NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F031276

Metagenome Family F031276

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031276
Family Type Metagenome
Number of Sequences 183
Average Sequence Length 41 residues
Representative Sequence MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFDS
Number of Associated Samples 164
Number of Associated Scaffolds 183

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.98 %
% of genes near scaffold ends (potentially truncated) 95.08 %
% of genes from short scaffolds (< 2000 bps) 85.25 %
Associated GOLD sequencing projects 160
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.224 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(9.290 % of family members)
Environment Ontology (ENVO) Unclassified
(19.126 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.530 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 183 Family Scaffolds
PF05988DUF899 1.09
PF01370Epimerase 1.09
PF04966OprB 1.09
PF04655APH_6_hur 1.09
PF07690MFS_1 1.09
PF00793DAHP_synth_1 1.09
PF00266Aminotran_5 1.09
PF07366SnoaL 1.09
PF00196GerE 0.55
PF08028Acyl-CoA_dh_2 0.55
PF03551PadR 0.55
PF01055Glyco_hydro_31 0.55
PF01569PAP2 0.55
PF01019G_glu_transpept 0.55
PF05163DinB 0.55
PF01026TatD_DNase 0.55
PF00144Beta-lactamase 0.55
PF02321OEP 0.55
PF00999Na_H_Exchanger 0.55
PF01872RibD_C 0.55
PF02518HATPase_c 0.55
PF12072RNase_Y_N 0.55
PF13193AMP-binding_C 0.55
PF13453zf-TFIIB 0.55
PF01906YbjQ_1 0.55
PF00561Abhydrolase_1 0.55
PF01145Band_7 0.55
PF08281Sigma70_r4_2 0.55
PF03576Peptidase_S58 0.55
PF069833-dmu-9_3-mt 0.55
PF02652Lactate_perm 0.55
PF01927Mut7-C 0.55
PF05015HigB-like_toxin 0.55
PF02780Transketolase_C 0.55
PF03446NAD_binding_2 0.55
PF01061ABC2_membrane 0.55
PF13905Thioredoxin_8 0.55
PF02452PemK_toxin 0.55
PF13533Biotin_lipoyl_2 0.55
PF14534DUF4440 0.55
PF13683rve_3 0.55
PF02082Rrf2 0.55
PF13531SBP_bac_11 0.55
PF10442FIST_C 0.55
PF12697Abhydrolase_6 0.55
PF12867DinB_2 0.55
PF02774Semialdhyde_dhC 0.55
PF00583Acetyltransf_1 0.55
PF13489Methyltransf_23 0.55
PF12695Abhydrolase_5 0.55
PF07228SpoIIE 0.55
PF00903Glyoxalase 0.55
PF14066DUF4256 0.55
PF03167UDG 0.55
PF13620CarboxypepD_reg 0.55
PF04972BON 0.55
PF09335SNARE_assoc 0.55
PF01381HTH_3 0.55
PF00303Thymidylat_synt 0.55
PF02687FtsX 0.55
PF07732Cu-oxidase_3 0.55
PF13506Glyco_transf_21 0.55
PF13495Phage_int_SAM_4 0.55
PF01297ZnuA 0.55
PF00106adh_short 0.55
PF00581Rhodanese 0.55
PF05016ParE_toxin 0.55
PF13376OmdA 0.55
PF04075F420H2_quin_red 0.55
PF03060NMO 0.55
PF13180PDZ_2 0.55
PF13189Cytidylate_kin2 0.55
PF00589Phage_integrase 0.55
PF13560HTH_31 0.55
PF10282Lactonase 0.55
PF00069Pkinase 0.55
PF06197DUF998 0.55
PF13618Gluconate_2-dh3 0.55
PF02913FAD-oxidase_C 0.55
PF03466LysR_substrate 0.55
PF13419HAD_2 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 183 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.19
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.09
COG3191L-aminopeptidase/D-esteraseAmino acid transport and metabolism [E] 1.09
COG3570Streptomycin 6-kinaseDefense mechanisms [V] 1.09
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 1.09
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 1.09
COG0002N-acetyl-gamma-glutamylphosphate reductaseAmino acid transport and metabolism [E] 0.55
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.55
COG0136Aspartate-semialdehyde dehydrogenaseAmino acid transport and metabolism [E] 0.55
COG0207Thymidylate synthaseNucleotide transport and metabolism [F] 0.55
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.55
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.55
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.55
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.55
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.55
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.55
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.55
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.55
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.55
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.55
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.55
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.55
COG1501Alpha-glucosidase/xylosidase, GH31 familyCarbohydrate transport and metabolism [G] 0.55
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.55
COG1620L-lactate permeaseEnergy production and conversion [C] 0.55
COG1656Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domainGeneral function prediction only [R] 0.55
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.55
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.55
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.55
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.55
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.55
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.55
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.55
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.55
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.55
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.55
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.55
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.55
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.55
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.55
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.55
COG2367Beta-lactamase class ADefense mechanisms [V] 0.55
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.55
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.55
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.55
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.55
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.55
COG3371Uncharacterized membrane proteinFunction unknown [S] 0.55
COG3549Plasmid maintenance system killer proteinDefense mechanisms [V] 0.55
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.55
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.55
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.22 %
UnclassifiedrootN/A26.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111022|2221214517All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300000559|F14TC_100513649Not Available694Open in IMG/M
3300001305|C688J14111_10243953All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300001686|C688J18823_10813877All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300002908|JGI25382J43887_10025349All Organisms → cellular organisms → Bacteria3185Open in IMG/M
3300004052|Ga0055490_10048047Not Available1107Open in IMG/M
3300004463|Ga0063356_105844055All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1528Open in IMG/M
3300005178|Ga0066688_10419182All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005329|Ga0070683_100018293All Organisms → cellular organisms → Bacteria6203Open in IMG/M
3300005332|Ga0066388_100366446All Organisms → cellular organisms → Bacteria2087Open in IMG/M
3300005353|Ga0070669_100243515All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300005353|Ga0070669_100708347All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes850Open in IMG/M
3300005437|Ga0070710_10670893All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005454|Ga0066687_10333853Not Available866Open in IMG/M
3300005467|Ga0070706_101001782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1770Open in IMG/M
3300005468|Ga0070707_100296361All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300005553|Ga0066695_10491554All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079755Open in IMG/M
3300005555|Ga0066692_10065493All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → unclassified Alteromonadaceae → Alteromonadaceae bacterium Bs312067Open in IMG/M
3300005555|Ga0066692_10930112All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005556|Ga0066707_10727347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300005569|Ga0066705_10626796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300005713|Ga0066905_101206140All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005719|Ga0068861_102149619Not Available559Open in IMG/M
3300005764|Ga0066903_101582247All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300005840|Ga0068870_10176514All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300005844|Ga0068862_100123356All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2285Open in IMG/M
3300006028|Ga0070717_11086422All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300006028|Ga0070717_11351123All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300006034|Ga0066656_10243813All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300006163|Ga0070715_10608036All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006844|Ga0075428_100000838All Organisms → cellular organisms → Bacteria32194Open in IMG/M
3300006846|Ga0075430_100411321All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300006847|Ga0075431_101069650All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300006881|Ga0068865_100207136All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300006893|Ga0073928_10130542Not Available2056Open in IMG/M
3300006893|Ga0073928_11027425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1560Open in IMG/M
3300006894|Ga0079215_10419676All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium799Open in IMG/M
3300006903|Ga0075426_10083097All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300006904|Ga0075424_101847741All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300006918|Ga0079216_10333319All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300009012|Ga0066710_100707869All Organisms → cellular organisms → Bacteria → Proteobacteria1536Open in IMG/M
3300009091|Ga0102851_12629566Not Available577Open in IMG/M
3300009792|Ga0126374_10932011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Hiyo6676Open in IMG/M
3300010037|Ga0126304_10118496Not Available1689Open in IMG/M
3300010044|Ga0126310_10822969Not Available716Open in IMG/M
3300010044|Ga0126310_11726968Not Available520Open in IMG/M
3300010048|Ga0126373_10143233All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300011411|Ga0153933_1037487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius1093Open in IMG/M
3300012357|Ga0137384_11111125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium633Open in IMG/M
3300012917|Ga0137395_10514667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1862Open in IMG/M
3300012930|Ga0137407_10020015All Organisms → cellular organisms → Bacteria5002Open in IMG/M
3300012944|Ga0137410_11950345Not Available521Open in IMG/M
3300012971|Ga0126369_11157954Not Available863Open in IMG/M
3300015242|Ga0137412_10271387All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300015371|Ga0132258_10121866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6198Open in IMG/M
3300015374|Ga0132255_102270673Not Available828Open in IMG/M
3300016270|Ga0182036_10462117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-11000Open in IMG/M
3300016319|Ga0182033_11779468Not Available559Open in IMG/M
3300016371|Ga0182034_10312821Not Available1263Open in IMG/M
3300016422|Ga0182039_10700252Not Available893Open in IMG/M
3300016422|Ga0182039_10981623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium haematophilum757Open in IMG/M
3300017933|Ga0187801_10422923All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. BvORR106556Open in IMG/M
3300017935|Ga0187848_10442615Not Available533Open in IMG/M
3300017936|Ga0187821_10009537All Organisms → cellular organisms → Bacteria3306Open in IMG/M
3300017942|Ga0187808_10013883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3189Open in IMG/M
3300017946|Ga0187879_10225570All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin3451047Open in IMG/M
3300017972|Ga0187781_11372066All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300017975|Ga0187782_10567480Not Available871Open in IMG/M
3300018006|Ga0187804_10246772All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300018006|Ga0187804_10249562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1766Open in IMG/M
3300018016|Ga0187880_1306589All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300018028|Ga0184608_10008101All Organisms → cellular organisms → Bacteria3494Open in IMG/M
3300018033|Ga0187867_10213493Not Available1094Open in IMG/M
3300018038|Ga0187855_10298042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae944Open in IMG/M
3300018043|Ga0187887_10209488Not Available1158Open in IMG/M
3300018072|Ga0184635_10117135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1058Open in IMG/M
3300018088|Ga0187771_11519313Not Available568Open in IMG/M
3300018090|Ga0187770_11561267Not Available538Open in IMG/M
3300018422|Ga0190265_10118362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus2525Open in IMG/M
3300018431|Ga0066655_11100187All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300018433|Ga0066667_10756888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae821Open in IMG/M
3300020003|Ga0193739_1129889All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300020170|Ga0179594_10154675All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300020220|Ga0194119_10927079Not Available505Open in IMG/M
3300021088|Ga0210404_10521839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1672Open in IMG/M
3300021377|Ga0213874_10385089All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300021420|Ga0210394_10366124All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300021420|Ga0210394_11420442All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300021432|Ga0210384_10689332All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300021444|Ga0213878_10359866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans630Open in IMG/M
3300021474|Ga0210390_11603926All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300021559|Ga0210409_10468109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Hiyo61122Open in IMG/M
3300021559|Ga0210409_10942425All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300022557|Ga0212123_10335505Not Available1040Open in IMG/M
3300023247|Ga0224529_1068384All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300024290|Ga0247667_1039027All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300024330|Ga0137417_1004896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300025324|Ga0209640_10610104Not Available879Open in IMG/M
3300025509|Ga0208848_1012125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1815Open in IMG/M
3300025509|Ga0208848_1038323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1037Open in IMG/M
3300025664|Ga0208849_1017646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2412Open in IMG/M
3300025910|Ga0207684_10740709All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300025910|Ga0207684_11124819All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium653Open in IMG/M
3300025933|Ga0207706_11407635Not Available572Open in IMG/M
3300025939|Ga0207665_10278464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1244Open in IMG/M
3300026297|Ga0209237_1117541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1126Open in IMG/M
3300026330|Ga0209473_1216708All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes708Open in IMG/M
3300026529|Ga0209806_1025502All Organisms → cellular organisms → Bacteria2990Open in IMG/M
3300026557|Ga0179587_10054557All Organisms → cellular organisms → Bacteria2310Open in IMG/M
3300026557|Ga0179587_10325983All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300027587|Ga0209220_1078204Not Available875Open in IMG/M
3300027645|Ga0209117_1023681All Organisms → cellular organisms → Bacteria1964Open in IMG/M
3300027655|Ga0209388_1003145All Organisms → cellular organisms → Bacteria → Proteobacteria4066Open in IMG/M
3300027667|Ga0209009_1027388All Organisms → cellular organisms → Bacteria → Proteobacteria1398Open in IMG/M
3300027671|Ga0209588_1010369All Organisms → cellular organisms → Bacteria2801Open in IMG/M
3300027674|Ga0209118_1043401All Organisms → cellular organisms → Bacteria → Terrabacteria group1345Open in IMG/M
3300027738|Ga0208989_10144279Not Available801Open in IMG/M
3300027783|Ga0209448_10109910All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300027812|Ga0209656_10371664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300027880|Ga0209481_10227078All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300027882|Ga0209590_10577480Not Available724Open in IMG/M
3300027882|Ga0209590_10711646Not Available642Open in IMG/M
3300027903|Ga0209488_10868851All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300027903|Ga0209488_10883334All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300027905|Ga0209415_10909828Not Available597Open in IMG/M
3300027909|Ga0209382_11832306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300027911|Ga0209698_11077543Not Available596Open in IMG/M
3300028381|Ga0268264_12270055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300028711|Ga0307293_10127036All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300028807|Ga0307305_10102166All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300028878|Ga0307278_10546007All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300028884|Ga0307308_10095733Not Available1412Open in IMG/M
3300028906|Ga0308309_10786784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola827Open in IMG/M
3300028906|Ga0308309_11636358All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300028909|Ga0302200_10303423All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300029817|Ga0247275_1006481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685245Open in IMG/M
3300029943|Ga0311340_10278156All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300029944|Ga0311352_10287708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum1373Open in IMG/M
3300029952|Ga0311346_10945496All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300029999|Ga0311339_10014952All Organisms → cellular organisms → Bacteria → Acidobacteria11885Open in IMG/M
3300030011|Ga0302270_10245968All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300030045|Ga0302282_1226864All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300030496|Ga0268240_10162056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium556Open in IMG/M
3300030520|Ga0311372_13077276Not Available501Open in IMG/M
3300030580|Ga0311355_10050538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4893Open in IMG/M
3300030743|Ga0265461_13318616All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300031228|Ga0299914_10337250Not Available1323Open in IMG/M
3300031229|Ga0299913_11027588All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300031231|Ga0170824_115135514All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300031232|Ga0302323_103449464Not Available503Open in IMG/M
3300031234|Ga0302325_10071753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis6694Open in IMG/M
3300031234|Ga0302325_11020865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1127Open in IMG/M
3300031525|Ga0302326_11752226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1816Open in IMG/M
3300031708|Ga0310686_107220305All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300031708|Ga0310686_118217089All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031715|Ga0307476_10701917All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300031716|Ga0310813_11220308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4693Open in IMG/M
3300031720|Ga0307469_10942345All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300031720|Ga0307469_11592902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Hiyo6627Open in IMG/M
3300031747|Ga0318502_10697805Not Available613Open in IMG/M
3300031753|Ga0307477_10336416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1039Open in IMG/M
3300031754|Ga0307475_11163925All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300031819|Ga0318568_10531003Not Available734Open in IMG/M
3300031820|Ga0307473_11417697Not Available524Open in IMG/M
3300031852|Ga0307410_11788734Not Available546Open in IMG/M
3300031897|Ga0318520_10760108Not Available607Open in IMG/M
3300031901|Ga0307406_10458749Not Available1024Open in IMG/M
3300031903|Ga0307407_10138780All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300031954|Ga0306926_10262869All Organisms → cellular organisms → Bacteria2138Open in IMG/M
3300032035|Ga0310911_10216171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1093Open in IMG/M
3300032063|Ga0318504_10540711Not Available559Open in IMG/M
3300032126|Ga0307415_102322335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300033004|Ga0335084_11211302All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp.754Open in IMG/M
3300033289|Ga0310914_10240799All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300033289|Ga0310914_11470669Not Available584Open in IMG/M
3300033290|Ga0318519_10476672All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300033419|Ga0316601_101087207Not Available800Open in IMG/M
3300033486|Ga0316624_10357928All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300033513|Ga0316628_100693733Not Available1335Open in IMG/M
3300033557|Ga0316617_102392659Not Available547Open in IMG/M
3300034143|Ga0334961_093439Not Available531Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.29%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.46%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.28%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.28%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.73%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.19%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.19%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.64%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.64%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.64%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.64%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.09%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.09%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.09%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.09%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.09%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.09%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.55%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.55%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.55%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.55%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.55%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.55%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.55%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.55%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.55%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.55%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.55%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.55%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.55%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011411Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaGHost-AssociatedOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023247Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025664Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034143Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22220570142209111022Grass SoilMSDKIGGGPTRANKPNGYVLGSYRIATAPEPNSSRLTSFKSIGFDSPGT
F14TC_10051364923300000559SoilMRPTRAHKPDGYPLGSYLIATALEPSSSRLTSLKSRCFESPANNVGPW
C688J14111_1024395313300001305SoilMMRPTRANKPNNYLLGSYRMATAPEPNSSRLTSLKSTRFDS
C688J18823_1081387713300001686SoilMMRPTRANKPNNYLLGSYRMATAPEPNSSRLTSLKSTRFD
JGI25382J43887_1002534913300002908Grasslands SoilMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPAN
Ga0055490_1004804733300004052Natural And Restored WetlandsMMRLTWANKSDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPA
Ga0063356_10584405523300004463Arabidopsis Thaliana RhizosphereMRPTRSNKPHGYLLGSYRIATAPEPNSRRPTSLKSTCFDSPAN
Ga0066688_1041918223300005178SoilMMRPTRANKPDGYLLGSYRIATDPEPNSSRLTSLKSTRFDSPANNVGPWP
Ga0070683_10001829333300005329Corn RhizosphereMMPPTRANKLKGYFLGSYRIAAASEPNSSLLTSLSRICFGSRANDVGPWPVTEPRQPTPS
Ga0066388_10036644653300005332Tropical Forest SoilMTRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSTRFD
Ga0070669_10024351543300005353Switchgrass RhizosphereMMRPTRANKPDGYLIGSYRIATAPEPNSSRLTSFKSTRFDNPANN
Ga0070669_10070834713300005353Switchgrass RhizosphereMVATAPDGYLLGSYRIATAPEPSSSRLTSFRSTCFDSPANNVG
Ga0070710_1067089323300005437Corn, Switchgrass And Miscanthus RhizosphereMMRPTRANKPDGYLLGSYRIATAPESNSSRLTSFKSTRFD
Ga0066687_1033385323300005454SoilMMRPTQAYKPNGYLLGSYRIAIAPEPNSSRLTSLKSIRFDSPANN
Ga0070706_10100178223300005467Corn, Switchgrass And Miscanthus RhizosphereMMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDS
Ga0070707_10029636123300005468Corn, Switchgrass And Miscanthus RhizosphereMRATRASKPDRYLRGSYRIATAPEPNSSRLTSFKSTRFDSPANNVG
Ga0066695_1049155423300005553SoilMTELPVMRQTLAAIYLLGSYRIATAPEPNSSRLTSFK
Ga0066692_1006549313300005555SoilMMQPTRSNNADGYLLGSYRIATAPEPNSSRLTSFKSTRFDSPANNV
Ga0066692_1093011213300005555SoilMRPTRANKPDCYRLGSYRIATAPEPNSSRLTSFKSI
Ga0066707_1072734713300005556SoilMMRLARASKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPA
Ga0066705_1062679613300005569SoilMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFD
Ga0066905_10120614013300005713Tropical Forest SoilMMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFK
Ga0068861_10214961923300005719Switchgrass RhizosphereMRPTRANKPDCYRLGSYRIATAPEPNSSRLTSFKST
Ga0066903_10158224713300005764Tropical Forest SoilMPPARRNKTNSYLLSSYRIATAPEPNSSWLTSFKSTGFDSPA
Ga0068870_1017651413300005840Miscanthus RhizosphereMAQVREGYLLGSYRIAITPEPNSRRLTSLNSTLFDNPASNVGPWPASLG*
Ga0068862_10012335613300005844Switchgrass RhizosphereMVATAPDGYLLGSYRIATAPEPSSSRLTSFRSTCFDSPANN
Ga0070717_1108642223300006028Corn, Switchgrass And Miscanthus RhizosphereMRKTLASKPNGYLLGSYRIATAPEPNSSRLTSLKSTGFD
Ga0070717_1135112313300006028Corn, Switchgrass And Miscanthus RhizosphereMMLPTGANKPDGYLRGSYRIATAPEPNPSRLTSLKSTRFDSPA
Ga0066656_1024381323300006034SoilMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKST
Ga0070715_1060803623300006163Corn, Switchgrass And Miscanthus RhizosphereMMRPTRANKPDGYLLASYRIATAPELNSSRLTSFKSTRFDSPANNVG
Ga0075428_100000838273300006844Populus RhizosphereMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIPFDSPANKVGPWPQSA*
Ga0075430_10041132123300006846Populus RhizosphereMTRPTRANKPDGYRLGSYRIATAPELNSSRFTSFKSIRF
Ga0075431_10106965013300006847Populus RhizosphereVRPTWANKPDGYLLGSYRIATAPEPNSRRLTSFKS
Ga0068865_10020713613300006881Miscanthus RhizosphereMLNKPSDYPLGSYRIAPEPTSSWLTSLKSTYFDSPAN
Ga0073928_1013054233300006893Iron-Sulfur Acid SpringMMRPNRANKPNGYLLGSYRIATAPEPNSSRLTSLK
Ga0073928_1102742513300006893Iron-Sulfur Acid SpringMTGPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTCFDS
Ga0079215_1041967613300006894Agricultural SoilMRATRASKPDGYLFGSYRIATAPEPNSSRLTSFKSTRFDSPANNVG
Ga0075426_1008309713300006903Populus RhizosphereMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTCFDSPANN
Ga0075424_10184774113300006904Populus RhizosphereMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKS
Ga0079216_1033331923300006918Agricultural SoilMNQCFSVLKTSGHILGSYRIANAPEPNSSRLTSFKSRCFDSPANNVGPWPASLG
Ga0066710_10070786933300009012Grasslands SoilMRPTRATKPDVYLLGSYRIATAPEPNSSLLTSFKS
Ga0102851_1262956623300009091Freshwater WetlandsMLLLARSYPDGYFLGSHRKATAPEPNSSWLTSFKSTCFDSPANKIGP
Ga0126374_1093201123300009792Tropical Forest SoilMCRKAHSSPNGYLLGSYRIATAPDPNSSRLTSFKSTCFDSPANNV
Ga0126304_1011849613300010037Serpentine SoilMMRPTQANKPDGYLLGSYRIATAPEPNSSRLTSFK
Ga0126310_1082296913300010044Serpentine SoilMMQPTRANTPDGYRLGSYRIATAPEPNSSRLTSCKS
Ga0126310_1172696813300010044Serpentine SoilMQPTRANTPDGYRLGTYRIATAPEPNSRRLTSVKS
Ga0126373_1014323313300010048Tropical Forest SoilMMRPTRANKSNGYLLGSYRIATAPEPNSSWPTSLK
Ga0134126_1290048523300010396Terrestrial SoilVPPLPEKPNSYLLGSYRIATAPELNSCRLTGRKSIGFDSPANKVGPWPA
Ga0153933_103748713300011411Attine Ant Fungus GardensMMRPNRINKPNSYLLGSYRIATTPERNSSRLTSLKSRGFDSPANN
Ga0137384_1111112513300012357Vadose Zone SoilMMQPARASKPDGYLLGSYRIATAPEPNSSRLTSFK
Ga0137395_1051466733300012917Vadose Zone SoilMDIKPDGYLLGSYRIATAPEPNSSRLTSFKSTRFDSPANN
Ga0137407_1002001593300012930Vadose Zone SoilMMRPIRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTCFDSPANKVGPWPASLGC
Ga0137410_1195034513300012944Vadose Zone SoilMHELRVMRLTRANKPNRYLLGSYRIATAPEPNSSRLTSLK
Ga0126369_1115795413300012971Tropical Forest SoilMMRPTRANKANGYLLGSYRIATAPEPNSSRLTSLKS
Ga0137412_1027138743300015242Vadose Zone SoilMMRPIRANKPNGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPANHVCPWPVS
Ga0132258_1012186613300015371Arabidopsis RhizosphereMNLLMPCMIRPTRVDKRDGYLLGSYRIATAPEPNSRRLT
Ga0132255_10227067313300015374Arabidopsis RhizosphereMIQPTRGNEPNGYLVGSYRIATAPEPNSNRLTSLRSTC
Ga0182036_1046211713300016270SoilMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRF
Ga0182033_1177946823300016319SoilMMRLTRANKPSYLLDSYRIATAPEPNSIRLTSFKS
Ga0182034_1031282143300016371SoilMVRPTRANNPDGYLVGSYRIATPEPNSSRLTSLKSTGFD
Ga0182039_1070025233300016422SoilMVRPTRANNPDGYLVGSYRIATPEPNSSRLTSLKSTGFDSP
Ga0182039_1098162313300016422SoilMMRLTRANKPSYLPDSYRIATAPEPNSIRLTSFKSIDLDS
Ga0187801_1042292313300017933Freshwater SedimentMMRPTRANKPNGYLLGSYRIATAPEPNSSRPTSFKSMRFDSPANNV
Ga0187848_1044261513300017935PeatlandMMRPTRTNKPNGYLLGSYRIATAPEPNSSRLTSLKS
Ga0187821_1000953713300017936Freshwater SedimentMMRWTRANKPNCYLLGSYRIATAPEPNSSRLTSFKSSHFDIPANN
Ga0187808_1001388363300017942Freshwater SedimentMLRPTRANKPNVYLLGSYRIATAPEPNSSRLTSLKST
Ga0187879_1022557023300017946PeatlandMRPTRANKPKCYLLGSYPIATAPEPNSSRLTSLKSTRFDSPANNVGPWP
Ga0187781_1137206623300017972Tropical PeatlandMMRPARANRPNGYLLGSYRIATAPEPNSSRFTSLKSTGFDSPANNV
Ga0187782_1056748023300017975Tropical PeatlandMMRRLGLNQPDGYFLGSYRIATVPEANSSRLTSLKST
Ga0187804_1024677213300018006Freshwater SedimentMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLK
Ga0187804_1024956233300018006Freshwater SedimentMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKST
Ga0187880_130658913300018016PeatlandMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRFDSP
Ga0184608_1000810183300018028Groundwater SedimentMMRATRASKPDDYLLGSYRIATAPEPNSSRLTSFKSTCFDSP
Ga0187867_1021349333300018033PeatlandMMRPTRANKPNGYLGSYRIATAPEPNSSRLTSLKSTRFDSPA
Ga0187855_1029804213300018038PeatlandMRPTRANKPNGYPLGSYRIATAPEPNSSRLTNLKSTCF
Ga0187887_1020948823300018043PeatlandMMRPTHANRLNGYFLGSYRSTTAPEPNSSRLTSFK
Ga0184635_1011713533300018072Groundwater SedimentMMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIRFDS
Ga0187771_1151931313300018088Tropical PeatlandMMRSTRANKPNGYLLGSYRIATVPEPNSSRLTSLKST
Ga0187770_1156126713300018090Tropical PeatlandMWPTPANKPNAYLLGSYRIATAPEPNSSRLTSLKSRGFDS
Ga0190265_1011836233300018422SoilMMRPTRANKPDGYLLGSYRIATAPEPSSSRLTSFK
Ga0066655_1110018723300018431Grasslands SoilMRPARANKPEGYLLGSYRIATAPEPNSSRLTSFKSTHFDSPAN
Ga0066667_1075688813300018433Grasslands SoilMLLLARFSPDGYLLGSYRIATAPEPNSSRLTSFKSIC
Ga0193739_112988913300020003SoilMMRATRASKPDGYLLGSYRIATAPEPNSSRLTSFKSTC
Ga0179594_1015467513300020170Vadose Zone SoilMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSI
Ga0194119_1092707913300020220Freshwater LakeMTWPELLRGRLGLTSPNGYLLGSYRIATAPEPNSSRSTSFKSTRFESPA
Ga0210404_1052183913300021088SoilMMRATRANKPNGYLLGSYRIATAPEPNSSRLTSLKS
Ga0213874_1038508923300021377Plant RootsMMRPIWANQGNGYLLGSYLIATAPEPNSTRLTSLKSTGFDRP
Ga0210394_1036612423300021420SoilMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFDSPANNV
Ga0210394_1142044213300021420SoilMMRPTGANKPDGYLLGSYRIATAPEPNSSRLTSLKST
Ga0210384_1068933213300021432SoilMVRPARSSEPDGYLLGSYRIATAPEPNSSRLTSFRSTCFD
Ga0213878_1035986613300021444Bulk SoilMMRPTRASKPNSYLLGSYRTATAPEPNSSWLTSLK
Ga0210390_1160392623300021474SoilMRPTRANKPNGYLLGSYRIATAPEPNTSRLTSLKSTCFDSPANNV
Ga0210409_1046810923300021559SoilMQPTRANKPNGYLLGSYRIATAPEPNSSRLTSRKSTCFDSPA
Ga0210409_1094242533300021559SoilMMRPTRANKPNGYLIGSYRIATAPESNSSRLTSLKST
Ga0212123_1033550533300022557Iron-Sulfur Acid SpringMIWPTRANKPDGYLLGSYRIATAPEPNSSRLTSLKS
Ga0224529_106838423300023247SoilMRPTLASKPKGYLLGSYRMATAPEPNSSRLTSLKSICFDSPANNV
Ga0247667_103902713300024290SoilMRPTRANKPNGYLLGSYRIATAPEPSSSRLTSLKSTCFDSPTNNVGPWPASLGCTT
Ga0137417_100489633300024330Vadose Zone SoilMMRPARASKPDGYLLGSYRIATAPEPNSSRLTSFKSRC
Ga0209640_1061010413300025324SoilMRPTRATKPDVYLLGSYRIATAPEPNSSRFTSFKS
Ga0208848_101212513300025509Arctic Peat SoilMMRPARASKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSP
Ga0208848_103832343300025509Arctic Peat SoilMRPARASNPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSP
Ga0208849_101764613300025664Arctic Peat SoilMMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSLKSTRFDSPA
Ga0207684_1074070913300025910Corn, Switchgrass And Miscanthus RhizosphereMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSICFDSP
Ga0207684_1112481923300025910Corn, Switchgrass And Miscanthus RhizosphereMMRPTWANKPNGYLLGSYRIATAPEPNSSQLTSLKSTCF
Ga0207706_1140763513300025933Corn RhizosphereMMQPTRANKPNGYLLGSYRIATAPEPNSSRLTSFK
Ga0207665_1027846413300025939Corn, Switchgrass And Miscanthus RhizosphereMMRPTQANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRF
Ga0207667_1066660733300025949Corn RhizosphereLLGSYRIATAPDSNSNRPTSFKSTYFDSPANNGYPIRPL
Ga0209237_111754113300026297Grasslands SoilVSLNSKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPANNV
Ga0209473_121670813300026330SoilMIRPTRAKTPDGYLFGSYRIATAPEPSSSRPTSFKSIHFDSPAN
Ga0209806_102550223300026529SoilMMRPTRANKPDGYLLGSYRIATDPEPNSSRLTSLKSTRFDSPANNVGPWPASLA
Ga0179587_1005455753300026557Vadose Zone SoilMIRPARASKPDGYLPGSYRIATAPEPNSSRLTSFKSTCFDSPASNVGPWPASL
Ga0179587_1032598323300026557Vadose Zone SoilMMRPTGLSKRNGYLLGSYRIATAPEPNSSRLTSLKSIRFDSPA
Ga0209220_107820413300027587Forest SoilMIWPTPANKPDGYLRGSYRIATAPEPNSSRLTSLKSTRFDSPANSV
Ga0209117_102368113300027645Forest SoilMIRPARANKSDGYLLGSYRIATAPEPNSSRLTSLKSTRFDSPANNVG
Ga0209388_100314513300027655Vadose Zone SoilMMRPTWANKPNGYLLGSYRIATAPEPNSSRLTSLKSTC
Ga0209009_102738813300027667Forest SoilMMRPTRANKPNGYLRGSYRIATAPELNSSRLTSLKST
Ga0209588_101036943300027671Vadose Zone SoilMMRPTRANKPNGYPLGSYRIATAPEPNSSRLTSLKSTCFDSPANTV
Ga0209118_104340113300027674Forest SoilMIWPTRANKPDGYLLGSYRIATAPEPNSSRLTSLKSIRF
Ga0208989_1014427913300027738Forest SoilRAGKPECYLLGLYRIATAPEANSSRLTSFKSDTLR
Ga0209448_1010991013300027783Bog Forest SoilMMRPARANKPDGYFLGSYRIATAPEPNSSRLTSFKSTCFDSPANSVGPWP
Ga0209656_1037166413300027812Bog Forest SoilMMRPARASKPDGYLLGSYRIATAPEPNSSRLTNFKSTCFDSP
Ga0209481_1022707813300027880Populus RhizosphereMTRPTRANKPDGYLLGSYRIATAPELNSSRFTSFKS
Ga0209590_1057748013300027882Vadose Zone SoilMMRPTPANKPNGYLLGSYRIATAPEPNSSRPTSLKSIRF
Ga0209590_1071164613300027882Vadose Zone SoilMMRPARANKPDGYLLGSYRIATAPKPNSSRLTSFKSTCFDSPATN
Ga0209488_1086885123300027903Vadose Zone SoilMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRF
Ga0209488_1088333423300027903Vadose Zone SoilMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSVKSTR
Ga0209415_1090982813300027905Peatlands SoilMMRPTRANKPNGYLLGSYRIAIAPEPNSSRLTSLRSTC
Ga0209382_1183230623300027909Populus RhizosphereMRPTRASKPDGYLFGSYRIATAPEPNSSRLTSFKSTSFDSP
Ga0209698_1107754313300027911WatershedsMMLPTRVSKPDRYRTGSYRIATAPEPNSSRLTRLK
Ga0268264_1227005523300028381Switchgrass RhizosphereMLNKPSDYPLGSYRIAPEPTSSWLTSLKSTYFDSPANTVGPWP
Ga0307293_1012703623300028711SoilMRATRASKPDGYLLGSYRIATAPEPNSSRLTSFKSTRFDSPANNV
Ga0307305_1010216613300028807SoilMMRPARAGKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDS
Ga0307278_1054600713300028878SoilMMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSTGFDSPAN
Ga0307308_1009573323300028884SoilMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPA
Ga0308309_1078678413300028906SoilMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTCFDSPANN
Ga0308309_1163635823300028906SoilMRTNRANKPCGYLLGSYRIATAPEPNSSRLTSRKSTCLDSP
Ga0302200_1030342313300028909BogMMRPTRANKSNGYLLGSYRIATAPEPNSSRLTSLKSTCFDS
Ga0247275_100648153300029817SoilMMRPTRANKPNGYLLGSYRIATAPEPNSSRPTGLKPIRF
Ga0311340_1027815623300029943PalsaMMRPTRVNKPNGYLLGSYRIATAPEPNSSRLTSLKSTCLDSPANYGGPVAH
Ga0311352_1028770823300029944PalsaMRPTRANKCNGYLLGSYRIATAPEPNSSRLTSLKSTCFD
Ga0311346_1094549613300029952BogVTVCRRGPDKLAGYLRGSYRIATAPEPNSSRLTSLKSIRFDN
Ga0311339_10014952113300029999PalsaMMQPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTHFDSP
Ga0302270_1024596813300030011BogMMRPIRANKPKGYLLGSYRIATAPEPNSSRLTSLKS
Ga0302282_122686423300030045FenMMRPIRANKPKGYLLGSYRIATAPEPNSSRLTSLKSIRFDSPANN
Ga0268240_1016205613300030496SoilMMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSCKSTY
Ga0311372_1307727613300030520PalsaMMLQTLVSKPNAYLLASYLIATAPEPYSSRLMNLKSTGFDSPANNVGP
Ga0311355_1005053843300030580PalsaMMRPARANKPNSYLLGSYRIATAPEPNSSRPTSLKSTWFDSPANNV
Ga0265461_1331861613300030743SoilMDHDAADLGMRPARANEPNGYLLGSYRIATAPEANSSRLKGLKSTCFD
Ga0299914_1033725033300031228SoilMMRPARASKPDGYLLGSYRIATAPEPNSSRFTSFKST
Ga0299913_1102758813300031229SoilMRATRASTPDGYLLGSYRIATTPERNSSRLTSFKSTCFDSPAN
Ga0170824_11513551413300031231Forest SoilMMRLTRANQPDGYVLGSYRIATAPERNSSRLTSFKS
Ga0302323_10344946423300031232FenMIRPTQATPDPYLLGSYRSATAPESNSYRLTSFKSTYF
Ga0302325_1007175383300031234PalsaMMRPTRANKPNGYLLGSYRIATAPEPNSSRPTSLKSTCFDSPANNV
Ga0302325_1102086533300031234PalsaMMWPTGANKPDGYLLGSYRIATAPEPNSNRLTSLKSTC
Ga0302326_1175222613300031525PalsaMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFDS
Ga0310686_10722030523300031708SoilMWRLGLNKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFDSPANN
Ga0310686_11821708913300031708SoilMMRPTRVNKPNGYLLGSYRSATAPEPNSSRLTSLKSTCFDSPANNV
Ga0307476_1070191713300031715Hardwood Forest SoilMRPARVSKPNGYLLGSYRIATAPELNSSRLTSLKS
Ga0310813_1122030813300031716SoilMMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSTRFD
Ga0307469_1094234523300031720Hardwood Forest SoilMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRFD
Ga0307469_1159290223300031720Hardwood Forest SoilMRPTRANKPDCYRLGSYRIATAPEPNSSRLTSFKSICLDSPANN
Ga0318502_1069780513300031747SoilMMRLTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIRFDSP
Ga0307477_1033641613300031753Hardwood Forest SoilMMRPTRANKPNGYLLGSYRMATAPEPNSSRLTSLKSIRFDSP
Ga0307475_1116392513300031754Hardwood Forest SoilMPELRVMRLTRANKPKGYLLGSYCSATAPEPNSSRL
Ga0318568_1053100323300031819SoilMMRLTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIRF
Ga0307473_1141769723300031820Hardwood Forest SoilMMRPTRANKPNGYLRGSYRIATAPEPNSSRLTSLKST
Ga0307410_1178873413300031852RhizosphereMRPTQANKPDGYLLGSYRIATAPEPNSSQLTSFKSTGFD
Ga0318520_1076010813300031897SoilMMRLTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIRFDSPANN
Ga0307406_1045874923300031901RhizosphereMMRPTRANKPDGYLLGSYRIATAPEPNSSWLTSLKST
Ga0307407_1013878013300031903RhizospherePTRANKPDGYLLGSYRIATAPEPNSSWLTSLKSTRFDSPANNVGP
Ga0306926_1026286943300031954SoilMMRLTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIR
Ga0310911_1021617113300032035SoilLAHRCGRLGANKPNFYLLGSYRIATAPEANSSRLTSLKSTRFDSPENNVGPWPA
Ga0318504_1054071123300032063SoilMRPTRANKSIGYLLGAYRIATAPEPNSSRLTSLKSTRFES
Ga0307415_10232233523300032126RhizosphereMMRPTRANKPDGYLLGSYRIATAPEPNSSWLTSLKSTRFDSPANNVGP
Ga0335084_1121130213300033004SoilMRPTRAGKPDGYLFGSYRIATAPKPNSGLLTSFKS
Ga0310914_1024079913300033289SoilMRPTGANKPNGYPLGSYRIDAAPAANSSRLTSLNSTGFDSPANNAG
Ga0310914_1147066913300033289SoilMVRPTRANNPDGYLVGSYRIATPEPNSSRLTSLKSTGFDSPANNVGPWPASLG
Ga0318519_1047667223300033290SoilMMRLTRAHKSDGYLLGSYRIATAPEPNSSRLTSFKSIGFDSP
Ga0316601_10108720713300033419SoilMRPTRSNMPHGYLLGSYRIATAPEPNSSRLTSFKSTCFD
Ga0316624_1035792813300033486SoilMMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRFDSPAN
Ga0316628_10069373333300033513SoilVSPALTPDGYLLGSYRIATTPEPNSCRLMSFKSRCFDSLENNVGR
Ga0316617_10239265923300033557SoilMMRPTPANKPDGYLLGSYRIATAPEPSSSRLTSFKSTR
Ga0334961_093439_2_1273300034143Sub-Biocrust SoilMMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSICFDSP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.