NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F031314

Metagenome Family F031314

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031314
Family Type Metagenome
Number of Sequences 182
Average Sequence Length 70 residues
Representative Sequence MNKIRRIDSFFEKKRKHIDNSQPSESTPMCNVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIRDPSNRPQI
Number of Associated Samples 21
Number of Associated Scaffolds 182

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 53.89 %
% of genes near scaffold ends (potentially truncated) 20.33 %
% of genes from short scaffolds (< 2000 bps) 42.31 %
Associated GOLD sequencing projects 21
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (51.648 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(82.967 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(78.022 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.47%    β-sheet: 0.00%    Coil/Unstructured: 73.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 182 Family Scaffolds
PF14291DUF4371 35.16
PF05699Dimer_Tnp_hAT 2.20
PF00665rve 1.10
PF03094Mlo 1.10
PF07727RVT_2 1.10
PF02537CRCB 1.10
PF13855LRR_8 0.55
PF00704Glyco_hydro_18 0.55
PF00501AMP-binding 0.55
PF00324AA_permease 0.55
PF00847AP2 0.55
PF13041PPR_2 0.55
PF00241Cofilin_ADF 0.55
PF001982-oxoacid_dh 0.55
PF00005ABC_tran 0.55
PF00067p450 0.55
PF13963Transpos_assoc 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 182 Family Scaffolds
COG0239Fluoride ion exporter CrcB/FEX, affects chromosome condensationCell cycle control, cell division, chromosome partitioning [D] 1.10
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.10
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.10
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.10
COG4584TransposaseMobilome: prophages, transposons [X] 1.10
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 0.55
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.55
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.55
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.55
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.55
COG2124Cytochrome P450Defense mechanisms [V] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.91 %
UnclassifiedrootN/A12.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028786|Ga0307517_10002555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta28980Open in IMG/M
3300028786|Ga0307517_10007277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa16180Open in IMG/M
3300028786|Ga0307517_10011409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa12312Open in IMG/M
3300028786|Ga0307517_10017438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta9362Open in IMG/M
3300028786|Ga0307517_10023448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7673Open in IMG/M
3300028786|Ga0307517_10034933All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5708Open in IMG/M
3300028786|Ga0307517_10039762All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci5153Open in IMG/M
3300028786|Ga0307517_10050390Not Available4233Open in IMG/M
3300028786|Ga0307517_10071054All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci3126Open in IMG/M
3300028786|Ga0307517_10071877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3093Open in IMG/M
3300028786|Ga0307517_10075453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2956Open in IMG/M
3300028786|Ga0307517_10082983Not Available2714Open in IMG/M
3300028786|Ga0307517_10087890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2576Open in IMG/M
3300028786|Ga0307517_10092286All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci2464Open in IMG/M
3300028786|Ga0307517_10100337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci2287Open in IMG/M
3300028786|Ga0307517_10124826All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1883Open in IMG/M
3300028786|Ga0307517_10186134All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1328Open in IMG/M
3300028786|Ga0307517_10284015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta941Open in IMG/M
3300028786|Ga0307517_10320910All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci857Open in IMG/M
3300028786|Ga0307517_10639848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta518Open in IMG/M
3300028794|Ga0307515_10002721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta37822Open in IMG/M
3300028794|Ga0307515_10049441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6326Open in IMG/M
3300028794|Ga0307515_10054325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5883Open in IMG/M
3300028794|Ga0307515_10061082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5356Open in IMG/M
3300028794|Ga0307515_10069054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4840Open in IMG/M
3300028794|Ga0307515_10070437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4759Open in IMG/M
3300028794|Ga0307515_10071444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4703Open in IMG/M
3300028794|Ga0307515_10072073All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci4670Open in IMG/M
3300028794|Ga0307515_10072410All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4651Open in IMG/M
3300028794|Ga0307515_10072955All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci4622Open in IMG/M
3300028794|Ga0307515_10077848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4371Open in IMG/M
3300028794|Ga0307515_10098454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3561Open in IMG/M
3300028794|Ga0307515_10109987All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci3230Open in IMG/M
3300028794|Ga0307515_10135721All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci2677Open in IMG/M
3300028794|Ga0307515_10156903All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci2343Open in IMG/M
3300028794|Ga0307515_10157264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2338Open in IMG/M
3300028794|Ga0307515_10202321Not Available1857Open in IMG/M
3300028794|Ga0307515_10382841Not Available1038Open in IMG/M
3300028794|Ga0307515_10517027Not Available803Open in IMG/M
3300028794|Ga0307515_10826510All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci551Open in IMG/M
3300030521|Ga0307511_10005900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta12379Open in IMG/M
3300030521|Ga0307511_10039166All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci4054Open in IMG/M
3300030521|Ga0307511_10047558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3507Open in IMG/M
3300030521|Ga0307511_10068721Not Available2613Open in IMG/M
3300030521|Ga0307511_10099665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1916Open in IMG/M
3300030521|Ga0307511_10150394All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1338Open in IMG/M
3300030521|Ga0307511_10184768All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1115Open in IMG/M
3300030521|Ga0307511_10269156All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci799Open in IMG/M
3300030521|Ga0307511_10273743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta787Open in IMG/M
3300030521|Ga0307511_10275341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum783Open in IMG/M
3300030522|Ga0307512_10035185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4273Open in IMG/M
3300030522|Ga0307512_10062554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2854Open in IMG/M
3300030522|Ga0307512_10132131All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1561Open in IMG/M
3300030522|Ga0307512_10142280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1464Open in IMG/M
3300030522|Ga0307512_10170888Not Available1246Open in IMG/M
3300030522|Ga0307512_10231192Not Available950Open in IMG/M
3300030522|Ga0307512_10338601All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci671Open in IMG/M
3300030522|Ga0307512_10348567All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci654Open in IMG/M
3300030522|Ga0307512_10421136All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci551Open in IMG/M
3300031456|Ga0307513_10019032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta8186Open in IMG/M
3300031456|Ga0307513_10035647All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5562Open in IMG/M
3300031456|Ga0307513_10057603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci4137Open in IMG/M
3300031456|Ga0307513_10078770All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci3407Open in IMG/M
3300031456|Ga0307513_10080213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3367Open in IMG/M
3300031456|Ga0307513_10092671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae3074Open in IMG/M
3300031456|Ga0307513_10200745Not Available1835Open in IMG/M
3300031456|Ga0307513_10222770All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1705Open in IMG/M
3300031456|Ga0307513_10247858All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1580Open in IMG/M
3300031456|Ga0307513_10287332All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1418Open in IMG/M
3300031456|Ga0307513_10305240Not Available1356Open in IMG/M
3300031456|Ga0307513_10308846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1344Open in IMG/M
3300031456|Ga0307513_10379491All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1153Open in IMG/M
3300031456|Ga0307513_10452842All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1007Open in IMG/M
3300031456|Ga0307513_11098316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta507Open in IMG/M
3300031507|Ga0307509_10039721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5124Open in IMG/M
3300031507|Ga0307509_10047232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4631Open in IMG/M
3300031507|Ga0307509_10049070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4529Open in IMG/M
3300031507|Ga0307509_10055290All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci4219Open in IMG/M
3300031507|Ga0307509_10074006All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci3545Open in IMG/M
3300031507|Ga0307509_10074393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3533Open in IMG/M
3300031507|Ga0307509_10109087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2779Open in IMG/M
3300031507|Ga0307509_10113966All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2699Open in IMG/M
3300031507|Ga0307509_10137317All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci2388Open in IMG/M
3300031507|Ga0307509_10165020All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci2105Open in IMG/M
3300031507|Ga0307509_10223080All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1695Open in IMG/M
3300031507|Ga0307509_10332735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1249Open in IMG/M
3300031507|Ga0307509_10362814All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1167Open in IMG/M
3300031507|Ga0307509_10375188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae1137Open in IMG/M
3300031507|Ga0307509_10376346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1134Open in IMG/M
3300031507|Ga0307509_10483720All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci925Open in IMG/M
3300031507|Ga0307509_10655299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci718Open in IMG/M
3300031616|Ga0307508_10007395All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10237Open in IMG/M
3300031616|Ga0307508_10035119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida4518Open in IMG/M
3300031616|Ga0307508_10054979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3527Open in IMG/M
3300031616|Ga0307508_10078067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2890Open in IMG/M
3300031616|Ga0307508_10118068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2254Open in IMG/M
3300031616|Ga0307508_10175317All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1747Open in IMG/M
3300031616|Ga0307508_10228926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1457Open in IMG/M
3300031616|Ga0307508_10336361Not Available1101Open in IMG/M
3300031616|Ga0307508_10393826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa976Open in IMG/M
3300031616|Ga0307508_10497130All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci814Open in IMG/M
3300031616|Ga0307508_10529278Not Available775Open in IMG/M
3300031616|Ga0307508_10608097All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci695Open in IMG/M
3300031616|Ga0307508_10855318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci531Open in IMG/M
3300031616|Ga0307508_10868063All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci525Open in IMG/M
3300031649|Ga0307514_10013466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6782Open in IMG/M
3300031649|Ga0307514_10020664All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5373Open in IMG/M
3300031649|Ga0307514_10051969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa3172Open in IMG/M
3300031649|Ga0307514_10106317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2002Open in IMG/M
3300031649|Ga0307514_10203429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1240Open in IMG/M
3300031649|Ga0307514_10393838Not Available711Open in IMG/M
3300031730|Ga0307516_10040844All Organisms → cellular organisms → Bacteria4614Open in IMG/M
3300031730|Ga0307516_10112663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2520Open in IMG/M
3300031730|Ga0307516_10163095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1977Open in IMG/M
3300031730|Ga0307516_10167940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1937Open in IMG/M
3300031730|Ga0307516_10236119All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1529Open in IMG/M
3300031730|Ga0307516_10260358All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1425Open in IMG/M
3300031730|Ga0307516_10356278All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1128Open in IMG/M
3300031730|Ga0307516_10359939All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1119Open in IMG/M
3300031730|Ga0307516_10639231All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci719Open in IMG/M
3300031730|Ga0307516_10652509All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci707Open in IMG/M
3300031730|Ga0307516_10675746All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci688Open in IMG/M
3300031730|Ga0307516_10682272All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci683Open in IMG/M
3300031730|Ga0307516_10706491All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci665Open in IMG/M
3300031730|Ga0307516_10707592All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci664Open in IMG/M
3300031838|Ga0307518_10072043All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci2502Open in IMG/M
3300031838|Ga0307518_10085508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2273Open in IMG/M
3300031838|Ga0307518_10214749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1262Open in IMG/M
3300031838|Ga0307518_10310999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa949Open in IMG/M
3300031838|Ga0307518_10314265All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci941Open in IMG/M
3300031838|Ga0307518_10414136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa743Open in IMG/M
3300032354|Ga0325403_1000702All Organisms → cellular organisms → Eukaryota25211Open in IMG/M
3300032354|Ga0325403_1000802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta24080Open in IMG/M
3300032354|Ga0325403_1001202All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta21107Open in IMG/M
3300032354|Ga0325403_1001534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae19357Open in IMG/M
3300032354|Ga0325403_1002556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa16210Open in IMG/M
3300032354|Ga0325403_1004468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida13011Open in IMG/M
3300032354|Ga0325403_1005363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta12078Open in IMG/M
3300032354|Ga0325403_1012108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales8160Open in IMG/M
3300032354|Ga0325403_1019556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6167Open in IMG/M
3300032354|Ga0325403_1025445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5153Open in IMG/M
3300032354|Ga0325403_1055967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2599Open in IMG/M
3300032355|Ga0325401_1026936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5153Open in IMG/M
3300032374|Ga0325400_1012109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8231Open in IMG/M
3300032374|Ga0325400_1012224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta8193Open in IMG/M
3300032389|Ga0325405_1000170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida61934Open in IMG/M
3300032389|Ga0325405_1004051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15042Open in IMG/M
3300032389|Ga0325405_1005266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13147Open in IMG/M
3300032389|Ga0325405_1007040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta11338Open in IMG/M
3300032389|Ga0325405_1007978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix10579Open in IMG/M
3300032389|Ga0325405_1014361All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7383Open in IMG/M
3300032389|Ga0325405_1016981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6609Open in IMG/M
3300032389|Ga0325405_1049792Not Available2537Open in IMG/M
3300032389|Ga0325405_1062196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1895Open in IMG/M
3300032390|Ga0325404_1048402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2563Open in IMG/M
3300032735|Ga0325410_1011861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9009Open in IMG/M
3300032740|Ga0325411_1013430All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8286Open in IMG/M
3300033179|Ga0307507_10030293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5710Open in IMG/M
3300033179|Ga0307507_10045284All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci4331Open in IMG/M
3300033179|Ga0307507_10198672Not Available1392Open in IMG/M
3300033179|Ga0307507_10258437All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1115Open in IMG/M
3300033179|Ga0307507_10266714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1086Open in IMG/M
3300033179|Ga0307507_10434537All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci731Open in IMG/M
3300033179|Ga0307507_10460543Not Available698Open in IMG/M
3300033180|Ga0307510_10005061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15635Open in IMG/M
3300033180|Ga0307510_10042779Not Available4932Open in IMG/M
3300033180|Ga0307510_10078374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3232Open in IMG/M
3300033180|Ga0307510_10116743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2389Open in IMG/M
3300033180|Ga0307510_10128154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2220Open in IMG/M
3300033180|Ga0307510_10196268Not Available1559Open in IMG/M
3300033180|Ga0307510_10213353All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1450Open in IMG/M
3300033180|Ga0307510_10287373All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci1112Open in IMG/M
3300033180|Ga0307510_10340047All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci953Open in IMG/M
3300033180|Ga0307510_10485591All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci677Open in IMG/M
3300033180|Ga0307510_10494519Not Available665Open in IMG/M
3300034389|Ga0325419_008069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta11328Open in IMG/M
3300034389|Ga0325419_032566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3991Open in IMG/M
3300034389|Ga0325419_049349Not Available2478Open in IMG/M
3300034389|Ga0325419_052788All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio ouci2269Open in IMG/M
3300034689|Ga0325421_014747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6878Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza82.97%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem14.29%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf2.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307517_10002555143300028786EctomycorrhizaMNKIRRIDFFFEKKRENIDNLQPSKPNPMCNIEVMVEQPQCTSVYKESTLISEQPLTRISIAHLIGNSSNHPQI
Ga0307517_10007277133300028786EctomycorrhizaLILFLKKKRKNIDNSQTSEPTPSNVEVMVEQPQCASVYKEPALISEQPLTRINIAHLIRDPSNCP
Ga0307517_1001140983300028786EctomycorrhizaMNKIKRIDSFFEKHRKNIDNSQPSELTLMFNVEVMVGQPQCTSVYVDPVLISEQPPTRIDIAHLIRDPSNRPQI
Ga0307517_1001743813300028786EctomycorrhizaFKKKRKNIDDSQPSKPTPMCNVEVMVEQPQCASVYKEPALISEQPFTRIDIAHLIRDPSNRPQI
Ga0307517_1002344883300028786EctomycorrhizaMNKIRRIDSFFEKKEKNIDNSQPSKSTSMCNVEVMVQQPQCASVYEEPALINEQPPTKIDIAHLIRDPSNRPQI
Ga0307517_1003493323300028786EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQSSEPTPMCNVEVMVEQPQCASVYEEPALISEQPPTRIDIAHSIRDPSNRP
Ga0307517_1003976263300028786EctomycorrhizaLIFFKKKNIDNSQPSEPTPICNVEVMVEQPQYASIYKESALITSEQPLTRIDIAHLIRDSCNHPQI
Ga0307517_1005039043300028786EctomycorrhizaLILFLKKKRKNIDNSLPSEPTPMCNVEVMVEQPQCASVYKEPALISEQPLTRIDIAHLIRDPSNRPQI
Ga0307517_1007105413300028786EctomycorrhizaLILFFFEKKRTNIDNSQPSEPIPMCIVEVMVEQPQCASVYEEPTLISEQPFTKIDIAHLIRNPSNRPQI
Ga0307517_1007187763300028786EctomycorrhizaFFLKKKKNIDNSQPSEPTPMCNVEVMVEQPQCASVYKEPALISEQSLTRINIAHLIRDLSNRPQI
Ga0307517_1007545353300028786EctomycorrhizaMNKIRRIDSFVEKKRTNIGNSQPSEPTPMCNVEVMVEQPQCASVYEEPTLISEQSLTRIDIAHLLRDPSNCPQILGILG
Ga0307517_1008298323300028786EctomycorrhizaMNKIRRIDSFFEKKNIDNSQSSEPTPMCNVEIMVKQPQCASVYKELALISEQPLTRIDITHFN
Ga0307517_1008789023300028786EctomycorrhizaLRKKGKKIDNSQPSESTPMCNVEVMVEQPQRASVYEKPALINEQPPTRINIAHLIIDPSNRP
Ga0307517_1009228623300028786EctomycorrhizaLKKKINIDNSQSSEPTPMCNVKVIVDQPQCASIFKEPALISEQPLTTIDIAHLIRDPSNRPQI
Ga0307517_1010033713300028786EctomycorrhizaMNKIKIIDSFLKKKYINDSQPSEPTLLCHVEVMVEQPQCALIYKESALISEQPLTRIDIAHLIRDPSNCPQI
Ga0307517_1012482613300028786EctomycorrhizaMNKIRRIDSFFEKKKEKNIDNSQPSESTPMCNVEVMVEQPQCALVYEEPALINEKPPTRINVAHLIIDPSNRP
Ga0307517_1018613433300028786EctomycorrhizaLKKKRKNIDNSQSSEPTPMCNVKVIVDQPQCASVFKEPALISEQPLTTIDIAHLIRDPSNRPQI
Ga0307517_1028401513300028786EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSETTLMCNVEVMVEQPQCASVYEEPTLTSEPTPTRIDIAHLIRDPSNRPQI
Ga0307517_1032091013300028786EctomycorrhizaMNKIRRINSFFEKKREKNIDNSQPSEPTPSIVEVMVEQPQCASVYKEPALITEQPLTRIDIAHLIRDPSNCPQI
Ga0307517_1063984813300028786EctomycorrhizaTIKIYDVLILGXTMNKIRRIDSFFEKKRKNIDNSQPSESTPICNVEVIVEQPKCASVYEEPALINEQPPTRIDTAHLIRDQSNHPQI
Ga0307515_10002721153300028794EctomycorrhizaMNKIRRIDFFFEKKRENIDNLQPSKPNPMCNIEVMVEQPQCASVYKESTLISEQPLTRINIAHLIGNSSNHPQI
Ga0307515_1004944113300028794EctomycorrhizaMNKIRRIDFFLKKKKNIDNSQPSEPTPMCNVEVMVEQPQCASVYKEPALISEQSLTRINIAHLIRDLSNRPQI
Ga0307515_1005432523300028794EctomycorrhizaLIIFFEKKKTNIDNSQPSEPTPMYNVEVMVEQPQCALVYEEPVLISVQPLTRIDIAHLLRDPSNRPQI
Ga0307515_1006108243300028794EctomycorrhizaMNKIRRIDFFFEKKRKNINNSQPSEPTLMCNVEVMVEQPQCASVYEEPTLISEQPPTRIDIAHLIRNPSNRP
Ga0307515_1006905473300028794EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSEPTLMCNVEVMVEQPQCASVYEEPTLTSEPTPTRIDIAHLIRDPSNRPQI
Ga0307515_1007043753300028794EctomycorrhizaLILFLEKKKKNIDNSQPSEPTSMCNVEVMVEQPQCASIYGELALISEQPPTKIDIAHLIRDPSNYPQI
Ga0307515_1007144413300028794EctomycorrhizaMNKIIRIDSFFEKKIYIYIDNSQPCEPTPMCNVEVMVEQPQCASIYRESTLISEQPLTRIDITYLIRNPSNRPQI
Ga0307515_1007207313300028794EctomycorrhizaMNKIRRIDFFFEKNRTNIDNSQPRGPTPMCNVEVMVEQPQSASVYEEPTLISEQPLTRIDIAHLIRDPNNR
Ga0307515_1007241023300028794EctomycorrhizaMNKIKRIDFFLKKKRKNIDNSQSSEPTPSNVEVMVEQPQYASVYKEPALISEQPLTTIDIAHLIRDSSNRPQI
Ga0307515_1007295513300028794EctomycorrhizaMNKIKRIDFFFEKKNIDDSQRSEPTPMCNVEVMVKQPQCASIYKKSALISEQPLTRIDIAHLIRDPSNHPQI
Ga0307515_1007784863300028794EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSETTLMCNVEVMVEQPHCTSVYEEPELTSEPPLTKINIAHLIRDPDNHPQI
Ga0307515_1009845413300028794EctomycorrhizaMSKIRRIDSFLEKKRKNIDNSQPSEPTPSNVEVMVKQPQCASVYKESALISEQPLTRIDIAHLIRDPSNRPQIWEYPVNQ
Ga0307515_1010998713300028794EctomycorrhizaLILFLKKKRKNIDNSQPSEPTPICNVEVMVEQPQCASIYRESTLISEQPLTRIDITYLITNPSNRPQI
Ga0307515_1013572123300028794EctomycorrhizaLKKKTIDNSQSSEPTPMCNVKVIVEQPQCASVYKEPALISEQHLTTIDIAHLIRDPSNRPQI
Ga0307515_1015690323300028794EctomycorrhizaLKKNIYDSQPNEPAPMCNVEVMVEQPQCASIYKKSALISEQPLTRIDIAHLIKDPSNHPQ
Ga0307515_1015726433300028794EctomycorrhizaMNKIRRNDSFFLKKRKNIDDSQPSEPTPMCNVEVMVEQPQCASVYKEPALISEQPLFRIDIAHLIRDPSNRP
Ga0307515_1020232123300028794EctomycorrhizaLILFLKKKRKNIDNSQPSEPTPSNVEVMVEQPQCASVYKEPALISEQPLTRIDIAHLIRDPSNRHQI
Ga0307515_1038284123300028794EctomycorrhizaNIDNSQPSETTLMCNVEVMVEQPHCTSVYEEPELTSEPPLTKINIANLIRDPDNHPQI
Ga0307515_1051702723300028794EctomycorrhizaMSKIRRIDSFFEKKKFDNSQPSEPTPSNVEVMVEQPQCASVYKEPALINEQPLTRIDIAHLIRDPSNRP
Ga0307515_1082651013300028794EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQSSEPTPMCNVKVIVDQPQCASVFKEPALISEQPLTTIDIAHLIRDPSNRPQI
Ga0307511_1000590083300030521EctomycorrhizaLIFFFEKKRENIDNLQPSKPNPMCNIEVMVEQPQCASVYKESTLISEQPLTRINIAHLIGNSSNHPQI
Ga0307511_1003916613300030521EctomycorrhizaLKKKIDDSQPSEPTPMCNVEVMVEQLQCVSIYKKSALISEQPLTRIDIAHLIRDPSNHPQ
Ga0307511_1004755813300030521EctomycorrhizaLIIFFEKKKTNIDNSQPSEPTPMCNVEVMVEQPQCALVYEEPVLISVQPLTRIDIAHLLRDPSNRPQI
Ga0307511_1006872113300030521EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSEPTPMCNVEVMVEQPQCASVYEEPALISEQPPTRIDIAHSIRDQSNRP
Ga0307511_1009966513300030521EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSETTLMCNVEVMVEQPHCTSVYEEPELTSEPPLTKINIANLIRDPDNHPQI
Ga0307511_1015039413300030521EctomycorrhizaLILFLKKKRKNIDNSQSSEPTPMCNVKVIVDQPQCASVFKEPALISEQPLTTIDIAHLIRDPSNRPQI
Ga0307511_1018476813300030521EctomycorrhizaLILFLKKKRKNIDNSQPSKPTPICNVEVMVEQPQCASIYRESTLISEQPLTRIDITYLITNPSNRPQI
Ga0307511_1026915613300030521EctomycorrhizaMNKIRRIDSFFEKKNIDDSQPSEPTPMCNVEVMVEQPQCASIYKESVLITSEQPLTRIDIAHLIRDPSNHPQI
Ga0307511_1027374313300030521EctomycorrhizaLKKKRKNIDNSQTSEPTPSNVEVMVEQPQCASVYKEPALISEQPLTRINIAHLIRDPSNC
Ga0307511_1027534123300030521EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSEPTPMCNVEVMVEQPQCASVYEEPALTSEPPPTRIDIAHLIRDPSNRPQIWEYPVNQQDEI
Ga0307512_1003518523300030522EctomycorrhizaMNKIRRIDSFVEKKRTNIDNSQPSEPTPMCNVEVMVEQPQCASVYEEPTLISEQSLTRIDIAHLLRDPSNCPQILGILG
Ga0307512_1006255453300030522EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQTSEPTPSNVEVMVEQPQCASVYKEPALISEQPLTRINIAHLIRDPSNCP
Ga0307512_1013213113300030522EctomycorrhizaLILFLKKKYIYIDNSQPCEPTPMCNVEVMVEQPQCASIYRESTLISEQPLTRIDITYLIRNPSNRPQ
Ga0307512_1014228013300030522EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSETTLMCNVEVMVEQPHCTLVYEEPTLTSEPPLTKINIAHLIRDPDNHPQI
Ga0307512_1017088823300030522EctomycorrhizaLIFFKKKNIDDSQPSESTPMCNVQVMAEQPQCASIYKESALISEQPLTRIDIAHLIRDPSNRS
Ga0307512_1023119213300030522EctomycorrhizaMNKIRRIDFFFLKKKKNIDNSQPSEPTPMCNVEVMVEQPQCASVYKEPALISEQSLTRINIAHLIRDLSNRPQI
Ga0307512_1027112333300030522EctomycorrhizaDNSQPSEPTPMCNVEVMVEQPQCASVYEEPALISVQPLTRIDIAHLLKDPSNRPQI
Ga0307512_1033860113300030522EctomycorrhizaLIFFKKKKRENIDNLQPSKPNPMCNIEVMVEQPQCASVYKESTLISEQPLTRINIAHLIGNSSNHPQI
Ga0307512_1034856713300030522EctomycorrhizaMNKIKRIDSFVEKKRTNIDNSQPSEPTPMCNVEVMVGQPQCASVYEEPTLISEQPLTRIDIAHLIRDPSNRHQI
Ga0307512_1042113613300030522EctomycorrhizaMNKIXRIDSFFEKKRKNIDNSQPSESTSMCDVEVMVEQPQCASVHEEPALINEQPPTRIDIAHLIR
Ga0307513_1001903223300031456EctomycorrhizaMNKIRRIDFFFEKHRTNIDNSQPRGPTPMCNVEVMVEQPQSASVYKEPTLISEQPLTRIDIAHLIRDPSNRXGIPG
Ga0307513_1003564783300031456EctomycorrhizaMNKIRRIDFFFEKKRTNIDNSQPSEPTPMCNVEVMVVQPQCASVYEEPALISVQPLTRIDIAHLLKDPSNRPQI
Ga0307513_1005760323300031456EctomycorrhizaMNKIRRIDFFFLKKNIDDSQPSEPTPMCNVEVMVEQPQCASIYKESVLITSEQPLTRIDIAHLIRDPSNHSQI
Ga0307513_1007877023300031456EctomycorrhizaMNKIRRIDFFFLKKNIDNSQPSEPTPICNVEVMVEQPQYASIYKEFALITSEQPLTRIDIAHLIRDSCNHPQI
Ga0307513_1008021353300031456EctomycorrhizaLILFFEKKKEKNIDNSQPSEPTSTCNVEVMVEQPQCASIYGELALISEQPPTKIDIAHLIRDPSNHPQI
Ga0307513_1009267133300031456EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSEPTPMCNVEVMVEQPQCASVYEEPALTSEPPPTRIDIAHLIRDPSNRPQIWEYPVNQHDEI
Ga0307513_1020074523300031456EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSESTPICNVEVIVEQPQCASVYEEPALINEQPPTRIDTAHLIRDPSNHPQI
Ga0307513_1022277013300031456EctomycorrhizaFXKKNIYDSQPSEPTPMCNVEVMVEQPQCASIYKKSELISEQLLTRIDIAHLIRNPSNHPQI
Ga0307513_1024785813300031456EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSESTPMYNVEVMVEQPQCASVYEEPALINEQPPTRIDIVHLIRDPSNRPQIWEYPV
Ga0307513_1028733213300031456EctomycorrhizaMNKIRRIDSFLKKKNIDDSQPSEPTPICNVEVMVEQPQYASIYKESVLITSEQPLTRIDIAHLIRDSCNHPQI
Ga0307513_1030524023300031456EctomycorrhizaMNKIXRIDSFFEKKRKNIDNSQPSESTSMCDVEVMVEQPQCASVHEEPALINEQPPTRIDIAHLIRDPSNRPQI
Ga0307513_1030884623300031456EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSESTPMCNVEVIVEQPQCASVYEEPALINEQPPTRIDTAHLIRDPNNRPQI
Ga0307513_1037949123300031456EctomycorrhizaMNKIKRIDSFLKKKYIDDSQPSEPILMCNVEVMVEQPQYALIYKESALISEQPLARIDIAYLIRDPSNRP
Ga0307513_1045284213300031456EctomycorrhizaMNKIKRIDSFVEKKRTNIDNSQPSEPTPMCNVEVMVGQPQCASVYEEPTLISEQPLTRIDIAHLIRDPSNRPQIWE
Ga0307513_1109831623300031456EctomycorrhizaLILFLKKKRKNIDTSQPSEPTPSNVEVMVEQPQCASVYKEPALISEQPLTRIDIAHLIRDPSNRPQI
Ga0307509_1003972183300031507EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSEPTLMCNVEVMVEQPQCASVYEEPTLTSEPTPTRIDIAHLIIDPSNRPQI
Ga0307509_1004723223300031507EctomycorrhizaLIIFFEKKRENIDNLQPSKPNPMCNIEVMVEQPQCASVYKESTLISEQPLTRINIAHLIGNSSNHPQI
Ga0307509_1004907033300031507EctomycorrhizaMNKIRRIDFFFEKKRKNINNSQPSEPTLMCNVEVMVEQPQCASVYEEPTLISEQPPTRIDIAHLIKNPSNRP
Ga0307509_1005529023300031507EctomycorrhizaLILFFFEKKRTNIDNSQPSEPIPMCIVEVMVEQPQCASVYEEPTLISEQPFTRIDIAHLIRNPSNRPQI
Ga0307509_1007400643300031507EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQLSEPTPSNVEVMVEQPLCASVYKEPALISEQALTRIDIAHLIRDPSNRPQIWEYPV
Ga0307509_1007439313300031507EctomycorrhizaMNKIRRIDSFYEKKRTNIDNSQLSESTPIYDVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIIDPSNHP
Ga0307509_1010908743300031507EctomycorrhizaMNKIRRIDFFFEKKRKNIDNSQPSESTPMCDVEVMVEQSRCASVYEEPALINEQPPTRIDIAHLIRDPSNHP
Ga0307509_1011396623300031507EctomycorrhizaLILFFEKKRKNIDDSQPSKPTPMCNVEVMVEQPQCASVYKEPVLISEQPLTRIDFAHLIRDPSNDPQI
Ga0307509_1013731713300031507EctomycorrhizaMNKIKIIDSFLKKKYIDDSQPSEPTLLCHVKVMVEQPQCALIYKESALISEQPLTRIDIAHLIRDPSNCP
Ga0307509_1016502013300031507EctomycorrhizaMNKIKRIDFFLKKKYIDDSQPNEQTLMCNVEVMVEQPQCALIYKESALIGEQPLTRIDIAHLIRDPSNRPQI
Ga0307509_1022308013300031507EctomycorrhizaLILFLKKNIDDSQPSEPTPICNVEVMVEQPQYASIYKESALITSEQPLTRIDIAHLIRDSCNHPQI
Ga0307509_1033273533300031507EctomycorrhizaMNKIRRIDFFFEKKRTNIDNSQPSEPTPMCNVEVMVEQPQCASVYEEPALISVQPLTRIDIAHLLKDPSNRPQI
Ga0307509_1036281413300031507EctomycorrhizaMNKIRRIDFFFEKKRKNIDNSQPSESTPMCNVEVIVKQPQCASVYEEPALINEQPPTRIDTAHLIRDPSNRPQIWEYPVNQQDEI
Ga0307509_1037518813300031507EctomycorrhizaMNKIRRIDSFYEKKRKNIDNSQPSESTPICDVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIIDPSNHPQI
Ga0307509_1037634633300031507EctomycorrhizaKNIDNSQPSELTLMFNVEVMVGQPQCTSVYVDPVLISEQPPTRIDIAHLIRDPSNRPQI
Ga0307509_1048372023300031507EctomycorrhizaKKNXFFLKKKYIDDSQPNEPTLMCNVEVMVEQPQCALIYKESALIGEQPLTRIDIAHLIRDPSNRSQI
Ga0307509_1065529913300031507EctomycorrhizaMNKIRRIDSFFEKKKEKNIDNSQPSESTPMCNVEVMVEQPQCASVYEEPALINEQPPTRINVAHLIIDPSNRP
Ga0307508_1000739533300031616EctomycorrhizaLKKNIYDSQPSEPTPMCNVEVMVEQPQCASIYKKSELISEQPLTRIDIAHLIRNPSNHPQ
Ga0307508_1003511913300031616EctomycorrhizaLIFFFVEKKRINIDNSQLSEPIPICIVEVMVEQPQCVSVYKEPTLISEQPLTRIDIAHLIRNPSNCPQI
Ga0307508_1005497913300031616EctomycorrhizaFFEKKKENIDNLQPSKPNPMCNIEVMVEQPQCASVYKESTLISEQPLTRINIAHLIGNSSNHPQI
Ga0307508_1007806713300031616EctomycorrhizaIDFFLKKKKNIDNSQPSEPTPMCNVEVMVEQPQCASVYKEPALISEQSLTRINIAHLIRDLSNRPQI
Ga0307508_1011806823300031616EctomycorrhizaMNKIRRIDSFFEKKRKHIDNSQPSESTPMCNVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIRDPSNRPQI
Ga0307508_1017531723300031616EctomycorrhizaMNKIRRIDSFFKKKNIDDSQPSEPTPICNVEVMVEQPQYASIYKESVLITSEQPLTRIDIAHLIRDSCNHPQI
Ga0307508_1022892613300031616EctomycorrhizaLILFFRKKKKNIDNSQPSEPTSMCNVKVMVEQPQCASIYGELALISEQPPTKIDIAHLIRDPSNHPQIXKYLV
Ga0307508_1033636133300031616EctomycorrhizaMNKIRRIDSFFEKKRKTIDNSQSSEPTPMCNVKVIVEQPQCASVYKEPALISEQHLTTIDIAHLIRDPSNHPQI
Ga0307508_1039382613300031616EctomycorrhizaIDNSQLSESTPIYDVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIIDPSNHP
Ga0307508_1049713023300031616EctomycorrhizaMNKIRRIVSFFEKKNIDNSLSSEPTPMCNVKVIVEQPQCASVYKEPELISEQPLTMIDIAHLIRDPSNRPQIWEYPVNQQDEI
Ga0307508_1052927813300031616EctomycorrhizaFNTSSFVFIFKTGNYDVLILGXTMNKIKRIDSFFEKHRKNIDNSQPSELTLMFNVEVMVGQPQCTSVYVDPVLISEQPPTRIDIAHLIRDPSNRPQI
Ga0307508_1060809713300031616EctomycorrhizaMDKIRRINCFFEKKNIDDSQPNESTPMFNVEVMVEQPQCLSIYKEFVLISEQPLTRIDIAHLIRDPSNRP
Ga0307508_1085531823300031616EctomycorrhizaLILFKKKNIDDSQPSEPTPICNVEVMVEQPQYASIYKESALITSEQPLTRIDIAHLIRDSCNHPQI
Ga0307508_1086806313300031616EctomycorrhizaLILFFFEKKRTNIDNSQPSEPIPMCIVEVMVEQPQCASVYEEPTLISEQPFTRIDIAHLIRNSSNRPQI
Ga0307514_1001346663300031649EctomycorrhizaMNKIRRIDSFFGKKRKNIDNSQFSEPTPSNVEVMVEQPLCVSVYKEPALISEQPLTRIDIAHLIRDPSNRPQI
Ga0307514_1002066443300031649EctomycorrhizaLILFFEKKRKNIDNSQPSEPTPMCNVEVMIEQPQCASVYEEPALICEQPPTRIDIAHSIRDPSNRP
Ga0307514_1005196913300031649EctomycorrhizaMNKIRRINSFFEKKREKNIDNSQPSEPTPSIVEVMVEQPQCASVYKEPALITEQPLTRIDIAHLI
Ga0307514_1010631723300031649EctomycorrhizaMNKIRRIDPFFEKKRKNIDNSQPSEPTPICNVEVLVEQPQCVSVYKEPALISEQPFTRINIAHLIRDPSNRPQI
Ga0307514_1020342913300031649EctomycorrhizaMNKIRRIDFFFEKKRKNIDNSQPSESTPICNVEVIVEQPKCASVYEEPALINEQPPTRIDTAHLIRDQSNHPQI
Ga0307514_1039383813300031649EctomycorrhizaRKNIDNSQPSELTLMFNVEVMVGQPQCTSVYVDPVLISEQPPTRIDIAHLIRDPSNRPQI
Ga0307516_1004084413300031730EctomycorrhizaLILFLKKKRKNIDNSQHSKPTPICNVEVMVEQPQCASIYKESTLISEQPLTRIDITYLIRNPSNRPQI
Ga0307516_1011266313300031730EctomycorrhizaLILFFKKKKNIDNSQPSEPTPICYVEVMVKQLQCASIYKEPALISKQPLTRINIALIRDPSNRPQI
Ga0307516_1013891413300031730EctomycorrhizaIDNSLSSEPTPMCNVKVIVEQPQCASVYKEPELISEQPLTMIDIAHLIRDPSNRPQIWEYPVNQQDEI
Ga0307516_1016309553300031730EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSETTLMCNVEVMVEQPQCTSVYEEPALTSEPPLTKINIAHLIRDPDNHPQI
Ga0307516_1016794013300031730EctomycorrhizaLKKKYIDDSQPNEPTLMCNVEVMVEQPQCALIYKESALIGEQPLTRIDIAHLIRDPSNRSQI
Ga0307516_1023611913300031730EctomycorrhizaLKKNIYDSQPNEPAPMCNVEVMVEQPQCASIYKKSALISEQPLTRIDIAHLIKDLSNHPQ
Ga0307516_1026035813300031730EctomycorrhizaMNKIRRIDSFFGKKRKNIDNSQPSEPTPSNVEVMVEQPLCASVYKEPALISEQPLTRIDIAHLIRDPSNRPQI
Ga0307516_1035627813300031730EctomycorrhizaLILFLKKKRKNIDNSQPSEPTPICNVEVMVEQPQCASIYRESTLISEQPLTRIDITYLIRNPSNR
Ga0307516_1035993913300031730EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSESTPMCNVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIRDPSNRPQIWEYPIN
Ga0307516_1063923113300031730EctomycorrhizaLILFFFEKKRTNIDNSQPSEPIPMCIVEVMVEQPQCASVYEEPTLISEQPLTRIDIAHLIKNPSNRP
Ga0307516_1065250913300031730EctomycorrhizaMNKIRRIDFFLKKKKNIDNSQPSEPTPMCNVEVMVEQPQCASVYKEPALISEQSLTRINIAHLI
Ga0307516_1067574613300031730EctomycorrhizaLILFLKKNIDDSQPSEPTPICNVEVMVEQPQYASIYKESALITSEQPLTRIDIAHLI
Ga0307516_1068227213300031730EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSEPTPSNVEVMVEQPLCASVYKEPALISEQPLTRIDIAHLIRDPSNRP
Ga0307516_1070649113300031730EctomycorrhizaLILFFEKKRKNIDDSQPSKPTTMCNVEVMVEQPQCASVYKEPVLISEQPLTRIDFAHLIRDPS
Ga0307516_1070759213300031730EctomycorrhizaLILFFEKKRKNIDDSQPSKPTPMCNVEVMVEQPQCASVYKEPVLISEQPLTRIDFAHLIRDPS
Ga0307518_1007204323300031838EctomycorrhizaVGPPHSKYVRRSFFEKKRKNIDNSKPSETTPMCNVEVMVEQPQYASVYEEPALTSEPPITRIDIAH
Ga0307518_1008550813300031838EctomycorrhizaMNKIRRIDFFFEKKRKNINNSQPSEPTLMCNVEVMVEQLQCASVYEEPVLISEQPPTRIDIAHLIRDPSNRPQI
Ga0307518_1021474913300031838EctomycorrhizaKNNDNSQPSKPTPICNVEVMVEQSQCASAYEEPALTSEPPPTRIDIAHLIRDPSNRPQI
Ga0307518_1031099933300031838EctomycorrhizaFEKKRTNIDNSQPSEPTPMCNVEVMVVQPQCASVYEEPALISVQPLTRIDIAHLLKDPSNRPQI
Ga0307518_1031426523300031838EctomycorrhizaLKKERKNIDNSQSSEPTPMCNVKVIVDQPQCASVFKEPALISEQPLTTIDIAHLIRDPSNRPQI
Ga0307518_1041413613300031838EctomycorrhizaKNNDNSQPSKPTPICNVEVMVEQSQCASAYEEPALTSEPPPTIIDIAHLIRDSSNRPQI
Ga0325403_1000702113300032354XylemMNKIRRIDSFFEKKNIDDSQPSEPTPMCNVEVMVEPPQCASIYKKSALISEQPLTKIDIAHLIRDPSNHPQI
Ga0325403_1000802123300032354XylemLILFFEKKRKNIDNSQPSEPTPNNVEVMVEQSQCASIYKEPTLISEQPLTRINIAHLIRDLSNHL
Ga0325403_100120223300032354XylemMNKIRRIDSFFEKKRKNIDNSQRSEPTPMCNVEVMVEQPQCASVYEEPTLTSELPHTRIDIAHLIRDPSNHPQI
Ga0325403_1001534113300032354XylemMNKIRRINSFFEKKNIDDSQPSEPTPMCNVEIMVKQPQCASIYKESALISEQPLTRINIAHLIRDPSNRPQI
Ga0325403_100255653300032354XylemMNKIRRIDSFFEKKRKSIDNSQPSEPTPNNVEVMVEQSLCASVYKEPALINEQPLTRIDIAHLIRDPSNRPQI
Ga0325403_100446883300032354XylemMNKIRRIDSFFFKKRKNIDNSQPSEPTPSNVEVMVEQPQCASVYKELALISEQPFTRIDIAHLLEIQAVILKFGNTWLINKMKFKGHTLIWGHINL
Ga0325403_100536343300032354XylemMNKIRRIDFFFEKKRKNIDNSQPSEPTPNNVEVMVEQPLCASVYKEPALISEQPLTRIDIAHLIRDPSNPGLFMCPIIQS
Ga0325403_101210873300032354XylemMNKIKRIDSFYEKKRKNIDNSQPSELTLMFNVEVMVRQPQYASVYEDPVLINEQPSTRIDIANLIRDPSNRP
Ga0325403_101955613300032354XylemMNKIRRIDSFFQKKRKNIDNSQPSEPTPNNVEVMVEQPLCASVYKKPALISEQPLTRIDIAHLIRDPSNRPQI
Ga0325403_102544573300032354XylemMNKIRRIESFFKKKRKNIDNSQPNESTPMYNVEVMVEQLQCASVYEERALINEQPPTRIDIAHLIRDSSNRPQI
Ga0325403_105596753300032354XylemMNKIRRIDSFFEKKRKNIDNSQSQPSELTPMCNVEVMVEQPQCASVYEKPALTSEPPPTRIDIAHLIRDPSNRPQINKMKFKGHTLIWGHINF
Ga0325401_102693673300032355XylemMNKIRRIESFFKKKRKNIDNSQSNESTPMYNVEVMVEQLQCASVYEERALINEQPPTRIDIAHLIRDSSNRPQI
Ga0325400_101210913300032374XylemIRRIDSFFEKKRKNIDNSQRSEPTPMCNVEVMVEQPQCASVYEEPTLTSELPHTRIDIAHLIRDPSNHPQI
Ga0325400_101222423300032374XylemLILFFEKKRKNIDDSQPSKPTPMCNVEVMVEQPQCALVYKEPVLISEQPLTRIDFAHLIRDPSNDPQI
Ga0325405_1000170223300032389XylemLIFFFEKKRKNIDNSQPSEPTPNNVEVMVEQPLCASVYKEPALISEQPLTRIDIAHLIRDPSNPGLFMCPIIQS
Ga0325405_100405173300032389XylemMKKIRRIDSFFEKKRKNIDNSQRSEPTPMCNVEVMVEQPQCASVYEEPTLTSELPHTRIDIAHLIRDPSNRPQI
Ga0325405_100526633300032389XylemMNKIRRIDSFFEKKRKSIDNSQPSEPTPNNVEVMVEQPLCASVYKEPALINEQPLTRIDIAHLIRDPSNRPQI
Ga0325405_100704023300032389XylemLILGXTMNKIRRIDSFFEKNRKNIDNSQPSESTLICNVEVMVKQPQCASVYEEPALINEQPPTRIDIAHLSRDLSNRPQI
Ga0325405_100797873300032389XylemMNKITRIDSFFLKKRKNIDDSQPSKPTPMCNVEVMVEQPQCALVYKEPVLISEQPLTRIDFAHLIRDPSNDPQI
Ga0325405_101436193300032389XylemLKKKNIDNSQSSEPTPMWNVKVIVDQPQCASVFKEPALISEQPLTTIDIAYLIRDPSNRPQI
Ga0325405_101698113300032389XylemLRKKKRKNIDNSQPSGPTPMCTVEVMVEQPQCASVCEEPALISEQPPTRIDIAHVIRDPSNRPQI
Ga0325405_104979213300032389XylemMNKIRRIDSFFEKKRKNINNSQPSEPTPMCNVKVMVGQPQCALVYKEPALISEQPLTRIDIAHLIRDLSNCPQI
Ga0325405_106219633300032389XylemMNKIRRIDFFLKKRKNNDNLQPSEPTPMCNVEVMVEQPQYASVYEEPALTSEPPPTRIDIAHLIRDPSNHPQI
Ga0325404_104840213300032390XylemMNKIRRIDSFFEKKRKNIDNSQSQPSELTPMCNVEVMVEQPQCASVYEKPALTREPPPTRIDIAHLIRDPSNRPQINKMKFKGHTLIWGHINF
Ga0325410_101186163300032735XylemMNKIRRIDSFFFNKKKNIDNSQLREPTSMCNVEVMVEQPQYASIYGELALISEQPPTKIDIAHLIRNPSNHP
Ga0325411_101343043300032740XylemLILFFKKKKKNIDNSQPREPTSMCNVEVMVEQPQYASIYGELALISEQPPTKIDIAHLIRNPSNHP
Ga0307507_1003029353300033179EctomycorrhizaMNKIRRIDSFFRKKKKNIDNSQPSEPTSMCNVEVMVEQPQCASIYGELALISEQPPTKIDIAYLIRDPSNYPQI
Ga0307507_1004528413300033179EctomycorrhizaMNKIIRIDSFFFEKKRTNIDNSQPSEPIPMCIVEVMVEQPQCASVYEEPTLISEQPFTRIDIAHLIRNPSNRPQI
Ga0307507_1019867223300033179EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSEPTPSNVEVMVEQLLCASVYKEPALISEQPLTRIDIAHLIRDPSNRPQI
Ga0307507_1025843723300033179EctomycorrhizaLKKKINIDNSQSSEPTPMCNVKVIVDQPQCASVFKEPALISEQPLTTIDIAHLIRDPSNRPQI
Ga0307507_1026671413300033179EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSESTPMCNVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIRDPSNRPQIWEYPINQQDE
Ga0307507_1043453713300033179EctomycorrhizaLILFFEKKRKNIDDSQPSKPTPMCNVEVMVEQPQCASVYKEPVLISEQPLTRIDFAHLIRDPSNDPQIXEYPVNQ
Ga0307507_1046054313300033179EctomycorrhizaKKRKNIDNSQPSESTPMCNVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIRDPSNRPQI
Ga0307510_1000506123300033180EctomycorrhizaMNKIRRIDSFFEKKRKNIDNSQPSEPTPSNVEVIVEQPLCASVYKEPALISEQPLIRIDIAHLIRDPCNHPQI
Ga0307510_1004277913300033180EctomycorrhizaMNKIKIIDSFLKKKYIDDSQPSEPTLLCHVEVMVEQPQCALIYKESALISEQPLTRIDIAHLIRDPSNCPQI
Ga0307510_1007837413300033180EctomycorrhizaLIFFFEKKKENIDNLQPSKPNPMCNIEVMVEQPQCASVYKESTLISEQPLTRINIAHLIGNSSNHPQI
Ga0307510_1011674363300033180EctomycorrhizaKNINNSQPSEPTLMCNVEVMVEQPQCASIYEEPALISEQPPTRIDIAHLIRDPSNRPQI
Ga0307510_1012815443300033180EctomycorrhizaLIPFLKKKKKRKNIDDSQPSKPTPMCNVEVMVEQPQCASVYKEPALISEQPFTRIDIAHLIRDPSNRPQI
Ga0307510_1019626823300033180EctomycorrhizaMNKIRRIDFFFEKKRKNIDNSQPSEPTPNNVEVMVEQPLCASVYKEPALISEQPLTRIDIAHLIRDPSNCP
Ga0307510_1021335313300033180EctomycorrhizaMNKIRRIDSFYEKKRKNIDNSQPSESTPICDVEVMVEQPQCASVYEEPALINEQPPTRIDIAHLIIDPSNHPQIXEYPV
Ga0307510_1028737313300033180EctomycorrhizaLIFFEKKRKNIDNSQSSEPTPSNVEVIVEQPQCASVYKEPALISEQPLTTIDIAHLIRDSSNRPQI
Ga0307510_1034004713300033180EctomycorrhizaLKKKRKNIDNSQPSEPTPICNVEVMVEQPQCASIYRESTLISEQPLTRIDITYLITNPSNRPQI
Ga0307510_1048559113300033180EctomycorrhizaMNKIRRIDSFFEKKINIDNSQSSEPTPMCNVKVIVDQPQCASVFKEPALISEQPLTTIDIAHLIRDPSNRPQI
Ga0307510_1049451913300033180EctomycorrhizaIDSFFEKKRKTIDNSQSSEPTPMCNVKVIVEQPQCASVYKEPALISEQHLTTIDIAHLIRDPSNRPQI
Ga0325419_008069_10739_109633300034389LeafMNKIRRIDSFFEKNRKNIDNSQPSESTLICNVEVMVKQPQCASVYEEPALINEQPPTRIDIAHLSRDLSNRPQI
Ga0325419_032566_853_10803300034389LeafMNKIRRINSFFEKTKRKNIDNSQPSGPTPMCNVEVMVEQPQCASVYEEPALINEQPPTRIDIAHVIRDPSNRPQI
Ga0325419_049349_117_3113300034389LeafLKKKEKIINNSQPSEPTPMCNVKVMVGQPQCALVYKELALISEQPLTRIDIAHLIRDLSNCPQI
Ga0325419_052788_128_3523300034389LeafMNKIRRIDSFFEKKRKNIDNSQPSESTPMCNVEVMVEQPQCASVYEEPALINEQPPTRIDIANLIRDPSNCPQI
Ga0325421_014747_3551_37573300034689LeafLILFFEKKRKNIDDSQPSKPTPICNAEVMVEQPQCASVYKEPVLISEQPLTRIDFAHLIRDPNNDPQI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.