Basic Information | |
---|---|
Family ID | F030831 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 184 |
Average Sequence Length | 39 residues |
Representative Sequence | MYRRIDPLISASRGTLAGDLLWLGAIGFILAIITGMIG |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 184 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 65.75 % |
% of genes near scaffold ends (potentially truncated) | 29.35 % |
% of genes from short scaffolds (< 2000 bps) | 86.41 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (78.261 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.326 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.457 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.478 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 184 Family Scaffolds |
---|---|---|
PF00211 | Guanylate_cyc | 2.17 |
PF13767 | DUF4168 | 1.63 |
PF00903 | Glyoxalase | 1.09 |
PF02615 | Ldh_2 | 1.09 |
PF14559 | TPR_19 | 1.09 |
PF04828 | GFA | 1.09 |
PF03330 | DPBB_1 | 1.09 |
PF13340 | DUF4096 | 1.09 |
PF09334 | tRNA-synt_1g | 0.54 |
PF06627 | DUF1153 | 0.54 |
PF05598 | DUF772 | 0.54 |
PF07811 | TadE | 0.54 |
PF13586 | DDE_Tnp_1_2 | 0.54 |
PF01471 | PG_binding_1 | 0.54 |
PF00005 | ABC_tran | 0.54 |
PF01850 | PIN | 0.54 |
PF13391 | HNH_2 | 0.54 |
PF05221 | AdoHcyase | 0.54 |
PF13358 | DDE_3 | 0.54 |
PF00857 | Isochorismatase | 0.54 |
PF00924 | MS_channel | 0.54 |
COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
---|---|---|---|
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.17 |
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 1.09 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.09 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.54 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.54 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.54 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.54 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.54 |
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.54 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.54 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.54 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.54 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.54 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.54 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 78.26 % |
All Organisms | root | All Organisms | 21.74 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.09% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.09% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.54% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.54% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1052678803 | 3300000364 | Soil | AFIDQRPNMNRSIDPLFSAGRGTLVGDLLWLGAIGFITAIITGVIG* |
Ga0066388_1050331922 | 3300005332 | Tropical Forest Soil | MMTFIDQRPNMNRSIDPLFSTSRGTLVGDLLWLGAIGFIIAIITGMIG* |
Ga0066388_1057976021 | 3300005332 | Tropical Forest Soil | MFFKRIDPLISTNHALVGDLLWIGAIGFILAIIFGVIGASPPP* |
Ga0066388_1073628422 | 3300005332 | Tropical Forest Soil | MFFKRIDPLISATRALVGDLLWTGAIGFILAIIFGVIGASPPP* |
Ga0066697_105886982 | 3300005540 | Soil | MYRRIDPPISASRGTLAGDLLWLGTIGFILAIITGVIG* |
Ga0066701_109404101 | 3300005552 | Soil | TLTKRPIMYRRIDPPISASRGTLAGDLLWLGTVGFILAIITGVIG* |
Ga0066699_109301752 | 3300005561 | Soil | LTKRPIMYRRIDPPISASRGTLAGDLLWLGTIGFILAIITGVIG* |
Ga0070717_100552414 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MFSRIDPAIITSRGTLGGDLFWLATIAFIFAIITGIFR* |
Ga0070712_1003035131 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFSRIDPAIITSRGTLAGDLLWLATIAFVFAIITGMLG* |
Ga0066665_107720221 | 3300006796 | Soil | MYRRIDPPISASRGTLAGDLLWLGIIGFILAIITGVIG* |
Ga0066660_111664201 | 3300006800 | Soil | TLTKRPIMYRRIDPPISASRGTLAGDLLWLGTIGFILAIITGVIG* |
Ga0099795_103986991 | 3300007788 | Vadose Zone Soil | RQRPIIYRRIDPLISASRGTLAGDLLWLGAIGFILAIITGMIG* |
Ga0099829_102844272 | 3300009038 | Vadose Zone Soil | RRVDPLISASRGTLAGDLLWLGTIGFILAIITGMIG* |
Ga0099829_111162751 | 3300009038 | Vadose Zone Soil | MYRRVDPLISASRGTLAGDLLWLGTIGFILAIITGMIG* |
Ga0099828_116018152 | 3300009089 | Vadose Zone Soil | MYRRVDPLISASRGTLAGDLLWLGTIGFILAIITGLIG* |
Ga0066709_1006947211 | 3300009137 | Grasslands Soil | MYRRIDPPISASRGTLADDLLWLGTIGFILAIITGVIG* |
Ga0126380_105626332 | 3300010043 | Tropical Forest Soil | MFKRIDPLISATHALVGDLLWLGAIGFILAIIFGVIGASPVP* |
Ga0126384_101610902 | 3300010046 | Tropical Forest Soil | MYRRIDPLISASRGTLAGDLLWLGAIGFILAIITGMIG* |
Ga0126384_101943572 | 3300010046 | Tropical Forest Soil | MKRSIDPLFSASRGTLVGDLLWLGAIGFIIAIITGLIG* |
Ga0126373_111949641 | 3300010048 | Tropical Forest Soil | MYRRIDPLISASRGTLAGDLLWLGTIGFILAIITGMIG* |
Ga0126373_132733611 | 3300010048 | Tropical Forest Soil | MDKRIDPLISASRGTLAGDLLWLGAIVFILAIITGMIR* |
Ga0074044_100860643 | 3300010343 | Bog Forest Soil | MYRGIDPFLSASRGTLVGDLLWLGAIGFIIAIITGMIG* |
Ga0126370_109239421 | 3300010358 | Tropical Forest Soil | MNRSIDPLFSASRGTLVGDLLWLGAIGFIVAIITGVVG* |
Ga0126370_119798001 | 3300010358 | Tropical Forest Soil | KRIDPLISASRGTLTGDLLWLGAIVFILAIITGMIR* |
Ga0126376_119325501 | 3300010359 | Tropical Forest Soil | MAFIDQRPNMNRSIDPLFSASRGTLVGDLLWLGAIGFIIAIITGMIG* |
Ga0126372_125377032 | 3300010360 | Tropical Forest Soil | MNRSIDPLFSASRGTLVGDLLWLGAVGFIIAIITGAIG* |
Ga0126372_128727271 | 3300010360 | Tropical Forest Soil | MYRSIDPLLSASRGTLAGDLLWLGAIGFIIAIITGIIG* |
Ga0126378_103653681 | 3300010361 | Tropical Forest Soil | MRAYFDQRPIMYNGIDPLISASRGTLAGDLLGLAAIGFILAIITGMIG* |
Ga0126378_107153511 | 3300010361 | Tropical Forest Soil | MYRRIEPLISASRGTLAGDLLWLGAIGFIIAIITGMIG* |
Ga0126378_108623682 | 3300010361 | Tropical Forest Soil | MYNPIDPLISASRGTLAGDLLWLAAIGFILAIITGLIG* |
Ga0126378_108971591 | 3300010361 | Tropical Forest Soil | MYRSIGPLLSASRGTLAGDLLWLGAIGFIIAIITGIIG* |
Ga0126378_121984941 | 3300010361 | Tropical Forest Soil | MYRSIDPLLSASRGTLVGDLLWLGAVGFIIAIIAGMIG* |
Ga0126379_127216771 | 3300010366 | Tropical Forest Soil | IVNSWTPPSKRPKMYKGRIEPLFSASRGRLVGDLLWLGAIGFIIAIITGLIG* |
Ga0126381_1009660813 | 3300010376 | Tropical Forest Soil | MNRPIDALFSASRGTLVGDLLWLGAIGFILAIVTGVIG* |
Ga0126381_1012959071 | 3300010376 | Tropical Forest Soil | MHRSIDPLISASRGTLAGDLLWLGTIGFIVAIITGMIG* |
Ga0126381_1030609122 | 3300010376 | Tropical Forest Soil | MDGRIDPLISSGRRTFVGDLLWLGAIGFILAIITGMIG* |
Ga0126381_1032613471 | 3300010376 | Tropical Forest Soil | MYRRIHPLISANRGTLAGDLLWLGTIGFILAIITGMIG* |
Ga0126381_1039521401 | 3300010376 | Tropical Forest Soil | MFKGIDPLISATHALVGDLLWLGAIGFILAIIFGVIDASPVP* |
Ga0126383_105732253 | 3300010398 | Tropical Forest Soil | PIDPLISASRGTLAGDLLWLAAIGFILAIITGFIG* |
Ga0126383_112345202 | 3300010398 | Tropical Forest Soil | MFKKIDPLISATHALVGDLLWLGAIGFILAIIFGVIGASPVP* |
Ga0126383_114264032 | 3300010398 | Tropical Forest Soil | MYNGIDPLISASRGTLAGDLLGLAAIGFILAIITGMI |
Ga0137392_116278061 | 3300011269 | Vadose Zone Soil | MYRRIHPLISASRGTLAGDLLWLGTIGFILAIITGLIG* |
Ga0137364_114011591 | 3300012198 | Vadose Zone Soil | MYGRIDPPISASRGTLAGDLLWLGTIGFILAIITGVIG* |
Ga0137383_107902871 | 3300012199 | Vadose Zone Soil | MYRRIDPAISASRGTLAGDLLWLGTVGFILAIITGVIG* |
Ga0137383_111365941 | 3300012199 | Vadose Zone Soil | RIDPPISASRGTLAGDLLWLGTIGFILAIITGVIG* |
Ga0137362_101909892 | 3300012205 | Vadose Zone Soil | MYRRIAPPISASRGTLAGDLLWLGTVGFILAIITGVIG* |
Ga0137376_112841141 | 3300012208 | Vadose Zone Soil | MYRRIDPPISASRGTLAGDLLWLGTVGFILAIITGVIG* |
Ga0137377_111260822 | 3300012211 | Vadose Zone Soil | MYRRVDPLISASRGTLAGDLLWLGAIGFILAIITGLIG* |
Ga0137360_114115691 | 3300012361 | Vadose Zone Soil | REPIMFSRIDPAIITSRGTLAGDLFWLATIAFVFAIITGMLG* |
Ga0137390_110679171 | 3300012363 | Vadose Zone Soil | LTKKAIVYKRVDPLISASRGTLAGDLLWLGTIGFILAIITGG* |
Ga0137397_112304251 | 3300012685 | Vadose Zone Soil | MYRRIDPPISASRGTLAGDLLWLGAIGFILAIITGVIG* |
Ga0137395_105533062 | 3300012917 | Vadose Zone Soil | MYRRVDPLISASRGTLAGDLLWLGTIGFILAIITGG* |
Ga0137394_101175892 | 3300012922 | Vadose Zone Soil | MYRRVNPLISASRGTLASDLLWLGSIGFLLAIITGIIG* |
Ga0137359_104298544 | 3300012923 | Vadose Zone Soil | MYRRIDPPISASRGTLAGDLLWLGTVGFILAIITGMIG* |
Ga0137416_106907872 | 3300012927 | Vadose Zone Soil | MYRRIDPPISASRGTLAGDLLWLGTIGFILAIITGMIG* |
Ga0137404_105915851 | 3300012929 | Vadose Zone Soil | MYRRIDPPISPSRGTLAGDLLWLGTIGFILAIITGVIG* |
Ga0126369_112316462 | 3300012971 | Tropical Forest Soil | MYRSIDPLLSASRGTLVGDLLWLGAIGFIIAIIAGMIG* |
Ga0137403_108090541 | 3300015264 | Vadose Zone Soil | MYRRIDPPISPSRGTLAGDLLWLGTVGFILAIITGVIG* |
Ga0182036_105035932 | 3300016270 | Soil | MYRRTDPLISGSRGTLAGDLLWFGTIGFILAIITGVIS |
Ga0182033_101853591 | 3300016319 | Soil | MYRRTDPLISGSCGTLAGDLLWLGTIGFILAIVTGMIG |
Ga0182033_112553051 | 3300016319 | Soil | MHRSIDPILSASRGTLAGDLLWLGAIGFILAIITGMIG |
Ga0182033_114350961 | 3300016319 | Soil | IDQRPFMYRSIDPPLSASRGTLVGDLLWLGTVGFIIAIIAGMIG |
Ga0182035_120148402 | 3300016341 | Soil | MYGRTDSLISASRRTLAGDLLWLGTIGFILAIIMGMIG |
Ga0182032_103273561 | 3300016357 | Soil | MYRSIDLLLSACRGTLVGDLLWLGAVGFIIAIIAGMIG |
Ga0182034_100353935 | 3300016371 | Soil | MSTRIDPLISASRGTLAGDLLWLGTIGFILAIITGMIG |
Ga0182040_100180476 | 3300016387 | Soil | MDGRIDPLISSGRRTFVGDLLWLGAIGFILAIVTGMIG |
Ga0182040_100435634 | 3300016387 | Soil | MYRSIDPLLSACRGTLVGDLLWLGTVGFIIAIIAGMIG |
Ga0182040_101374742 | 3300016387 | Soil | MYRSIDPLLSSSRGTLVCDLLWLGAIGFIIAIITGLIG |
Ga0182037_105176402 | 3300016404 | Soil | MTERPIMFGRSDPLISASRVTLAGDLLWFGTISFILALVTGMVG |
Ga0066662_112953771 | 3300018468 | Grasslands Soil | PIMYRRIDPPISASRGTLAGDLLWLGTIGFILAIITGVIG |
Ga0210403_107798441 | 3300020580 | Soil | MYRSIDPLLSASRGTLAGDLLWLGAIGFIIAIITGIIG |
Ga0210399_105058212 | 3300020581 | Soil | MNRSIDPLFSAGRGTLVGDLLWLGAIGFIIAIITGIIG |
Ga0210399_114657661 | 3300020581 | Soil | IMFRRIDPLIFTSRGTLAGDLLWVGTISFILPIITGMIG |
Ga0210406_113832341 | 3300021168 | Soil | PIMHRSIDPLISASRGTLAGDLLWLGAIGFIIAIITGMIG |
Ga0210387_106988902 | 3300021405 | Soil | MHGSIDPLISASRGTLAGDLLWLGAIGFIIAIITGMIG |
Ga0126371_100185736 | 3300021560 | Tropical Forest Soil | MYNPIDPLISASRGTLAGDLLWLAAIGFILAIITGLIG |
Ga0126371_100749304 | 3300021560 | Tropical Forest Soil | MNRPIDALFSASRGTLVGDLLWLGAIGFILAIVTGVIG |
Ga0126371_112871591 | 3300021560 | Tropical Forest Soil | DQRPIMFFKRIDPLISATHALVGDLLWIGAIVFILAIIFGVIGASPFP |
Ga0126371_136691801 | 3300021560 | Tropical Forest Soil | MYKPIDALISAGRGTLVGDLLWLAAIGFAAIGFILAIYMG |
Ga0209248_100155453 | 3300027729 | Bog Forest Soil | MYRGIDPFLSASRGTLVGDLLWLGAIGFIIAIITGMIG |
Ga0209689_10723791 | 3300027748 | Soil | MYRRIDPPISASRGTLAGDLLWLGTIGFILAIITGVIG |
Ga0209701_104699731 | 3300027862 | Vadose Zone Soil | MYRRVDPLISASRGTLAGDLLWLGTIGFILAIITGMIG |
Ga0137415_100864475 | 3300028536 | Vadose Zone Soil | MYRRIDPPISASRGTLAGDLLWLGTIGFILAIITGIIG |
Ga0307482_10532763 | 3300030730 | Hardwood Forest Soil | MTKRPIMSRRIDPLSSASRGTLAGDLLWLGAIAFIVAIITGMIG |
Ga0307482_11932631 | 3300030730 | Hardwood Forest Soil | MTKRPIMFRRIDPLSSASHGTLAGDLLWLGAIGFILAIITGMIG |
Ga0170834_1052735242 | 3300031057 | Forest Soil | MNRRIDPLISASRGTLVGDLLWLGAIGFIIAIITGVVG |
Ga0170823_136703382 | 3300031128 | Forest Soil | LTKRPIVYRRIDPLISASRGTLAGDLLWLATIGFILAIITGMIG |
Ga0170824_1064024361 | 3300031231 | Forest Soil | LHLTKRPIMYRRVDPLISASRGTLAGDLLWLGAIGFIFAIITGMIG |
Ga0170820_117295752 | 3300031446 | Forest Soil | MNRSIDPLFSASRGTLVGDLLWLGAIGFIIAIITGVVG |
Ga0170820_160366141 | 3300031446 | Forest Soil | LTKRPIVYRSIDPLFSASRGTLVGDLLWLGAIGFIIAIITGVVG |
Ga0170820_176825591 | 3300031446 | Forest Soil | LTKRPIVYRRIDPLISASRGTLAGDLLWLGTIGFILAIITGMIG |
Ga0170819_125448572 | 3300031469 | Forest Soil | MAFIDQRPNMNRSIDPLFSASRGTLVGDLLWLGAIGFIVAIITGVVG |
Ga0170818_1056393781 | 3300031474 | Forest Soil | IMYRRIDPFISAGRGTLAGDLLWLGAIGFILAIITGMIG |
Ga0170818_1120237692 | 3300031474 | Forest Soil | MNRSIDPLFSASRGTLVGDLLWLGAIGFIIAIITGVIG |
Ga0318516_100084732 | 3300031543 | Soil | MYRSIDPFFSASRGTLAGDLLWLGAIGFIIAIITGMIG |
Ga0318516_100302642 | 3300031543 | Soil | MYRRIDPLISASRGTLAGDLLWLGTIGFILAVITGMIG |
Ga0318516_100606363 | 3300031543 | Soil | MYRSIDPLLSASRGTLVGDLLWLGAIGFIIAIITGLIG |
Ga0318516_100639783 | 3300031543 | Soil | MTERPIMFGRSDPLISASRVTLAGDLLWFGTISFILAIVTGMIG |
Ga0318516_102014622 | 3300031543 | Soil | MYRRIDPLFSASRGTLAGDLLWLGAIGFITAIITGMIG |
Ga0318516_103304111 | 3300031543 | Soil | MDGRIDPLISSGRRTFVGDLLWLGAIGFILAIITGMIG |
Ga0318516_105956302 | 3300031543 | Soil | MYRSIDPLLSACRGTLVGDLLWLGAVGFMIAIIAGMIG |
Ga0318534_100449411 | 3300031544 | Soil | MYRRIDPLISASRATLTGDLLWLGAIGFILAIITGMIG |
Ga0318541_101031621 | 3300031545 | Soil | MYKRIDPLFSASRGTLSGDLLWLGAIGFILAIITGMIG |
Ga0318541_104035642 | 3300031545 | Soil | MYRRTDPLISGSRGTRAGDLLWLGTIGFILAIVTGMIG |
Ga0318538_104346631 | 3300031546 | Soil | MYRRIDPLISASRGTLAGDLLWLGAIGFILTIITGMIG |
Ga0318538_107890282 | 3300031546 | Soil | MYRRSDPLISASRGTLTGDLLWLGTIGFILAIITGMIG |
Ga0318528_100117031 | 3300031561 | Soil | RPIMYRSIDPLLSASRGTLAGDLLWLGAIGFIIAIVTGVIA |
Ga0318528_101051003 | 3300031561 | Soil | MYRSIDPLLSASRGTLVGDLLWLGAVGFMIAIIAGMIG |
Ga0310915_100208033 | 3300031573 | Soil | MYRRIDPLISASRGTLAGDLLWLGTIGFILAIITGMIG |
Ga0310915_101125983 | 3300031573 | Soil | MYRRTDPLISASCRTLVGTLLWLGTIGFILAIITGMIS |
Ga0310915_108921101 | 3300031573 | Soil | MNQRPIMYRSIDPLLSASRGTLVGDLLWLGAIGFIIAIITGLIG |
Ga0307483_10348572 | 3300031590 | Hardwood Forest Soil | MYRRIDPLVSVSRGTLAGDLLWLGAIGFILEADRK |
Ga0318555_104655801 | 3300031640 | Soil | PIMYKRIDPLFSASRGTLSGDLLWLGAIGFILAIITGMIG |
Ga0318542_105726672 | 3300031668 | Soil | YRSIDPLLSASRGTLAGDLLWLGAIGFIIAIVTGVIA |
Ga0318561_100814754 | 3300031679 | Soil | MDGRIDPLISSGRRTFVGDLLWLGAIGFILAIITGMI |
Ga0318561_107690691 | 3300031679 | Soil | MYRRSDPLISASRGTLTGDLLWLGTIGFILAIITGM |
Ga0318574_102031812 | 3300031680 | Soil | IMYRRIDPLISASRGTLAGDLLWLGAIGFILAIITGMIG |
Ga0318572_100572035 | 3300031681 | Soil | MYRRIDPLISASRGTLAGDLLWLGAIGFILAIITGMIG |
Ga0318572_100982144 | 3300031681 | Soil | MYRSIDPFFSASRGTLAGDLLWLGAIGFIIAIVTGVIA |
Ga0310686_1086661464 | 3300031708 | Soil | MSRRIDPLSSASRGTLAGDLLWLGAIAFIVAIITGMIG |
Ga0306917_109492641 | 3300031719 | Soil | MYRRIDPLISASRGTLAGDLLWLGAIGFILAMITGMIG |
Ga0318500_101289622 | 3300031724 | Soil | MYRRIDPLISAGRGTLTGDLLWLGAIGFILAIITGMIG |
Ga0318501_101597851 | 3300031736 | Soil | MFGRSDPLISASRVTLAGDLLWLGTISFILAIVTGMI |
Ga0318501_105281711 | 3300031736 | Soil | MYRSIDPLLSASRGTLVGDLLWLGTVGFIIAIIAGMIG |
Ga0306918_106265483 | 3300031744 | Soil | MHRSIDPILSASRGTLVGDLLWLGTISFIIAIVTGLIG |
Ga0318494_103631221 | 3300031751 | Soil | TLTKRPIMYRRIDPLISASRGTLAGDLLWLGTIGFILAVITGMIG |
Ga0307477_107020881 | 3300031753 | Hardwood Forest Soil | MYRRIDPLVSVSRGTLAGDLLWLGAIGFILAIITGMIG |
Ga0307477_107692871 | 3300031753 | Hardwood Forest Soil | MHRSIDPLISASRGTLAGDLLWLGAIGFIIAIITGMIG |
Ga0307475_114567622 | 3300031754 | Hardwood Forest Soil | MYRRIDPLISASRGTLAGDVLWLGAIGFILAIITGMIG |
Ga0307475_115889411 | 3300031754 | Hardwood Forest Soil | MYGRIDPLISASRGTLAGDLFWLGAIGFILAIITGIIG |
Ga0318537_101639093 | 3300031763 | Soil | MYRRIDPLISASRGTLAGDLLWLGAIGFILAMITG |
Ga0318537_102758361 | 3300031763 | Soil | MYRRSDPLISASRGTLTGDLLWLGTIGFILAIITGMIS |
Ga0318554_105268711 | 3300031765 | Soil | YRSIDPLLSASRGTLVGDLLWLGAIGFIIAIITGLIG |
Ga0318509_101244283 | 3300031768 | Soil | IMFRRSDPLISASRVTLAGDLLWLGTISFILAIVTGMIG |
Ga0318526_102957981 | 3300031769 | Soil | RSDPLISASRVTLAGDLLWLGTISFILAIVTGMIG |
Ga0318546_111405491 | 3300031771 | Soil | NMNRSIDPLFSAGRGTLVGDLLWLGAIGFIIAIITGVIG |
Ga0318547_107940591 | 3300031781 | Soil | MYRRSDPLISASRGTLTGDLLWLGTIGFILAIITG |
Ga0318497_100643933 | 3300031805 | Soil | MTERPIMFGRSDPLISASRVTLAGDLLWFGTISFILAIVIGMIG |
Ga0307478_105811542 | 3300031823 | Hardwood Forest Soil | MTKRPIMFRSIDPLISASRGTLAGDLLWVGAIGFILAIITGMIG |
Ga0306919_103028502 | 3300031879 | Soil | MYRSIDPLLSASRGTLAGDLLWLGAIGFIIAIVTGVIA |
Ga0306919_111569641 | 3300031879 | Soil | RRTDPLISGSRGTLAGDLLWLGTIGFILAIVTGMIG |
Ga0306925_101269645 | 3300031890 | Soil | MYRSIDPLLSASRGTLVGDLLWLGAVGFIIAIIAGMIG |
Ga0306925_106635492 | 3300031890 | Soil | MNRSIDPFFSASRGTLVGDLLWLGAIGFVIAIVTGVIG |
Ga0306925_112418771 | 3300031890 | Soil | LTKRPIIYRRIDPLISASRGTLAGDLLWLGAIGFILAIITGMIG |
Ga0306925_115353901 | 3300031890 | Soil | MDGSIDPLISSGRRTFVGDLLWLGAIGFILAIITGMIG |
Ga0306925_116156971 | 3300031890 | Soil | MDGRIDPLISSGRRTFVGDLLWLGAIGFILAIVTG |
Ga0318520_107658261 | 3300031897 | Soil | MYRRIDPLISASRATLTGDLLWLGAIGFILAIITG |
Ga0306923_110405361 | 3300031910 | Soil | CTERSIMYRRIDPLISASRATLTGDLLWLGAIGFILAIITGMIG |
Ga0306921_104819163 | 3300031912 | Soil | MYRRTDPLISGSRGTLAGDLLWLGTIGFILAIVTGMIG |
Ga0306921_111939971 | 3300031912 | Soil | MNRSIDPLFSAGRGTLVGDLLWLGAIGFIIAIITGLIG |
Ga0310912_115281121 | 3300031941 | Soil | NRSIDPLFSTSRGTLVGDLLWLGAIGFIIAIITGLIG |
Ga0310916_105131791 | 3300031942 | Soil | RIDPLISASRGTLAGDLLWLGTIGFILAIITGMIG |
Ga0310916_116586281 | 3300031942 | Soil | MNRSIDPLFSAGRGTLVGDLLWLGAIGFIISIITGVIG |
Ga0310910_101182863 | 3300031946 | Soil | MYRSIDPLLSASRGTLVGDLLWFGAIGFIIAIITGLIG |
Ga0310910_110486481 | 3300031946 | Soil | MYRSIDPLLSASRGTLVGDLLWLGAVGFMIAIIAGMI |
Ga0310910_114100771 | 3300031946 | Soil | MYRSIDPPLSASRGTLVGDLLWLGTVGFIIAIIAGMIG |
Ga0310909_101223522 | 3300031947 | Soil | MSTRIDPVISASRGTLAGDLLWLGTIGFILAIITGMIG |
Ga0306926_105001652 | 3300031954 | Soil | MNRSIDPLFSASRGTLVGDLLWLGAIGFVIAIITGVIG |
Ga0306926_105688533 | 3300031954 | Soil | RRIDPLISASRGTLAGDLLWLGAIGFILAMITGMIG |
Ga0318530_101712172 | 3300031959 | Soil | KPIMYRSIDPLLSASRGTLVGDLLWLGAVGFMIAIIAGMIG |
Ga0307479_107984032 | 3300031962 | Hardwood Forest Soil | VRGGSLRSDPLISASRVTLAGDLLWLGTISFIVAIVTGMIG |
Ga0307479_121137882 | 3300031962 | Hardwood Forest Soil | MYGRIDPLISASRGALAGDLLWLGAIGFILAIITGMIG |
Ga0318531_105294071 | 3300031981 | Soil | MYRSIDPLLSASRGTLVGDLLWLGAVGFIIAIIAGMIGC |
Ga0306922_110350061 | 3300032001 | Soil | YIAKRPAMYGRTDPLISASRGTLAGDLLWFGTIGFILAIITGVIS |
Ga0310911_100189865 | 3300032035 | Soil | MYRRIDPLISASRGTLAGDLLWLGTIGFILAVITGMI |
Ga0310911_104097612 | 3300032035 | Soil | SIDPLLSACRGTLVGDLLWLGAVGFMIAIIAGMIG |
Ga0318559_104182561 | 3300032039 | Soil | YRSIDPFFSASRGTLAGDLLWLGAIGFIIAIITGMIG |
Ga0318556_101123703 | 3300032043 | Soil | RPTLAKRPIMDGRIDPLISSGRRTFVGDLLWLGAIGFILAIITGMIG |
Ga0318556_101322803 | 3300032043 | Soil | MYRRIDQLISASRGTLAGDLLWLGAIGFILTIITGMIG |
Ga0318556_107526721 | 3300032043 | Soil | MNQRPIMYRSIDPFFSASRGTLAGDLLWLGAIGFIIAIITGMI |
Ga0318506_102813252 | 3300032052 | Soil | TLTKRPIMDGRIDPLISSGRRTFVGDLLWLGAIGFILAIITGMIG |
Ga0318575_107237871 | 3300032055 | Soil | NMYRRTDPLISGSRGTLAGDLLWLGTIGFILAIVTGMIG |
Ga0318533_100256771 | 3300032059 | Soil | ADHVQKDHPLISASRGTLAGELLWYRTISFILAIVWGMIG |
Ga0318504_101418401 | 3300032063 | Soil | TCTERSIMYRRIDPLISASRATLTGDLLWLGAIGFILAIITGMIG |
Ga0318514_102806663 | 3300032066 | Soil | MYRRIDPLISASRGTLAGDLLWLGAIGFILAIITGMI |
Ga0306924_102952352 | 3300032076 | Soil | MNQRPIMYRSIDPLLSASRGTLVGDLLWLGAIGFIIAIITGMIG |
Ga0306924_112071341 | 3300032076 | Soil | MYGRTDPLISASRGTLAGDLLWFGTIGFILAIITGVIS |
Ga0318518_101190582 | 3300032090 | Soil | MYKRIDPLFSASRGTLAGDLLWLGAIGFILAIITGMIG |
Ga0307472_1009056462 | 3300032205 | Hardwood Forest Soil | MRPIVYRRIDPLISASRGTLAGDLLWLGTIGFILAIITGMIG |
Ga0306920_1011244983 | 3300032261 | Soil | MHRNIDPLISASRGTFAGDLLWLGAIGLIIVIITGMAG |
Ga0306920_1012425461 | 3300032261 | Soil | MNRSIDPLFSAGRGTLVGDLLWLGAIGFIIAIITGVIG |
Ga0306920_1029757481 | 3300032261 | Soil | MMTFIDQRPNMNRSIDPLFSTSRGTLVGDLLWLGAIGFIIAIITGMIG |
Ga0310914_114313321 | 3300033289 | Soil | MYRSIDPLLSASRGTLVGDLLWLGAVGFMIAIIAG |
Ga0310914_117301871 | 3300033289 | Soil | WWPAIDQKPIMYRSIDPLLSASRGTLVGDLLWLGAVGFMIAIIAGMIG |
⦗Top⦘ |