Metagenome Family F031004

Basic Information
Family ID	F031004
Family Type	Metagenome
Number of Sequences	183
Average Sequence Length	41 residues
Representative Sequence	MKRSGSGVHVFELAFEHTVDILNTDFRCADVLPFARTHT
Number of Associated Samples	15
Number of Associated Scaffolds	183

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	38.76 %
% of genes near scaffold ends (potentially truncated)	68.31 %
% of genes from short scaffolds (< 2000 bps)	78.69 %
Associated GOLD sequencing projects	9
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Most Common Taxonomy
Group	Unclassified (61.749 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (86.885 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 183 Family Scaffolds
PF01833	TIG	1.09
PF00930	DPPIV_N	1.09
PF14631	FancD2	0.55
PF02931	Neur_chan_LBD	0.55
PF00152	tRNA-synt_2	0.55
PF03764	EFG_IV	0.55
PF00135	COesterase	0.55
PF00271	Helicase_C	0.55
PF00078	RVT_1	0.55
PF00261	Tropomyosin	0.55
PF00320	GATA	0.55
PF11648	RIG-I_C-RD	0.55
PF00246	Peptidase_M14	0.55

COG ID	Name	Functional Category	% Frequency in 183 Family Scaffolds
COG0823	Periplasmic component TolB of the Tol biopolymer transport system	Intracellular trafficking, secretion, and vesicular transport [U]	1.09
COG1506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase	Amino acid transport and metabolism [E]	1.09
COG0017	Aspartyl/asparaginyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.55
COG0173	Aspartyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.55
COG0480	Translation elongation factor EF-G, a GTPase	Translation, ribosomal structure and biogenesis [J]	0.55
COG1190	Lysyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	0.55
COG1196	Chromosome segregation ATPase Smc	Cell cycle control, cell division, chromosome partitioning [D]	0.55
COG2269	Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)	Translation, ribosomal structure and biogenesis [J]	0.55
COG2272	Carboxylesterase type B	Lipid transport and metabolism [I]	0.55

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
All Organisms	root	All Organisms	38.25 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
cellular organisms	root	All Organisms → cellular organisms	37.16 %
Viruses	superkingdom	All Organisms → Viruses	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	37.16 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	36.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	31.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	31.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	31.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	30.60 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	1.09 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	28.42 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	2.19 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	1.09 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	28.42 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	2.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	28.42 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	2.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	28.42 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	28.42 %
Sedentaria	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	27.87 %
Scolecida	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.55 %
Crustacea	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	27.87 %
Capitellidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	0.55 %
Multicrustacea	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	27.87 %
Capitella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Malacostraca	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca	0.55 %
Cladistia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Polypteriformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes	0.55 %
Eumalacostraca	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Eucarida	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida	0.55 %
Polypteridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Decapoda	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda	0.55 %
Polypterus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Brachyura	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura	0.55 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Eubrachyura	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura	0.55 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Heterotremata	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata	0.55 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Majoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Majoidea	0.55 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Majidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Majoidea → Majidae	0.55 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Chionoecetes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Majoidea → Majidae → Chionoecetes	0.55 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.75 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	27.87 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.09 %
Chionoecetes opilio	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Majoidea → Majidae → Chionoecetes → Chionoecetes opilio	0.55 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.55 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004626\|Ga0066188_1002604	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	3037	Open in IMG/M
3300004626\|Ga0066188_1092271	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1057	Open in IMG/M
3300004626\|Ga0066188_1110071	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	975	Open in IMG/M
3300004626\|Ga0066188_1126317	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	913	Open in IMG/M
3300004626\|Ga0066188_1150033	Not Available	837	Open in IMG/M
3300004626\|Ga0066188_1156325	Not Available	818	Open in IMG/M
3300004626\|Ga0066188_1159442	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	809	Open in IMG/M
3300004626\|Ga0066188_1183033	Not Available	748	Open in IMG/M
3300004626\|Ga0066188_1200873	Not Available	707	Open in IMG/M
3300004626\|Ga0066188_1211961	Not Available	685	Open in IMG/M
3300004626\|Ga0066188_1218726	Not Available	671	Open in IMG/M
3300004626\|Ga0066188_1266449	Not Available	588	Open in IMG/M
3300004626\|Ga0066188_1318232	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	516	Open in IMG/M
3300005648\|Ga0056131_1021110	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	3462	Open in IMG/M
3300005648\|Ga0056131_1056424	Not Available	2202	Open in IMG/M
3300005648\|Ga0056131_1103590	Not Available	1518	Open in IMG/M
3300005648\|Ga0056131_1137567	Not Available	1233	Open in IMG/M
3300005648\|Ga0056131_1155164	Not Available	1117	Open in IMG/M
3300005871\|Ga0056124_1110948	Not Available	1348	Open in IMG/M
3300005871\|Ga0056124_1123525	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1236	Open in IMG/M
3300005871\|Ga0056124_1203271	Not Available	766	Open in IMG/M
3300005871\|Ga0056124_1222546	Not Available	692	Open in IMG/M
3300005871\|Ga0056124_1243688	Not Available	622	Open in IMG/M
3300005871\|Ga0056124_1290388	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	501	Open in IMG/M
3300005968\|Ga0056130_1019560	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2819	Open in IMG/M
3300005968\|Ga0056130_1026503	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2542	Open in IMG/M
3300005968\|Ga0056130_1049220	Not Available	1984	Open in IMG/M
3300005968\|Ga0056130_1059200	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1825	Open in IMG/M
3300005968\|Ga0056130_1059430	Not Available	1822	Open in IMG/M
3300005968\|Ga0056130_1086587	Not Available	1506	Open in IMG/M
3300005968\|Ga0056130_1124159	Not Available	1215	Open in IMG/M
3300005968\|Ga0056130_1134717	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1151	Open in IMG/M
3300005968\|Ga0056130_1137492	Not Available	1136	Open in IMG/M
3300005968\|Ga0056130_1147089	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1084	Open in IMG/M
3300005968\|Ga0056130_1163848	Not Available	1002	Open in IMG/M
3300005968\|Ga0056130_1176279	Not Available	946	Open in IMG/M
3300005968\|Ga0056130_1188372	Not Available	897	Open in IMG/M
3300005968\|Ga0056130_1210437	Not Available	817	Open in IMG/M
3300005968\|Ga0056130_1215148	Not Available	801	Open in IMG/M
3300005968\|Ga0056130_1245643	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	709	Open in IMG/M
3300005968\|Ga0056130_1251502	Not Available	694	Open in IMG/M
3300005968\|Ga0056130_1252696	Not Available	690	Open in IMG/M
3300005968\|Ga0056130_1264657	Not Available	659	Open in IMG/M
3300005968\|Ga0056130_1282730	Not Available	616	Open in IMG/M
3300005968\|Ga0056130_1317199	Not Available	546	Open in IMG/M
3300005968\|Ga0056130_1339544	Not Available	506	Open in IMG/M
3300005968\|Ga0056130_1340619	Not Available	505	Open in IMG/M
3300005978\|Ga0056129_1007271	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5322	Open in IMG/M
3300005978\|Ga0056129_1010585	Not Available	4735	Open in IMG/M
3300005978\|Ga0056129_1048914	Not Available	2543	Open in IMG/M
3300005978\|Ga0056129_1057384	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2339	Open in IMG/M
3300005978\|Ga0056129_1115190	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1490	Open in IMG/M
3300005978\|Ga0056129_1140307	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1269	Open in IMG/M
3300005978\|Ga0056129_1156414	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1155	Open in IMG/M
3300005978\|Ga0056129_1166821	All Organisms → Viruses → Predicted Viral	1088	Open in IMG/M
3300005978\|Ga0056129_1185885	Not Available	977	Open in IMG/M
3300005978\|Ga0056129_1192614	Not Available	943	Open in IMG/M
3300005978\|Ga0056129_1236360	All Organisms → cellular organisms → Eukaryota	753	Open in IMG/M
3300005978\|Ga0056129_1253769	Not Available	692	Open in IMG/M
3300005978\|Ga0056129_1261486	Not Available	668	Open in IMG/M
3300005978\|Ga0056129_1266802	Not Available	651	Open in IMG/M
3300005978\|Ga0056129_1270881	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	639	Open in IMG/M
3300005978\|Ga0056129_1285541	Not Available	599	Open in IMG/M
3300005978\|Ga0056129_1290078	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	587	Open in IMG/M
3300005979\|Ga0056132_1058932	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2125	Open in IMG/M
3300005979\|Ga0056132_1072627	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1884	Open in IMG/M
3300005979\|Ga0056132_1085492	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1704	Open in IMG/M
3300005979\|Ga0056132_1112423	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1414	Open in IMG/M
3300005979\|Ga0056132_1173271	Not Available	1005	Open in IMG/M
3300005979\|Ga0056132_1185719	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	944	Open in IMG/M
3300005979\|Ga0056132_1252228	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	701	Open in IMG/M
3300005979\|Ga0056132_1344529	Not Available	509	Open in IMG/M
3300005984\|Ga0056126_10009043	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	3562	Open in IMG/M
3300005984\|Ga0056126_10015210	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	3025	Open in IMG/M
3300005984\|Ga0056126_10132194	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1206	Open in IMG/M
3300005984\|Ga0056126_10133160	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1201	Open in IMG/M
3300005984\|Ga0056126_10144653	Not Available	1144	Open in IMG/M
3300005984\|Ga0056126_10160401	Not Available	1074	Open in IMG/M
3300005984\|Ga0056126_10178319	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1004	Open in IMG/M
3300005984\|Ga0056126_10204260	Not Available	918	Open in IMG/M
3300005984\|Ga0056126_10206835	Not Available	910	Open in IMG/M
3300005984\|Ga0056126_10209696	Not Available	902	Open in IMG/M
3300005984\|Ga0056126_10238866	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	823	Open in IMG/M
3300005984\|Ga0056126_10247481	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	802	Open in IMG/M
3300005984\|Ga0056126_10279023	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Majoidea → Majidae → Chionoecetes → Chionoecetes opilio	732	Open in IMG/M
3300005984\|Ga0056126_10282493	Not Available	725	Open in IMG/M
3300005984\|Ga0056126_10319473	Not Available	658	Open in IMG/M
3300005984\|Ga0056126_10323691	Not Available	651	Open in IMG/M
3300005984\|Ga0056126_10342815	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	621	Open in IMG/M
3300005984\|Ga0056126_10386578	Not Available	562	Open in IMG/M
3300005984\|Ga0056126_10391756	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	556	Open in IMG/M
3300005984\|Ga0056126_10432557	Not Available	511	Open in IMG/M
3300006000\|Ga0056123_1239301	Not Available	753	Open in IMG/M
3300006000\|Ga0056123_1252961	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	722	Open in IMG/M
3300006000\|Ga0056123_1377534	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	520	Open in IMG/M
3300006912\|Ga0056114_1015566	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5322	Open in IMG/M
3300006912\|Ga0056114_1017032	Not Available	5139	Open in IMG/M
3300006912\|Ga0056114_1020819	Not Available	4721	Open in IMG/M
3300006912\|Ga0056114_1021629	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	4644	Open in IMG/M
3300006912\|Ga0056114_1024868	Not Available	4361	Open in IMG/M
3300006912\|Ga0056114_1031978	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3857	Open in IMG/M
3300006912\|Ga0056114_1032171	Not Available	3845	Open in IMG/M
3300006912\|Ga0056114_1032750	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	3812	Open in IMG/M
3300006912\|Ga0056114_1034565	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	3708	Open in IMG/M
3300006912\|Ga0056114_1036126	Not Available	3620	Open in IMG/M
3300006912\|Ga0056114_1039971	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3425	Open in IMG/M
3300006912\|Ga0056114_1052287	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	2929	Open in IMG/M
3300006912\|Ga0056114_1059553	Not Available	2688	Open in IMG/M
3300006912\|Ga0056114_1069817	Not Available	2407	Open in IMG/M
3300006912\|Ga0056114_1074741	Not Available	2290	Open in IMG/M
3300006912\|Ga0056114_1076390	Not Available	2253	Open in IMG/M
3300006912\|Ga0056114_1088238	Not Available	2008	Open in IMG/M
3300006912\|Ga0056114_1124483	Not Available	1460	Open in IMG/M
3300006912\|Ga0056114_1144339	Not Available	1244	Open in IMG/M
3300006912\|Ga0056114_1156011	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1136	Open in IMG/M
3300006912\|Ga0056114_1158084	Not Available	1118	Open in IMG/M
3300006912\|Ga0056114_1188292	Not Available	898	Open in IMG/M
3300006912\|Ga0056114_1198789	Not Available	835	Open in IMG/M
3300006912\|Ga0056114_1211985	Not Available	766	Open in IMG/M
3300006912\|Ga0056114_1234737	Not Available	666	Open in IMG/M
3300006912\|Ga0056114_1263391	Not Available	571	Open in IMG/M
3300006912\|Ga0056114_1271109	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	551	Open in IMG/M
3300006912\|Ga0056114_1280777	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	528	Open in IMG/M
3300006912\|Ga0056114_1290127	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	507	Open in IMG/M
3300027289\|Ga0209787_1022225	Not Available	2248	Open in IMG/M
3300027289\|Ga0209787_1027605	Not Available	2086	Open in IMG/M
3300027289\|Ga0209787_1031362	Not Available	1993	Open in IMG/M
3300027289\|Ga0209787_1087200	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1266	Open in IMG/M
3300027289\|Ga0209787_1092496	Not Available	1226	Open in IMG/M
3300027289\|Ga0209787_1100414	Not Available	1171	Open in IMG/M
3300027289\|Ga0209787_1104525	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1144	Open in IMG/M
3300027289\|Ga0209787_1117139	Not Available	1070	Open in IMG/M
3300027289\|Ga0209787_1118906	Not Available	1060	Open in IMG/M
3300027289\|Ga0209787_1156045	Not Available	887	Open in IMG/M
3300027289\|Ga0209787_1166728	Not Available	845	Open in IMG/M
3300027289\|Ga0209787_1190498	Not Available	756	Open in IMG/M
3300027289\|Ga0209787_1212795	Not Available	684	Open in IMG/M
3300027338\|Ga0209052_1118560	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1220	Open in IMG/M
3300027338\|Ga0209052_1167121	Not Available	887	Open in IMG/M
3300027338\|Ga0209052_1174919	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	844	Open in IMG/M
3300027338\|Ga0209052_1198285	Not Available	728	Open in IMG/M
3300027338\|Ga0209052_1223889	Not Available	624	Open in IMG/M
3300027392\|Ga0209680_1093486	Not Available	1631	Open in IMG/M
3300027392\|Ga0209680_1096739	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1590	Open in IMG/M
3300027392\|Ga0209680_1108696	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1456	Open in IMG/M
3300027392\|Ga0209680_1110150	Not Available	1441	Open in IMG/M
3300027392\|Ga0209680_1125113	Not Available	1301	Open in IMG/M
3300027392\|Ga0209680_1131063	Not Available	1253	Open in IMG/M
3300027392\|Ga0209680_1135390	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1217	Open in IMG/M
3300027392\|Ga0209680_1135847	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1213	Open in IMG/M
3300027392\|Ga0209680_1141245	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1173	Open in IMG/M
3300027392\|Ga0209680_1143318	All Organisms → cellular organisms → Eukaryota	1156	Open in IMG/M
3300027392\|Ga0209680_1149099	Not Available	1115	Open in IMG/M
3300027392\|Ga0209680_1198063	Not Available	831	Open in IMG/M
3300027392\|Ga0209680_1201221	Not Available	814	Open in IMG/M
3300027392\|Ga0209680_1213059	Not Available	756	Open in IMG/M
3300027392\|Ga0209680_1254964	Not Available	586	Open in IMG/M
3300027392\|Ga0209680_1258746	Not Available	573	Open in IMG/M
3300027495\|Ga0209788_1120037	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1293	Open in IMG/M
3300027495\|Ga0209788_1151004	Not Available	1080	Open in IMG/M
3300027495\|Ga0209788_1220770	Not Available	753	Open in IMG/M
3300027495\|Ga0209788_1259588	Not Available	626	Open in IMG/M
3300027520\|Ga0209681_1032030	Not Available	2732	Open in IMG/M
3300027520\|Ga0209681_1070274	Not Available	1826	Open in IMG/M
3300027520\|Ga0209681_1113477	Not Available	1331	Open in IMG/M
3300027520\|Ga0209681_1172138	Not Available	944	Open in IMG/M
3300027520\|Ga0209681_1173545	Not Available	937	Open in IMG/M
3300027549\|Ga0209458_1007973	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	3461	Open in IMG/M
3300027549\|Ga0209458_1014683	Not Available	2841	Open in IMG/M
3300027549\|Ga0209458_1088923	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1344	Open in IMG/M
3300027549\|Ga0209458_1110133	Not Available	1192	Open in IMG/M
3300027549\|Ga0209458_1112797	Not Available	1176	Open in IMG/M
3300027549\|Ga0209458_1120685	All Organisms → Viruses → Predicted Viral	1130	Open in IMG/M
3300027549\|Ga0209458_1139095	Not Available	1036	Open in IMG/M
3300027549\|Ga0209458_1157576	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	956	Open in IMG/M
3300027549\|Ga0209458_1176730	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	884	Open in IMG/M
3300027549\|Ga0209458_1233033	Not Available	712	Open in IMG/M
3300027549\|Ga0209458_1324617	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	524	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Habitat	Taxonomy	Distribution
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	86.89%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	13.11%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0066188_10026042	3300004626	Marine Gutless Worms Symbiont	MKRSSSGVHVFELTFDFEHTVDILNTDFRCAEVLPFARTHT*
Ga0066188_10922712	3300004626	Marine Gutless Worms Symbiont	MKLSGSGVPVFELAFDFEHTVDILNTDFRRAEVLPFARTHT*
Ga0066188_11100711	3300004626	Marine Gutless Worms Symbiont	TRWSSMKRSGSGVHVFKLAFEHTVDILNTDFRCAGVLQFALTHT*
Ga0066188_11263171	3300004626	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFEHTVDILNTEFRGAGVLPFAQTDT*
Ga0066188_11500331	3300004626	Marine Gutless Worms Symbiont	KRSGSGVHVFELAFDFEHTVDILNTDFRCADVLPFARMHT*
Ga0066188_11563252	3300004626	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFDFEHTVDILNTDFRCAEVLPFARMHT*
Ga0066188_11594421	3300004626	Marine Gutless Worms Symbiont	MKQSGSGVHVFQLAFEHMVDISNADFRCADVLPFARMHT*
Ga0066188_11830331	3300004626	Marine Gutless Worms Symbiont	MKQSDSGVHVFELAFEHKVDILNTDFRCADVLPFARTHN*
Ga0066188_12008731	3300004626	Marine Gutless Worms Symbiont	MKRSASGLYILDLAFNFEHTVEILNTDFRCADVLPFARMHT*
Ga0066188_12119611	3300004626	Marine Gutless Worms Symbiont	SSIKRSGSGVHVFELAFDFEHTVDILNADFRCAEVLPFARMQT*
Ga0066188_12187261	3300004626	Marine Gutless Worms Symbiont	RSGSGVHVFELAFDFEHTVDILNTDFRSADVLPFARTHT*
Ga0066188_12664491	3300004626	Marine Gutless Worms Symbiont	KRSGSGVHVLELAFDFEHTVDILNTDFRCADVLPFAQTHT*
Ga0066188_13182321	3300004626	Marine Gutless Worms Symbiont	MKRSGNGVHVFELAFEHMVDFLNTDFRCAEVLPFARMLT*
Ga0056131_10211101	3300005648	Marine Gutless Worms Symbiont	MKRSGNGDHVFELAFEHTVDILNTDFRCADVLPFARTHA
Ga0056131_10564247	3300005648	Marine Gutless Worms Symbiont	SMKRSVSGDHVFELAFEHTVDILNTDFRCADVLPLARTHT*
Ga0056131_11035901	3300005648	Marine Gutless Worms Symbiont	GSGDHVFELAFEHTVDILNTDFRCVDVLPFARTHN*
Ga0056131_11375671	3300005648	Marine Gutless Worms Symbiont	GNGDHVFELAFEHTVDILNTDFRCADVLPFARTHA*
Ga0056131_11551642	3300005648	Marine Gutless Worms Symbiont	SGNGDHVFELAFEHTVDILNTDFRCADVLPFARTHA*
Ga0056124_11109482	3300005871	Marine Gutless Worms Symbiont	WSSMKRSGSGVHVFELAFEHMVDILNTDFRSADVLPFAWMHT*
Ga0056124_11235252	3300005871	Marine Gutless Worms Symbiont	MKQSGSGVHVFELAFEHMVDILNTDFRSADVLPVAWTHT*
Ga0056124_12032712	3300005871	Marine Gutless Worms Symbiont	RSGSGVHVFELAFEHMVDILNTDFRSADVLPFAWTHT*
Ga0056124_12225461	3300005871	Marine Gutless Worms Symbiont	WSSMKRSGSGVHVFELAFEHMVDILNTDFRSADVLPFAWTHT*
Ga0056124_12436882	3300005871	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFEHMVDILNTDFRSADVLPFAWTHTYVGVEFR*
Ga0056124_12903881	3300005871	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFEHMVGILNTDFRSADVLPFAWTHT*
Ga0056130_10143588	3300005968	Marine Gutless Worms Symbiont	SGSGVHVLELAFDFMHTVDILNTDFRCAEVLPFAWMHT*
Ga0056130_10195605	3300005968	Marine Gutless Worms Symbiont	MKRSGSGIHVFELVFDFEHTVDILNTDFRCADVLPFARTHT*
Ga0056130_10265034	3300005968	Marine Gutless Worms Symbiont	MKRSGSGVHVLELAFDFVHTVDILNTDFRCAEVLPFARTHT
Ga0056130_10492202	3300005968	Marine Gutless Worms Symbiont	RPGSGVHVFELAFDFEHTVDILNTTDADVLPFARTQT*
Ga0056130_10592002	3300005968	Marine Gutless Worms Symbiont	MKQSGSGVHIFELALDFEHTVDILFNTDFRCADILPFAQTHT*
Ga0056130_10594302	3300005968	Marine Gutless Worms Symbiont	MKRSGSAVYVFELAFDFEHTVDILNTDFRCAEVLPFARTHT*
Ga0056130_10865875	3300005968	Marine Gutless Worms Symbiont	TRWSSIKWSGSGVHVLELAFDFEHTVDILNTDFICAEVLPFARTHT*
Ga0056130_11241594	3300005968	Marine Gutless Worms Symbiont	SGSGVHVLELAFDFVHTVDILNTDFRCAEVLPFARTHT*
Ga0056130_11347171	3300005968	Marine Gutless Worms Symbiont	MKWSGNGVHVFELAFDFEHTVDIFNTDFSSVDVLPFARTHT*
Ga0056130_11374921	3300005968	Marine Gutless Worms Symbiont	RWSSMKRSGSGVHVFELAFDFEHTVDILNSDFRCAEVLAFARTHT*
Ga0056130_11470891	3300005968	Marine Gutless Worms Symbiont	LIKRPGSGVHVLELAFDFVHTVDILNTDFRCAEVLPF
Ga0056130_11638483	3300005968	Marine Gutless Worms Symbiont	SIKRSGSGIHVFELAFDFEHTVDILNTDFMCAEVLPFAQTHT*
Ga0056130_11762792	3300005968	Marine Gutless Worms Symbiont	WSSIKRSGSGVHVLELAFDFMHTVDILNTDFRCAEVLPFARTHT*
Ga0056130_11883721	3300005968	Marine Gutless Worms Symbiont	SGVHVFELAFEHMVDILNTDFMCAGVLPFARTHT*
Ga0056130_12104371	3300005968	Marine Gutless Worms Symbiont	SGSGVHVFELAFDFVHTVDILNTDFRCAEVLPFARTHT*
Ga0056130_12151482	3300005968	Marine Gutless Worms Symbiont	MKQSGSGVHVIELTFDFEHTMDILNTYFRCADDLPFARTHT*
Ga0056130_12456431	3300005968	Marine Gutless Worms Symbiont	TRWSSMKRSGSGVHVFELAFEHTVDILNTDSRCAEVLPFARTHT*
Ga0056130_12515021	3300005968	Marine Gutless Worms Symbiont	RSGSGVHVLELELAFDFVHTVDILNTDFRCADVLPFARTHT*
Ga0056130_12526961	3300005968	Marine Gutless Worms Symbiont	SGSGVHVFELALDFEHTVDILNTDFRSAKVLPFARTHT*
Ga0056130_12646572	3300005968	Marine Gutless Worms Symbiont	RSGSGVHVLELAFDFEHTVDILNTDFRCAEVLPFERTHT*
Ga0056130_12827303	3300005968	Marine Gutless Worms Symbiont	GSGVHVFELAFDFEHTVDILNTDFKYAEVLPFARTHT*
Ga0056130_13171992	3300005968	Marine Gutless Worms Symbiont	ESGNISTRWSSMKQSDSGVHVFELAFEHKVDILNTDFRCADVLPFARTHN*
Ga0056130_13395441	3300005968	Marine Gutless Worms Symbiont	GVHVLELAFDFEHTVDILNTDFRCAEVLPFARTNT*
Ga0056130_13406191	3300005968	Marine Gutless Worms Symbiont	LIKWSGSGVHVLELAFDSVHTVDILNTDFRCAEVLPFA
Ga0056129_10072711	3300005978	Marine Gutless Worms Symbiont	KWSGSGVHVLELAFDFEHTVDILNTDFRCAEVLPFERTHT*
Ga0056129_10105857	3300005978	Marine Gutless Worms Symbiont	GVHVLELAFDFVHTVDILNTDFRCAEVLPFARTDT*
Ga0056129_10489143	3300005978	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFDFEHTVDILNTDFRCADVLPFARTQT*
Ga0056129_10573843	3300005978	Marine Gutless Worms Symbiont	MKQSGNGVHVFEPAFDFEHTVDILNTDFRCAEVLPLTRRHT*
Ga0056129_11151903	3300005978	Marine Gutless Worms Symbiont	MKRSGSGVHVLELAFDFVHTVDILNTDFRCAEVLPFARTH
Ga0056129_11403071	3300005978	Marine Gutless Worms Symbiont	LIKRPGSGVHVLELAFDFVHTVDILNTDFRCAEVLPFAD
Ga0056129_11564142	3300005978	Marine Gutless Worms Symbiont	MKRSGSDVHVFELAFDFEHTVDILNTDFRYAEFLPFARTRT*
Ga0056129_11668213	3300005978	Marine Gutless Worms Symbiont	GSGTHVFELAFDFEQTVDILNTDFRCAEVLPFARTHT*
Ga0056129_11858853	3300005978	Marine Gutless Worms Symbiont	SGSGVHVLELAFDFVHTVDILNTDFRCAEVLPFALTLT*
Ga0056129_11926141	3300005978	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFEHTVDILNTDFRCADVLPFARTHT*
Ga0056129_12363602	3300005978	Marine Gutless Worms Symbiont	SSIKWSDSGVHFFELGLKHTVDILNTDFRCAEVLSFALTHT*
Ga0056129_12537693	3300005978	Marine Gutless Worms Symbiont	KRSGSGVHVLELAFDFVHTMDILNTDFRCAEVLPFARTHT*
Ga0056129_12614862	3300005978	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFDFEHTVDILNTDFRCAEVLPFARTHT*
Ga0056129_12668021	3300005978	Marine Gutless Worms Symbiont	RSGSGVHVLELAFDFVHMVDILNTDFRCAEVLPYARTHS*
Ga0056129_12708811	3300005978	Marine Gutless Worms Symbiont	MKRSGSGVHVLELAFAFEHTVDISNTDFRCAEVLPFARMHI*
Ga0056129_12855411	3300005978	Marine Gutless Worms Symbiont	VLELELAFDFVHTVDILNTDFRCAEVLPFARTHT*
Ga0056129_12900781	3300005978	Marine Gutless Worms Symbiont	MKRSRSGVHVFELAFEHTVDILNTDFRCADVLPFA
Ga0056129_13181151	3300005978	Marine Gutless Worms Symbiont	DRGVHVLELAFDFMHTVDILNTDFRCAGVLPFAWTHT*
Ga0056129_13264471	3300005978	Marine Gutless Worms Symbiont	MDYKDCSGVHIFEIAFDFEHTVDILNTDFTCAEVLPFTRTHT*
Ga0056132_10589321	3300005979	Marine Gutless Worms Symbiont	SGSGDHVFELAFEHTVDILNTDFRCADVLPFARTHT*
Ga0056132_10726273	3300005979	Marine Gutless Worms Symbiont	MKRSVSGDHVFELAFEHTVDIMNTDFRCVDVLPFARTHT*
Ga0056132_10854922	3300005979	Marine Gutless Worms Symbiont	RSGSGDHVFELAFEHTVDILNTDFRCADVLPFARTHT*
Ga0056132_11124231	3300005979	Marine Gutless Worms Symbiont	MKRSGNGDHVFELAFEHTVDILNTDFRCADVLPFA
Ga0056132_11732712	3300005979	Marine Gutless Worms Symbiont	KRSGSGDHVFELAFEHTVDILNTDFRCADVLIFARTHA*
Ga0056132_11857192	3300005979	Marine Gutless Worms Symbiont	MKRSVSGDHVFELAFEHTVDILNTDFKCADVLPFAWTHT*
Ga0056132_12522281	3300005979	Marine Gutless Worms Symbiont	MKRSVSGDHVFELAFERTVDILNTDFRCADVLPFARTH
Ga0056132_13445291	3300005979	Marine Gutless Worms Symbiont	MKWSGSGDHVFELAFEHTVDILNTDFMCADVLPFARTHT*
Ga0056126_100090436	3300005984	Marine Gutless Worms Symbiont	MKQSGSGDYVFELAFEHTVDILNTDFRCADVLPFVRMHT*
Ga0056126_100152106	3300005984	Marine Gutless Worms Symbiont	MKWSGSGDHVFELAFEHTVDILSTDFRCADDLPFARTHT*
Ga0056126_101321941	3300005984	Marine Gutless Worms Symbiont	MKRPGSGDHIFKLAFEHTVDILNTDFRCADVLPFAR
Ga0056126_101331603	3300005984	Marine Gutless Worms Symbiont	GNISTRWSSMKRSGSGDHVFELAFEHTVDILNTDFRCADVMPFARAHT*
Ga0056126_101446531	3300005984	Marine Gutless Worms Symbiont	SKSGNISTRWSSMKRSGSGDHVFELAFEHMVDILNTDFICADVLPLARTHT*
Ga0056126_101604012	3300005984	Marine Gutless Worms Symbiont	MKRSGSGDHVFELAFEHTVDILNTDFRCADVLPFTRTHT*
Ga0056126_101783192	3300005984	Marine Gutless Worms Symbiont	MKRSGSGDHVFELVFEHTVDIFNTDFRCADVLPFAWTHT*
Ga0056126_102042601	3300005984	Marine Gutless Worms Symbiont	SGDHVFKLAFEHTVDILNTDFRCADVLPFTILHGRINT*
Ga0056126_102068353	3300005984	Marine Gutless Worms Symbiont	SMKRSGSGDHVFELAFEHTVDILNTDFRCADVSPFARTHT*
Ga0056126_102096961	3300005984	Marine Gutless Worms Symbiont	TRWSSMKRSGSGDHVFELAFEHTVNILNTDFRCADVLPFAWTHT*
Ga0056126_102388663	3300005984	Marine Gutless Worms Symbiont	MKWSGSGDHVFELAFEHMVDILITDFRCADVLPFAQMHT*
Ga0056126_102474812	3300005984	Marine Gutless Worms Symbiont	MKRSGSGNHIFELAFEHTVDILNTDYKCADVLPFAWTHT*
Ga0056126_102790231	3300005984	Marine Gutless Worms Symbiont	SGSGNHVFELAFEHTVDILNTDFRCADVLPFARTHS*
Ga0056126_102824932	3300005984	Marine Gutless Worms Symbiont	GSGDHVFELAFEHTVDILNTDFRCADVLPFAWTHT*
Ga0056126_103194731	3300005984	Marine Gutless Worms Symbiont	SGSGDHVFELAFEHTVDILNTDFRCADVLPFARTHS*
Ga0056126_103236911	3300005984	Marine Gutless Worms Symbiont	SKSGNISTRWSSMKRSGSGDHVFELAFKHTVDILNTDFRSADVLPFARTHT*
Ga0056126_103428151	3300005984	Marine Gutless Worms Symbiont	SKSGNISTRWSSMKRSGSGDHVFELAFEHKVNILNTDFRCADVLPFARTHT*
Ga0056126_103865781	3300005984	Marine Gutless Worms Symbiont	SSMKRSGSGDHVFELAFEHTVDILNTDFRCADVLPFEQTHT*
Ga0056126_103917561	3300005984	Marine Gutless Worms Symbiont	MKRSGSGDHVFELAFEHTVNILNTDFRCADVLPFA
Ga0056126_104325571	3300005984	Marine Gutless Worms Symbiont	VKWSGSGDHVFELAFEHTVDILNTDFRCADVLPFA
Ga0056123_12393011	3300006000	Marine Gutless Worms Symbiont	SGVHVFELAFEHTVDILNTDFRCADVLPFARTHT*
Ga0056123_12529612	3300006000	Marine Gutless Worms Symbiont	TRWSSMKRSGSGVHVFELAFEHTVDILNTDFRSADVLPFTRTHT*
Ga0056123_13775341	3300006000	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFEHTVDILNTDFRCADVLPFA
Ga0056114_10155661	3300006912	Marine Gutless Worms Symbiont	VHVLELAFDFEHTVDILNTDFRCAEVLPFARTHT*
Ga0056114_10170321	3300006912	Marine Gutless Worms Symbiont	WSSIKRSGSGVHVLELAFDFEHTVDFLNTDFRCAGVLSFARTHT*
Ga0056114_102081910	3300006912	Marine Gutless Worms Symbiont	MKQSGTGIHVFELAFDFEHTVDILNTDFRCAKVLPFARTHI*
Ga0056114_10216292	3300006912	Marine Gutless Worms Symbiont	MKLSGSGVHVFELEFDFEHTVDILNIDFRCAEVLPFARTHT*
Ga0056114_10248681	3300006912	Marine Gutless Worms Symbiont	THVLELAFDFEHTVDILNTDFRCAEVLPFARTHT*
Ga0056114_10319787	3300006912	Marine Gutless Worms Symbiont	SGSGVHVLELAFDFVHTVDILNTDFRCAEVLPFAQMHT*
Ga0056114_10321713	3300006912	Marine Gutless Worms Symbiont	MKQSDSGVHIFELALEHMVDILNTDFRCADVLPFAWMHT*
Ga0056114_10327503	3300006912	Marine Gutless Worms Symbiont	MKRAGSGVHVFELAFDFKHTVDILNTDFRCADVLPFARTHT*
Ga0056114_10345657	3300006912	Marine Gutless Worms Symbiont	WSSIKRSGSGVHVFELAFDFEHTVNILNTDFRCAEILPFAQTHT*
Ga0056114_10361265	3300006912	Marine Gutless Worms Symbiont	GSGVHVLELAFDFVYTVDILNTDFRCAEVLPFARTHT*
Ga0056114_10399715	3300006912	Marine Gutless Worms Symbiont	MKQSGSGVHIFELAFDFEHTVDILFNTDFRCADILPFAQTHT*
Ga0056114_10522875	3300006912	Marine Gutless Worms Symbiont	SSMKRSGSGVHVFELAFEHTVDILNTDFRCADVLPFARTHT*
Ga0056114_10595534	3300006912	Marine Gutless Worms Symbiont	RPGSGVHVFELAFDFEHTVDILNTTVADVLPFARTQT*
Ga0056114_10698171	3300006912	Marine Gutless Worms Symbiont	TRWSSMKRSGSGIHVLELAFDFVHTVDILNTDFRCAGELPFARTQT*
Ga0056114_10747411	3300006912	Marine Gutless Worms Symbiont	NWSGSGVHVLELAFDFEHTVDILNTDFRYADVLPFARTHT*
Ga0056114_10763901	3300006912	Marine Gutless Worms Symbiont	MKRSGSGVHIFELAYDFEHTVDILNTDFRCADVLP
Ga0056114_10882382	3300006912	Marine Gutless Worms Symbiont	MKWSGSGVHIFELVFDFEHTVDILNTDFRCAEVLPFARTLS*
Ga0056114_11244832	3300006912	Marine Gutless Worms Symbiont	LVKRSGSGVHIFELAFDFEHTVDIFNTDFRCAEVLPFAWTLT*
Ga0056114_11443391	3300006912	Marine Gutless Worms Symbiont	SGVHVFEVAFEHTVDILNTDFRCASVLPFAWTHT*
Ga0056114_11560113	3300006912	Marine Gutless Worms Symbiont	SKSGNISTRWSSMKRSGSGVHVFKLAFDLEHTVDILNTDFSCAEVLPFARTHT*
Ga0056114_11580842	3300006912	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFDFEHTVDILNTDFRYAEVLPFARTQT*
Ga0056114_11647572	3300006912	Marine Gutless Worms Symbiont	LSGSGVHVLELAFDFMHTVDILNTHFRCAEVLPFA*
Ga0056114_11882921	3300006912	Marine Gutless Worms Symbiont	MKQSGSGVHIFELAFDFEHTVDIFNTDFRCAEVLPFARTHT*
Ga0056114_11987891	3300006912	Marine Gutless Worms Symbiont	ISTRWSSMKRSGSGVHVFELAFDFEHTVDILNTDFRSADVLPFARTHT*
Ga0056114_12119853	3300006912	Marine Gutless Worms Symbiont	ISTRWSSIKRSGSGVHVFELAFDFEHTVDILNTDFRCAGVLPFARTHT*
Ga0056114_12347372	3300006912	Marine Gutless Worms Symbiont	MKRSGSGVYVLELAFDFEYTVDILNTTRCAEVLPFAQTHT*
Ga0056114_12633911	3300006912	Marine Gutless Worms Symbiont	GSGVHVFKLAFEHTVDILNTDFRCADVLPFALTHT*
Ga0056114_12711092	3300006912	Marine Gutless Worms Symbiont	MKRSGTGVHVLEFAFDFEHTVDILNTDFRCAEVLPFARTHT*
Ga0056114_12807771	3300006912	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFEHTVDILNTDFRCADVLPFARTH
Ga0056114_12901271	3300006912	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFDFEHTVDILNTDFRCANILPFARTHT*
Ga0209787_10222251	3300027289	Marine Gutless Worms Symbiont	SIKQSGSGVHVFELAFNFEHTVDSLNTDFRCAEVLPFARTLT
Ga0209787_10276051	3300027289	Marine Gutless Worms Symbiont	MDYKDCSGVHIFEIAFDFDHTVDILNTDFRCAEVLPFARTHT
Ga0209787_10313621	3300027289	Marine Gutless Worms Symbiont	MNRPGSGVHVFELAFDFEHTVDILNTTDADVLPFARTQT
Ga0209787_10506801	3300027289	Marine Gutless Worms Symbiont	GVHVLELAFDFMHTVDILNTDFRCAGVLPFAWTHT
Ga0209787_10872001	3300027289	Marine Gutless Worms Symbiont	MKQSGSGIHTLELAFDFVHTVDILNTYFRCADVLKFAQTHT
Ga0209787_10924962	3300027289	Marine Gutless Worms Symbiont	MKRSSSGVHVLELVLELAFDFEHMVDILNTDFRCA
Ga0209787_11004141	3300027289	Marine Gutless Worms Symbiont	RWSSIKQSGSGIHISELAFDFVHTVDILNTDFRCAGVLPFARTHT
Ga0209787_11045251	3300027289	Marine Gutless Worms Symbiont	MKWTGSGVHVFELVFDFEHMVDILNTDFSCAGILPFAQTHT
Ga0209787_11171392	3300027289	Marine Gutless Worms Symbiont	SMKRSGSGVHVLELAFDFEHTVDILNTDFRRAEVLSFARTHT
Ga0209787_11189061	3300027289	Marine Gutless Worms Symbiont	GNISTRWSSMKRPGSGVHVLALAFDFEHTVDILNTVFRCAGVLPFARTHT
Ga0209787_11560451	3300027289	Marine Gutless Worms Symbiont	LSGSGVHVFELEFDFEHTVDILNIDFRCAEVLPFARTHT
Ga0209787_11667281	3300027289	Marine Gutless Worms Symbiont	KSGNISTRWSSMKRSGSAVYVFELAFDFEHTVDILNTDFRCAEVLPFARTHT
Ga0209787_11904981	3300027289	Marine Gutless Worms Symbiont	GFGVHALELAFDFKHTVDILNTDFSCADVMPFARTHT
Ga0209787_12127951	3300027289	Marine Gutless Worms Symbiont	PGSGVHVLELAFDFEHTVDILNTDFRCASVLPLARTHT
Ga0209052_11185601	3300027338	Marine Gutless Worms Symbiont	MKQSGSGVHVFELAFEHMVDILNTDFRSADVLPVAWTHT
Ga0209052_11671211	3300027338	Marine Gutless Worms Symbiont	SSMKRSGSGVHVFELAFEHMVDILNTDFRSADVWPFAWTHT
Ga0209052_11749191	3300027338	Marine Gutless Worms Symbiont	KSGNISTRWSSMKRSGSGVHVFELAFEHMVDILNTDFRSADVLPFAWTHT
Ga0209052_11982851	3300027338	Marine Gutless Worms Symbiont	SSMKRSGSGVHVFELAFEHMVDILNTDFRSADVLPFAWTHT
Ga0209052_12238891	3300027338	Marine Gutless Worms Symbiont	SMKRSGSGVHVFELAFEHMVDILNTDFRSADVLPFAWTHTYVGVEFR
Ga0209680_10934862	3300027392	Marine Gutless Worms Symbiont	MKQSDSGVHVFELAFEHKVDILNTDFRCADVLPFARTHN
Ga0209680_10967391	3300027392	Marine Gutless Worms Symbiont	MTSGSGVHVFELAFDFEHTVDILNTDFRCAEVLPF
Ga0209680_11086961	3300027392	Marine Gutless Worms Symbiont	MKQSGSGVHIFELALDFEHTVDILFNTDFRCADILPFAQTHT
Ga0209680_11101501	3300027392	Marine Gutless Worms Symbiont	DKAVHIFLSFDFEHTVDILNTDFRCAEVLPFAQMHT
Ga0209680_11251131	3300027392	Marine Gutless Worms Symbiont	KQSGSGVHVFELAFDFEHTVDILNTDFRCAEVLPFARTHT
Ga0209680_11310631	3300027392	Marine Gutless Worms Symbiont	SSMRRSGSGVHVFELAFEHTVDILNTEFRCADILPFARTHT
Ga0209680_11353901	3300027392	Marine Gutless Worms Symbiont	LVKRSGSGVHIFELAFDFEHTVDILNIDFRCAEVLPFARTLT
Ga0209680_11358473	3300027392	Marine Gutless Worms Symbiont	MKWSGNGVHVFELAFDFEHTVDIFNTDFSSVDVLPFARTHT
Ga0209680_11412451	3300027392	Marine Gutless Worms Symbiont	MKRSGSGIHVFELAFDFEHAVDILNIDFRCAEVLLFARTHT
Ga0209680_11433181	3300027392	Marine Gutless Worms Symbiont	GNGVHVFELAFDFEHTVDIFNTDFSSVDVLPFARTHT
Ga0209680_11490991	3300027392	Marine Gutless Worms Symbiont	MKRSGSGVHVFELAFDFEHTVDILNTDFRCAEVLPFARTHT
Ga0209680_11980631	3300027392	Marine Gutless Worms Symbiont	SSIKRSGSGIHVLELAFDSVYTVDILNTDFRCAEVFPIARTHI
Ga0209680_12012211	3300027392	Marine Gutless Worms Symbiont	SIKRSGSGVHVLELAFDVVHTVDILNTDFRCAGVLPFTRTHT
Ga0209680_12130591	3300027392	Marine Gutless Worms Symbiont	IRWSSITWSGFGVHALELAFDFKHTVDILNTDFSCADVMPFARTHT
Ga0209680_12549641	3300027392	Marine Gutless Worms Symbiont	KRSGSGVHVLELAFDFEHTVDILNTGFRCAEVLPFTRTHT
Ga0209680_12587461	3300027392	Marine Gutless Worms Symbiont	MKRSGSGVHVFGLAFDFEHTVDILNTDFRCAGVLPFALTHT
Ga0209788_11200371	3300027495	Marine Gutless Worms Symbiont	RVGTFPSTRWSSMKRPGSGDHVFELAFEHTVDILNTDFRCVDVLPFARTHN
Ga0209788_11510041	3300027495	Marine Gutless Worms Symbiont	SMKRSGSGDHVFELAFEHTVDILNTDFRCADVLPFARTHT
Ga0209788_12207701	3300027495	Marine Gutless Worms Symbiont	STRWSSMKRSGSGDHVFELVFKHTVDILNTDRCADVLPFARTHT
Ga0209788_12595881	3300027495	Marine Gutless Worms Symbiont	SSMKRSGNGDHVFELAFERMVDILNTDFRCADVLPFTRTHA
Ga0209681_10320302	3300027520	Marine Gutless Worms Symbiont	MKWSGSGDHVFELALEHTVDILNTDFRCADVLPFALTHT
Ga0209681_10702741	3300027520	Marine Gutless Worms Symbiont	WSSMKRSVSGDHVFELAFEHTVDILNTDFKCADVLPFAWTHT
Ga0209681_11134772	3300027520	Marine Gutless Worms Symbiont	SVSGDHVFELAFERMVDILNTDFRCAVVLPFARTHT
Ga0209681_11721381	3300027520	Marine Gutless Worms Symbiont	SSMKRSGSGDHVFDLAFEHTVDILNTGFRCADVLPFAQTHT
Ga0209681_11735451	3300027520	Marine Gutless Worms Symbiont	IEGWEHFHQVSSMKWSGSVDHVFELAFEHMVDILNTAFRCADVLPFARTHT
Ga0209458_10079731	3300027549	Marine Gutless Worms Symbiont	MKQSGSGDYVFELAFEHTVDILNTDFRCADVLPFVRMHT
Ga0209458_10146831	3300027549	Marine Gutless Worms Symbiont	MKWSGSGDHVFELAFEHTVDILNTDFRCADVLPFART
Ga0209458_10889231	3300027549	Marine Gutless Worms Symbiont	MKRSGSGDHAFKLAFEHTVNILNTDFRCADVLPFARTRAH
Ga0209458_11101331	3300027549	Marine Gutless Worms Symbiont	TRWSSMKRSGSGDHVFELAFEHTVDILNTDSRCADVLPFARTHT
Ga0209458_11127971	3300027549	Marine Gutless Worms Symbiont	QSGSGDHVFELAFEHTVDILNTDFRCADVLPFPRTHT
Ga0209458_11206851	3300027549	Marine Gutless Worms Symbiont	SKSGNISTRWSSMKQSGSGDDVFELAFEHTVDILNTDFRCADVLPFARTHT
Ga0209458_11390951	3300027549	Marine Gutless Worms Symbiont	SSMKRSGSGDHVFELAFEHTVDILNTDFRCADVSPFARTHT
Ga0209458_11575761	3300027549	Marine Gutless Worms Symbiont	GNISTRWSSMKWSGSGDHVFELAFEHTVDILSTDFRCADDLPFARTHT
Ga0209458_11767301	3300027549	Marine Gutless Worms Symbiont	GNISTRWSSMKRSGSGDHVFELAFEHTVDILNTDFRCADVLPFVRTHT
Ga0209458_12330331	3300027549	Marine Gutless Worms Symbiont	AMKQSGSGDHVFELAFEHTVDILNTDFRCLDVLPFAQMHT
Ga0209458_13246171	3300027549	Marine Gutless Worms Symbiont	MKQSGSGDHVFELAFKHTVDILNTDFRCADVLPFTWTHT

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F031004

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated	Open in IMG/M
3300005648	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.1	Host-Associated	Open in IMG/M
3300005871	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND	Host-Associated	Open in IMG/M
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated	Open in IMG/M
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated	Open in IMG/M
3300005979	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.2	Host-Associated	Open in IMG/M
3300005984	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus manae LIZARD ISLAND	Host-Associated	Open in IMG/M
3300006000	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 3 HERON ISLAND	Host-Associated	Open in IMG/M
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated	Open in IMG/M
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027338	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND (SPAdes)	Host-Associated	Open in IMG/M
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027495	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027520	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027549	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus manae LIZARD ISLAND (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign