGRIFFGASAVLFGVIALMWHDANTWQNLQHIWSLPFG
Ga0209421_105857123300027432Forest SoilMKTALYGRIVFGASAVLFGVIALLWYDADTWQTLRQMWSLPFGTIIGG
Ga0207505_11417413300027459SoilMRTTLFGCLVFAASTVLFGVIALMWHDADTWQTPFRILSLPF
Ga0208324_110099623300027604Peatlands SoilMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLP
Ga0209221_108997913300027609Forest SoilMKTAIYGRVVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAILGG
Ga0209625_110993513300027635Forest SoilMKTALYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWSLPFG
Ga0209588_107007423300027671Vadose Zone SoilMKTALYGRIFFGASMVLFGVIALMWHDANTWQNLEHIWSLPFGTVIG
Ga0209530_100315513300027692Forest SoilWKLPMKTAIYGRVVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAILGG
Ga0209073_1042335923300027765Agricultural SoilMKAALYGRIVFGACAVLFGVIALMWHDSDTWQALRKIWSLPLAQPLAGVS
Ga0209656_1016665713300027812Bog Forest SoilMKTALYGRIVFGASAVLFGVIALMWCDSDTWQTLRQIWSLPFGTIIG
Ga0209693_1057889423300027855SoilMKTAWYGRRVFGASAVLFGIIALMWWDADTWQTLSQIW
Ga0209488_1027666113300027903Vadose Zone SoilMKTALYGRIFFGASAVLFGVIALMWDDANTWQTCNISGDCLL
Ga0209415_1016628313300027905Peatlands SoilMKTALYGRIVFGAAAVLFAVIALMWRDADTWQNLQH
Ga0209006_1003636213300027908Forest SoilVRGCYCFRMKPELCGRIVFGGSAVLFGVIALMWYDADTWQTLRQIWSVPFGTIIG
Ga0265356_103533713300028017RhizosphereMKTALYGRIVFGASAVLFGVIALMWHDSDTWQNLQQIWRLPFGTLIGGCLMAAL
Ga0268264_1032374613300028381Switchgrass RhizosphereMKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMTLKS
Ga0247275_104548213300029817SoilMKTALYGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWSLPFGTISGGCLM
Ga0311327_1052498513300029883BogMKAASYGRIVFGAAAVLFGVIALMWYDAATWQTLREIWNLPFGATIGGCLM
Ga0311339_1085001713300029999PalsaMRTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRRIWSLPFGTIVG
Ga0311338_1116496423300030007PalsaMKTALYGRIVFGGSAVLFGAIALMWHDADTWQSVHRILRLP
Ga0302176_1037135513300030057PalsaMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPFG
Ga0311370_1017773733300030503PalsaMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLP
Ga0311357_1143369823300030524PalsaMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPFGTIIGG
Ga0170834_10334400313300031057Forest SoilMKTALYGRIVIGASAVLFGVIALMWHDANTWQNLQHIWSLPFGT
Ga0170824_11785337313300031231Forest SoilMKTALYGRIVIGASAVLFGVIALMWHDSDTWQNLQQIWRL
Ga0302325_1008258313300031234PalsaMKTALYGRIVFGSSAVLFGVIALMWYDSDTWQTLRQIWSLPFGNIIGGCL
Ga0302324_10052779333300031236PalsaMKTALYGRIVFGSSAVLFGVIALMWYDSDTWQTLRQIWSLPFGNIIGG
Ga0302324_10101414513300031236PalsaMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFG
Ga0265340_1024212313300031247RhizosphereMKAALYGRIVFGASAVLFGVIALFWHDPDTWQSLVRIWRLPFGTVIGQCLMIVL
Ga0302326_1075429613300031525PalsaMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGC
Ga0302326_1244287813300031525PalsaVKPTALRVLLFSYMKTALYGRIVFGASAVLLGVIALMWYDSDTWQTLRQIWS
Ga0310915_1049810413300031573SoilMKGVQYGRLAFGIAAVLFGVIALMWHDADTWQALTKIWSLPSGTIIGECL
Ga0307476_1118574023300031715Hardwood Forest SoilMKTALYGRIVFGASAVLFGVIALMWHDSDTWQTLSQIWSMPFGIIV
Ga0318547_1066699713300031781SoilMKTATYGRILFGASAVLFGVIALMWHDADTWQSLI
Ga0307478_1121433123300031823Hardwood Forest SoilMKTPLCGRIVFGAAAALFGVIALMWHDADTWQNLQ
Ga0318527_1023587233300031859SoilMKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAVIGACLM
Ga0306925_1031639713300031890SoilMKTALYGRIVFGTSAVLVGVIALMWYDSDTWQTLRQIWSLPF
Ga0306925_1136408223300031890SoilMKTGLYERIVFGRPAVLFGVIALMWHDPETWQNVH
Ga0306923_1029525143300031910SoilMKTGLYERIVFGTPAVLFGVIALMWHDPETWQNVH
Ga0310912_1130581323300031941SoilMKTALYGRILFGASAVLFGVIALMWHDPDTWQNLQQVWRLPFGAL
Ga0310916_1045136123300031942SoilMKTALYGRIVFGASAVLFGVIALMWHDADTWQNLRQIWSLPSGIVI
Ga0310910_1093004623300031946SoilMRKAVYGRIVFGASAVLFGVIALMWHDPETWQNVH
Ga0307479_1031184443300031962Hardwood Forest SoilMKTALYGRIVFGASAVLFGMIALMWYDSDTWQTLRQIWS
Ga0307479_1038594933300031962Hardwood Forest SoilMKTALYGRIFFGASAVLFGVIALMWHDANTWQNLQHIWSLPFGTVIGGCLMIAQI
Ga0306922_1224596413300032001SoilMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWRLPFGITIGGCLMT
Ga0306924_1200780013300032076SoilMNTRLYGRIVFGASAVLFGVIALMWHDADTWQTLRQIWSWPFGAIIGACL
Ga0311301_1073851413300032160Peatlands SoilMKTALHGRIVFGAAAVLFGVIALMWHDADTWQNLQHIWS
Ga0306920_10294300013300032261SoilMKTALYGRILLGASAVLFGVIALMWHDPDTWQNLQQVWRLPFGALIGGCLMT
Ga0306920_10346185723300032261SoilMKTALYGRILFGASAVLFGVIALMWHDPDTWQNLQQVWRLPFGALIGGCLMT
Ga0335078_1125702723300032805SoilMKVPLCGRTVFGASAVLSGVIALMWHDSDTWQTLRQ
Ga0335078_1184369723300032805SoilMVDRGRYLFSMKTELYGRIVFGASAVLFGVIALMWYDSDTWQTLSQIWSLPFGAIIGG
Ga0335070_1039094213300032829SoilMGTAVYGRIVFGASAVLFGVIALLWHDADTWQELQHIWGLPFGIIVGESLM
Ga0335081_1168409123300032892SoilMETAWHGRLAFGASAVLFGSIALLWHDADTWQTLR
Ga0335081_1207657413300032892SoilMVFGASAVLFGVIALMWHDSDTWQSLRQIWSLPFGAIIGEVLMAAQI
Ga0335074_1034467043300032895SoilMKTAGRIVLGAAAVLFGIIALRWHDTDTWQNVHHV
Ga0335083_1067269313300032954SoilMKTAQYGRIVFGGSAVLFGVLALIWPDSDTWQTLRQL
Ga0318519_1034951413300033290SoilMKTGLYERIVLGTPAVLFGVIALMWHDPETWQNVH
Ga0326727_1074222523300033405Peat SoilMKTAIYGRIVFGASAVLFGVIALLWHDLDTWQNLQHIWKWPFGAILGG
Ga0371489_0363644_528_6743300033755Peat SoilMKTALWGRILFGGSAVLFGVIALMWHDADTVQNLLRIWMLPFGIVIGGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.