Basic Information | |
---|---|
Family ID | F031445 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 182 |
Average Sequence Length | 46 residues |
Representative Sequence | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRR |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 182 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 88.00 % |
% of genes near scaffold ends (potentially truncated) | 19.23 % |
% of genes from short scaffolds (< 2000 bps) | 76.92 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.473 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.681 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.374 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.95% β-sheet: 0.00% Coil/Unstructured: 52.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 182 Family Scaffolds |
---|---|---|
PF00582 | Usp | 32.42 |
PF04343 | DUF488 | 3.85 |
PF07681 | DoxX | 3.85 |
PF02627 | CMD | 2.20 |
PF00923 | TAL_FSA | 2.20 |
PF08281 | Sigma70_r4_2 | 1.65 |
PF00044 | Gp_dh_N | 1.10 |
PF13442 | Cytochrome_CBB3 | 1.10 |
PF00072 | Response_reg | 0.55 |
PF01152 | Bac_globin | 0.55 |
PF00196 | GerE | 0.55 |
PF13847 | Methyltransf_31 | 0.55 |
PF00793 | DAHP_synth_1 | 0.55 |
PF07992 | Pyr_redox_2 | 0.55 |
PF00676 | E1_dh | 0.55 |
PF02371 | Transposase_20 | 0.55 |
PF00970 | FAD_binding_6 | 0.55 |
PF13517 | FG-GAP_3 | 0.55 |
PF08183 | SpoV | 0.55 |
PF07730 | HisKA_3 | 0.55 |
PF13188 | PAS_8 | 0.55 |
PF14759 | Reductase_C | 0.55 |
PF13185 | GAF_2 | 0.55 |
COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
---|---|---|---|
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 3.85 |
COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 3.85 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 3.85 |
COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 2.20 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 2.20 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 2.20 |
COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 1.10 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.55 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.55 |
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.55 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.55 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.55 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.55 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.47 % |
Unclassified | root | N/A | 22.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_103993398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
3300000956|JGI10216J12902_109256065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
3300000956|JGI10216J12902_112464876 | Not Available | 726 | Open in IMG/M |
3300000956|JGI10216J12902_116035632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1176 | Open in IMG/M |
3300003267|soilL1_10164524 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
3300004114|Ga0062593_100007925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4697 | Open in IMG/M |
3300004114|Ga0062593_101400641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
3300004156|Ga0062589_100845520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
3300004479|Ga0062595_100059901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1803 | Open in IMG/M |
3300004479|Ga0062595_100257438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1138 | Open in IMG/M |
3300005093|Ga0062594_102690634 | Not Available | 551 | Open in IMG/M |
3300005167|Ga0066672_10453995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 837 | Open in IMG/M |
3300005171|Ga0066677_10291547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
3300005175|Ga0066673_10006759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4691 | Open in IMG/M |
3300005181|Ga0066678_10247545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1152 | Open in IMG/M |
3300005184|Ga0066671_10246276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1098 | Open in IMG/M |
3300005187|Ga0066675_10591375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
3300005327|Ga0070658_10042215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3682 | Open in IMG/M |
3300005344|Ga0070661_100278390 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300005444|Ga0070694_100334349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1169 | Open in IMG/M |
3300005454|Ga0066687_10012534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 3328 | Open in IMG/M |
3300005458|Ga0070681_11196761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 682 | Open in IMG/M |
3300005459|Ga0068867_100394342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1166 | Open in IMG/M |
3300005529|Ga0070741_10004558 | All Organisms → cellular organisms → Bacteria | 32199 | Open in IMG/M |
3300005540|Ga0066697_10221526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
3300005540|Ga0066697_10370698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 833 | Open in IMG/M |
3300005545|Ga0070695_100564484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
3300005555|Ga0066692_10261468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1094 | Open in IMG/M |
3300005558|Ga0066698_10515678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
3300005568|Ga0066703_10660547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
3300005569|Ga0066705_10160978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1385 | Open in IMG/M |
3300005575|Ga0066702_10633455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
3300005598|Ga0066706_10619882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
3300006755|Ga0079222_10046243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1989 | Open in IMG/M |
3300006854|Ga0075425_100411357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1558 | Open in IMG/M |
3300006876|Ga0079217_11023138 | Not Available | 607 | Open in IMG/M |
3300009012|Ga0066710_101836006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 912 | Open in IMG/M |
3300009012|Ga0066710_103053486 | Not Available | 650 | Open in IMG/M |
3300009100|Ga0075418_11718298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
3300009100|Ga0075418_12926972 | Not Available | 521 | Open in IMG/M |
3300009137|Ga0066709_100308040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2155 | Open in IMG/M |
3300009174|Ga0105241_10038319 | All Organisms → cellular organisms → Bacteria | 3613 | Open in IMG/M |
3300009789|Ga0126307_10000656 | All Organisms → cellular organisms → Bacteria | 22510 | Open in IMG/M |
3300009789|Ga0126307_11312907 | Not Available | 586 | Open in IMG/M |
3300009840|Ga0126313_10225354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
3300010036|Ga0126305_10149945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1449 | Open in IMG/M |
3300010038|Ga0126315_10419047 | Not Available | 844 | Open in IMG/M |
3300010039|Ga0126309_10021645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2816 | Open in IMG/M |
3300010039|Ga0126309_10023086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2745 | Open in IMG/M |
3300010039|Ga0126309_10585359 | Not Available | 700 | Open in IMG/M |
3300010039|Ga0126309_10637210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
3300010040|Ga0126308_10181706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
3300010040|Ga0126308_10935715 | Not Available | 605 | Open in IMG/M |
3300010041|Ga0126312_10001447 | All Organisms → cellular organisms → Bacteria | 15565 | Open in IMG/M |
3300010041|Ga0126312_11041656 | Not Available | 600 | Open in IMG/M |
3300010323|Ga0134086_10201977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
3300010336|Ga0134071_10630601 | Not Available | 563 | Open in IMG/M |
3300010337|Ga0134062_10292311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
3300010403|Ga0134123_11218565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
3300010999|Ga0138505_100073166 | Not Available | 508 | Open in IMG/M |
3300011000|Ga0138513_100015917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 995 | Open in IMG/M |
3300011003|Ga0138514_100001510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2905 | Open in IMG/M |
3300011003|Ga0138514_100027528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1059 | Open in IMG/M |
3300012200|Ga0137382_10434133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 928 | Open in IMG/M |
3300012204|Ga0137374_10022760 | All Organisms → cellular organisms → Bacteria | 7056 | Open in IMG/M |
3300012207|Ga0137381_11756095 | Not Available | 510 | Open in IMG/M |
3300012212|Ga0150985_100050288 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300012937|Ga0162653_100001949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1843 | Open in IMG/M |
3300012941|Ga0162652_100020871 | Not Available | 914 | Open in IMG/M |
3300012975|Ga0134110_10465427 | Not Available | 570 | Open in IMG/M |
3300014488|Ga0182001_10671394 | Not Available | 511 | Open in IMG/M |
3300014497|Ga0182008_10437348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
3300015371|Ga0132258_10061731 | All Organisms → cellular organisms → Bacteria | 8642 | Open in IMG/M |
3300015371|Ga0132258_10249415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4339 | Open in IMG/M |
3300015371|Ga0132258_10441697 | All Organisms → cellular organisms → Bacteria | 3241 | Open in IMG/M |
3300015371|Ga0132258_10446459 | All Organisms → cellular organisms → Bacteria | 3223 | Open in IMG/M |
3300015374|Ga0132255_100273026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2423 | Open in IMG/M |
3300015374|Ga0132255_101789722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
3300015374|Ga0132255_104204629 | Not Available | 611 | Open in IMG/M |
3300017997|Ga0184610_1284060 | Not Available | 546 | Open in IMG/M |
3300018000|Ga0184604_10124743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
3300018027|Ga0184605_10107633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1234 | Open in IMG/M |
3300018027|Ga0184605_10244874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
3300018051|Ga0184620_10004157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2954 | Open in IMG/M |
3300018051|Ga0184620_10291677 | Not Available | 550 | Open in IMG/M |
3300018054|Ga0184621_10033071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1663 | Open in IMG/M |
3300018054|Ga0184621_10138355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
3300018061|Ga0184619_10032966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2194 | Open in IMG/M |
3300018061|Ga0184619_10040534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1999 | Open in IMG/M |
3300018061|Ga0184619_10237528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 838 | Open in IMG/M |
3300018061|Ga0184619_10339235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300018066|Ga0184617_1163137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300018071|Ga0184618_10038233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1688 | Open in IMG/M |
3300018071|Ga0184618_10145237 | Not Available | 966 | Open in IMG/M |
3300018072|Ga0184635_10000926 | All Organisms → cellular organisms → Bacteria | 8023 | Open in IMG/M |
3300018072|Ga0184635_10122783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
3300018072|Ga0184635_10239386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
3300018073|Ga0184624_10198795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 894 | Open in IMG/M |
3300018073|Ga0184624_10473489 | Not Available | 547 | Open in IMG/M |
3300018073|Ga0184624_10493026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
3300018076|Ga0184609_10330376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
3300018081|Ga0184625_10058481 | Not Available | 1940 | Open in IMG/M |
3300018081|Ga0184625_10171237 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300018081|Ga0184625_10520687 | Not Available | 597 | Open in IMG/M |
3300018422|Ga0190265_11130986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
3300018422|Ga0190265_12566971 | Not Available | 607 | Open in IMG/M |
3300018431|Ga0066655_11049066 | Not Available | 566 | Open in IMG/M |
3300018433|Ga0066667_10424418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1081 | Open in IMG/M |
3300018468|Ga0066662_10406533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1199 | Open in IMG/M |
3300018482|Ga0066669_12112074 | Not Available | 531 | Open in IMG/M |
3300019875|Ga0193701_1019791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1372 | Open in IMG/M |
3300020082|Ga0206353_10317175 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300021080|Ga0210382_10046761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1690 | Open in IMG/M |
3300021080|Ga0210382_10051087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1627 | Open in IMG/M |
3300021445|Ga0182009_10313858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
3300022195|Ga0222625_1339056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300022467|Ga0224712_10689593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300022756|Ga0222622_10005709 | All Organisms → cellular organisms → Bacteria | 5606 | Open in IMG/M |
3300022756|Ga0222622_10142871 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300022756|Ga0222622_10151992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1493 | Open in IMG/M |
3300022756|Ga0222622_10325999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1064 | Open in IMG/M |
3300022756|Ga0222622_10464697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 900 | Open in IMG/M |
3300022756|Ga0222622_10657102 | Not Available | 760 | Open in IMG/M |
3300022756|Ga0222622_10695006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
3300025321|Ga0207656_10344600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
3300025901|Ga0207688_10729983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
3300025912|Ga0207707_10138651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2127 | Open in IMG/M |
3300025912|Ga0207707_10277583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1452 | Open in IMG/M |
3300025917|Ga0207660_11499545 | Not Available | 545 | Open in IMG/M |
3300025919|Ga0207657_10000871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 31861 | Open in IMG/M |
3300026089|Ga0207648_10385911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1267 | Open in IMG/M |
3300026312|Ga0209153_1003952 | All Organisms → cellular organisms → Bacteria | 4675 | Open in IMG/M |
3300026312|Ga0209153_1004816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4224 | Open in IMG/M |
3300026322|Ga0209687_1011910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2887 | Open in IMG/M |
3300026542|Ga0209805_1104500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1350 | Open in IMG/M |
3300026550|Ga0209474_10156090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1483 | Open in IMG/M |
3300027787|Ga0209074_10068698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
3300028707|Ga0307291_1011131 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
3300028711|Ga0307293_10073786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
3300028715|Ga0307313_10069818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1048 | Open in IMG/M |
3300028715|Ga0307313_10082205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 969 | Open in IMG/M |
3300028716|Ga0307311_10048971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
3300028719|Ga0307301_10083397 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300028721|Ga0307315_10270221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300028722|Ga0307319_10002994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5172 | Open in IMG/M |
3300028722|Ga0307319_10210725 | Not Available | 637 | Open in IMG/M |
3300028744|Ga0307318_10019328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2195 | Open in IMG/M |
3300028754|Ga0307297_10302024 | Not Available | 578 | Open in IMG/M |
3300028771|Ga0307320_10111210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1046 | Open in IMG/M |
3300028771|Ga0307320_10410676 | Not Available | 544 | Open in IMG/M |
3300028771|Ga0307320_10482316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300028787|Ga0307323_10088230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
3300028787|Ga0307323_10106453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
3300028787|Ga0307323_10174730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
3300028790|Ga0307283_10003951 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
3300028793|Ga0307299_10248207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300028793|Ga0307299_10329831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300028796|Ga0307287_10380337 | Not Available | 532 | Open in IMG/M |
3300028811|Ga0307292_10135651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 987 | Open in IMG/M |
3300028824|Ga0307310_10722160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
3300028828|Ga0307312_10690515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
3300028875|Ga0307289_10143444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
3300028876|Ga0307286_10413599 | Not Available | 507 | Open in IMG/M |
3300028878|Ga0307278_10000125 | All Organisms → cellular organisms → Bacteria | 37780 | Open in IMG/M |
3300028878|Ga0307278_10010275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4387 | Open in IMG/M |
3300028878|Ga0307278_10012986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3882 | Open in IMG/M |
3300028878|Ga0307278_10210162 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300028881|Ga0307277_10003354 | All Organisms → cellular organisms → Bacteria | 6161 | Open in IMG/M |
3300031731|Ga0307405_11320754 | Not Available | 628 | Open in IMG/M |
3300031911|Ga0307412_11390463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300031995|Ga0307409_100521194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
3300031996|Ga0308176_10583719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1146 | Open in IMG/M |
3300032002|Ga0307416_101173627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 873 | Open in IMG/M |
3300032005|Ga0307411_11045914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
3300032126|Ga0307415_100214027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1540 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.68% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 13.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.09% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.14% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.30% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 3.30% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.30% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.20% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.20% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.65% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.10% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.10% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.55% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.55% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1039933981 | 3300000956 | Soil | MEALETYTFALAALSAALLLLAPGLAKKQLVWKRAKPVPPRPRR* |
JGI10216J12902_1092560652 | 3300000956 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRWF* |
JGI10216J12902_1124648761 | 3300000956 | Soil | MEALETYTSALAVLSAALLLVVAGLAKKQLVWKRAKAVPARRRRRRF* |
JGI10216J12902_1160356321 | 3300000956 | Soil | MDSLETYTPALAALSAALLLIASGLVKKQLVWKRPTPVRARHRRRRS* |
soilL1_101645242 | 3300003267 | Sugarcane Root And Bulk Soil | MEALETYTSAVSVLSAALLLVAAGLAKKQLVWKRPKPVPARRRRRKR* |
Ga0062593_1000079259 | 3300004114 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRAKPVPTGRRRCRR* |
Ga0062593_1014006412 | 3300004114 | Soil | MEALDTYTSVLTVLSAALLLAAAELAKKQLVRKLAKPVRARRRRGS* |
Ga0062589_1008455202 | 3300004156 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRSR* |
Ga0062595_1000599012 | 3300004479 | Soil | MEAVETYSSVLAVLSAALLLVAAGLAKKQLVWKRPKAVPARRRRRWF* |
Ga0062595_1002574382 | 3300004479 | Soil | MEALDTYTSVVVVLSAALLLIAAGLAKKQLVWKRAKPVPARRRRNR* |
Ga0062594_1026906341 | 3300005093 | Soil | MEALETYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPVRRRRCRR* |
Ga0066672_104539952 | 3300005167 | Soil | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRRNR* |
Ga0066677_102915472 | 3300005171 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRSS* |
Ga0066673_100067592 | 3300005175 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWRRAKPVPARRRRRRF* |
Ga0066678_102475451 | 3300005181 | Soil | MLETYTSALAALSAALLLIASGLVKKQLVWKRPTPLRARYR |
Ga0066671_102462762 | 3300005184 | Soil | MEALETYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVLARRRRRSF* |
Ga0066675_105913753 | 3300005187 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRR |
Ga0070658_100422152 | 3300005327 | Corn Rhizosphere | MEAYETYTSVLVALSVALLLIASGLAKKQLVWKRSRPSRGHRRRS* |
Ga0070658_100902842 | 3300005327 | Corn Rhizosphere | MELHETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRRRNG* |
Ga0070683_1018302852 | 3300005329 | Corn Rhizosphere | HETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRRRNG* |
Ga0070691_103384141 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MELHETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRR |
Ga0070661_1002783903 | 3300005344 | Corn Rhizosphere | MEAYETYTSVLVALSIALLLIASGLAKKQLVWKRSRPSRGHRRRS* |
Ga0070694_1003343491 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MEALETYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPVRR |
Ga0066687_100125347 | 3300005454 | Soil | MAALETYTSALAVRSAALLLIAAGLAKKQLVWKRAKPVLARRRRRSF* |
Ga0070681_111967611 | 3300005458 | Corn Rhizosphere | MEAYETYTSVLVALSVALLLIASGLAKKQLVWKRSRPSRGRRRRS* |
Ga0068867_1003943421 | 3300005459 | Miscanthus Rhizosphere | MEALETYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPLRRRRCRR* |
Ga0070741_1000455820 | 3300005529 | Surface Soil | MEALETYTSALAVLSAALLLVATGLAKKQLVWKRAKAVSARRRRSNR* |
Ga0066697_102215263 | 3300005540 | Soil | MLETYTSALAALSAALLLIASGLVKKQLVWKRPTPLRARYRRRRS* |
Ga0066697_103706981 | 3300005540 | Soil | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRRN |
Ga0070695_1005644841 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GALMEALETYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPVRRRRCRR* |
Ga0066692_102614682 | 3300005555 | Soil | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRATPVPARRRRNR* |
Ga0066698_105156782 | 3300005558 | Soil | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRSNR* |
Ga0068855_1000482171 | 3300005563 | Corn Rhizosphere | MELHETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRR |
Ga0068855_1000808128 | 3300005563 | Corn Rhizosphere | ETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRRRNG* |
Ga0066703_106605471 | 3300005568 | Soil | MEALETYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRGRSS* |
Ga0066705_101609782 | 3300005569 | Soil | MEALETYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRRRSS* |
Ga0066702_106334552 | 3300005575 | Soil | MEALETYTSALAVVSAALLLVAAGLAKKQLVWKRAKPVPARRRRRSS* |
Ga0066706_106198823 | 3300005598 | Soil | MEALEIYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRSS* |
Ga0079222_100462432 | 3300006755 | Agricultural Soil | MEALETYTSAVAVLGAALLLVAAGLAKKQLVWKRRRPAPVRRRRCRR* |
Ga0075425_1004113574 | 3300006854 | Populus Rhizosphere | MEALETYTSVLAVLSAALLLIAAGLAKKQLVWRRPKPVPVRRRRGRR* |
Ga0079217_110231382 | 3300006876 | Agricultural Soil | VEAVETYTSVLTVLSVAVLLVVAGLAKKQLVWKAKAVPTRRRRRR* |
Ga0066710_1018360063 | 3300009012 | Grasslands Soil | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRR |
Ga0066710_1030534861 | 3300009012 | Grasslands Soil | MDSLETYTSALAALSAALLLIASGLAKKQLVWKRPTPLRARYRRRRS |
Ga0075418_117182982 | 3300009100 | Populus Rhizosphere | MEALETYTSTVAVLSAALLLVAAGLAKKQLAWKQARPVPAPRRRCRR* |
Ga0075418_129269721 | 3300009100 | Populus Rhizosphere | MEALETYTSTLAVLSAALLLVAAGLAKKQLVWKRAKPDPARRRRRSS* |
Ga0066709_1003080402 | 3300009137 | Grasslands Soil | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRPKPVPARRRRNR* |
Ga0105241_100383192 | 3300009174 | Corn Rhizosphere | MEALETYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPARRRRCRR* |
Ga0126307_1000065616 | 3300009789 | Serpentine Soil | MEALETYTSVLAMLSAALLLVAAGLAKKQLVWKVKPLPMRKRRRRS* |
Ga0126307_113129072 | 3300009789 | Serpentine Soil | MEALETYTSALTVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRRF* |
Ga0126313_102253543 | 3300009840 | Serpentine Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRVKPLPARRRRRKP* |
Ga0126305_101499454 | 3300010036 | Serpentine Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRPKPVPARRRRRSS* |
Ga0126315_104190472 | 3300010038 | Serpentine Soil | MEALETYTSALVVLSAALLLVAAGLAKKQLVWRRAKPVRARRRRNRF* |
Ga0126309_100216452 | 3300010039 | Serpentine Soil | MESFETYASALTAISVALLLVAAGLAKKQLVWKRVKPRPRRRRRR* |
Ga0126309_100230864 | 3300010039 | Serpentine Soil | MEALEIYTSALAVLSAALLLVAAGLAKKQLVWKRVKRSPARRHRREP* |
Ga0126309_105853592 | 3300010039 | Serpentine Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKQAKPVPARRRRCRR* |
Ga0126309_106372102 | 3300010039 | Serpentine Soil | MEALETYTSILTLLSAALLLVAAGLAKKQLVWKTKPLPMWKRRRRS* |
Ga0126308_101817062 | 3300010040 | Serpentine Soil | MEALTYTSALVVLSAALLLVAAGLAKKQLVWRRAKPVRAQRRRNRF* |
Ga0126308_109357152 | 3300010040 | Serpentine Soil | MEALETYTSTLAVLSAALLLVAAGLAKKQLVWKRAKPAPARRRRRRS* |
Ga0126312_100014479 | 3300010041 | Serpentine Soil | MEALETYTSTLAVLSAALLLVAARLAKKQLVWKRAKPAPARRRRRRS* |
Ga0126312_110416562 | 3300010041 | Serpentine Soil | MEALETYTSVLALLSAALLLVAAGLAKKQLVWKAKPVPMRRRRRRS* |
Ga0134086_102019771 | 3300010323 | Grasslands Soil | MDSLETYTSALAALSAAFLLIASGLVKKQLVWKRPTPLRARYRRRRS* |
Ga0134071_106306012 | 3300010336 | Grasslands Soil | MDSLETYTSALAALSAAFLLIASGLVKKQLVWKRPTPLRA |
Ga0134062_102923111 | 3300010337 | Grasslands Soil | GAQMEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRSS* |
Ga0134123_112185652 | 3300010403 | Terrestrial Soil | MEALKTYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPVRRRRCRR* |
Ga0138505_1000731662 | 3300010999 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRCRR* |
Ga0138513_1000159171 | 3300011000 | Soil | QGGAQMEALETYTSALAVLSAALLLVAAGLANKQLVWKRGKPVPARRRRRGF* |
Ga0138514_1000015104 | 3300011003 | Soil | MEALETYTSALAVLSAALFLVAAGLAKKQLVWKRAKPVPARRRRRRSF* |
Ga0138514_1000275283 | 3300011003 | Soil | MEALETYTSALAVLSAALLLVAAGLVKKQLVWKRVKPLPARRRRPKP* |
Ga0137382_104341331 | 3300012200 | Vadose Zone Soil | MEALEAYTSALAVLSAALLLIVAGLAKKQLVWKRAKPVPARRRRNR* |
Ga0137374_1002276014 | 3300012204 | Vadose Zone Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRSF* |
Ga0137381_117560951 | 3300012207 | Vadose Zone Soil | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRCNR* |
Ga0150985_1000502881 | 3300012212 | Avena Fatua Rhizosphere | PMESFETYTSVLAALSATLLMIAAGFAKKQLVWRRPARTRANSRRRQW* |
Ga0162653_1000019493 | 3300012937 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRGF* |
Ga0162652_1000208711 | 3300012941 | Soil | TRRCKMEALETYTSTLAVLSAALLLVAAGLAKKQLVSKRAKPVPARRRRRSP* |
Ga0134110_104654272 | 3300012975 | Grasslands Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWRRTKPVPARRRRRRF* |
Ga0182001_106713942 | 3300014488 | Soil | LDAVDSYTSVLATLTAALLLVAAGLAKKQLVWKAKPIWLRRRRRRR* |
Ga0182008_104373481 | 3300014497 | Rhizosphere | MEALETYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRRSF* |
Ga0132258_1006173115 | 3300015371 | Arabidopsis Rhizosphere | MEALDAYTSAFAVLSAALLLVAARVAKKPLVPVRVKRVAPRLRRRTS* |
Ga0132258_102494159 | 3300015371 | Arabidopsis Rhizosphere | MEALDAYTSAFAVLSAALLLVAAQVAKKPLVPVRVKRVAPRLRRRTS* |
Ga0132258_104416973 | 3300015371 | Arabidopsis Rhizosphere | VKTLELYVSALTVLSAALLFVAAGLAKKQLVWKRVSPVPVCLRRRRS* |
Ga0132258_104464594 | 3300015371 | Arabidopsis Rhizosphere | MEALDPYTSAVAVLSAVLLMITAGLAKRQLVWRAKPVRARRRLRRHSGGRLR* |
Ga0132255_1002730263 | 3300015374 | Arabidopsis Rhizosphere | MEALETYTSVLAVLSAALLLIAAGLAKKQLVWRRPKPVPVWRRRGRR* |
Ga0132255_1017897222 | 3300015374 | Arabidopsis Rhizosphere | MEAFDSYTSAVAVISAALLMITAGLAKKQLVWKRASPVRPRCRRRRS* |
Ga0132255_1042046291 | 3300015374 | Arabidopsis Rhizosphere | PYTSVVALLCLALLLVTAGLGKKQLVWKARRSPMSMRRRRRRS* |
Ga0184610_12840602 | 3300017997 | Groundwater Sediment | MEALETYTSALTVLSAALLLVAAGLAKKQLVWKRAKPAPARRRRSS |
Ga0184604_101247432 | 3300018000 | Groundwater Sediment | MEALETYTSALTVLSAALLLVAAGLAKKQLVWKRAKPAPARRRCSH |
Ga0184605_101076333 | 3300018027 | Groundwater Sediment | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRRNR |
Ga0184605_102448741 | 3300018027 | Groundwater Sediment | MEALETYTSALAVLSAALLLVAAGFAKKQLVWKRAKPVPARRRRRSF |
Ga0184620_100041571 | 3300018051 | Groundwater Sediment | MEVLETYTSALAVLSAALLLIVAGLAKKQLVWKRAKPISKRRRRSS |
Ga0184620_102916772 | 3300018051 | Groundwater Sediment | MEALEIYTSALAVISAALLLVVAGLAKKQLVWNRAKPIPVRRRRRRR |
Ga0184621_100330715 | 3300018054 | Groundwater Sediment | MEALETYTSALAVLSAALLLVVAGLAKKQLVWRREKPVSKRRRRSS |
Ga0184621_101383552 | 3300018054 | Groundwater Sediment | MEALETYTSALAVLSAALLLVAAGLAKKQLVWRQKPVSKRRRRSY |
Ga0184619_100329663 | 3300018061 | Groundwater Sediment | MEALDTYTSALAVLSAALLLVAAGLAKKQLVWRQKPVSKRRRRSY |
Ga0184619_100405343 | 3300018061 | Groundwater Sediment | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRSF |
Ga0184619_102375281 | 3300018061 | Groundwater Sediment | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPA |
Ga0184619_103392351 | 3300018061 | Groundwater Sediment | MLETYTSALAALSAALLLIASGLVKKQLVWKRPTPLRARYRRRRS |
Ga0184617_11631372 | 3300018066 | Groundwater Sediment | MEVLEAYTSALAVLSAALLLVAAGLAKKQLVWRQKPVSKRRRRSY |
Ga0184618_100382332 | 3300018071 | Groundwater Sediment | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRCRRRF |
Ga0184618_101452372 | 3300018071 | Groundwater Sediment | MEVLDTYTSVLAVLIGALLLVAAGLAKKQLVWKRPNPVRVRWRRRSS |
Ga0184635_100009266 | 3300018072 | Groundwater Sediment | MEALETYTSTLAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRQSP |
Ga0184635_101227832 | 3300018072 | Groundwater Sediment | MEALDSYTSAVAVLSAALLMITAGLAKQQLVWKRPKLVRARRRRRRY |
Ga0184635_102393862 | 3300018072 | Groundwater Sediment | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRAKPIPVRRRRR |
Ga0184624_101987951 | 3300018073 | Groundwater Sediment | MEALDSYTSAAAVLSAALLMITAGLAKKQLVWKRAKPVRARRRRRRS |
Ga0184624_104734892 | 3300018073 | Groundwater Sediment | MEALDSYTSAVAVLSAALLMITAGLAKQQLVWKRPKPVRARRRRRRY |
Ga0184624_104930262 | 3300018073 | Groundwater Sediment | MEALEAYTSAPAVLSAVLLLVVAGLAKKQLVWNRAKPIPVRRRRRRR |
Ga0184609_103303762 | 3300018076 | Groundwater Sediment | MEALETYTSALTVLSAALLLIVAGLAKKQLVWKRAEPVSKRRRRSS |
Ga0184625_100584812 | 3300018081 | Groundwater Sediment | MEALEAYTSTLAVLSATLLLVVTGLAKKQLVWKRPKPVPARRRRRRF |
Ga0184625_101712372 | 3300018081 | Groundwater Sediment | MEALDSYTSAVAVLSAVLLMITAGLAKQQLVWKRPKLVRARRRRRRY |
Ga0184625_105206872 | 3300018081 | Groundwater Sediment | MEALETYTSALAVLSAALLLVVAGLAKKQLVWKRAKPVSKRRRRRS |
Ga0190265_111309861 | 3300018422 | Soil | KEVHVEAVETYTSVLTVLSVALLLVVAGMAKKQLVWKAKPSPARRRRPRT |
Ga0190265_125669711 | 3300018422 | Soil | MEALETYTSALAVVSAALLLVAAGVAKKQLVWKRAKPVPARRRRRRS |
Ga0066655_110490662 | 3300018431 | Grasslands Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWRRAKPVPARRRRRRF |
Ga0066667_104244182 | 3300018433 | Grasslands Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRSS |
Ga0066662_104065333 | 3300018468 | Grasslands Soil | MEALETYTLALAVRSAALLLIAAGLAKKQLVWKRAKPVLARRRRRSF |
Ga0066669_121120741 | 3300018482 | Grasslands Soil | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPAWLRRNR |
Ga0193701_10197912 | 3300019875 | Soil | MEALETYTSALAVISTALLLVAAGLAKKQLVWKRAKPVPVRRRRCRR |
Ga0206353_103171754 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | RGGEMELHETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRRRNG |
Ga0210382_100467611 | 3300021080 | Groundwater Sediment | SQGGALMEALETYTSAVAVLSAALLLVAAGLAKKQLVWKQAKPVPARRRRCRR |
Ga0210382_100510873 | 3300021080 | Groundwater Sediment | MEALEAYTSALAVLSAALLLIAAGLAKKQLVWKRAKPAPARRRRKR |
Ga0182009_103138582 | 3300021445 | Soil | MEALETYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVPARRRRSF |
Ga0222625_13390562 | 3300022195 | Groundwater Sediment | MEALETYTSVLALLSGALLLVAAGLVKKQLVWKAKRVRVPTRRHCP |
Ga0224712_106895932 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LHETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRRRNG |
Ga0222622_100057096 | 3300022756 | Groundwater Sediment | MEALETYTSAVAVLSAAVLLIAAGLAKKRLVWKPARPVRARRRRRRS |
Ga0222622_101428713 | 3300022756 | Groundwater Sediment | MEALDSYTSAVAVLSAALLMITAGLAKQQLVWKRPKPVRARRRRPRS |
Ga0222622_101519923 | 3300022756 | Groundwater Sediment | MEALETYTSALAVISAALLLVAAGLAKKQLVWKRAKPVPARRRRCRR |
Ga0222622_103259993 | 3300022756 | Groundwater Sediment | MEALETYTSALAVISTALLLVAAGLAKKQLVWKRAKPVPV |
Ga0222622_104646972 | 3300022756 | Groundwater Sediment | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRAKPIPVRRRRRRR |
Ga0222622_106571021 | 3300022756 | Groundwater Sediment | MLETYTSILVALTAALLLIASGLAKKQLVWKRPTRLRARYRRHRW |
Ga0222622_106950062 | 3300022756 | Groundwater Sediment | MEALETYTSAVAVLSAALLLIAAGLARKQLVWKRVKPLPARRRRRKP |
Ga0207656_103446001 | 3300025321 | Corn Rhizosphere | HETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRRRNG |
Ga0207688_107299832 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MEALETYTSAVAVLGAALLLVAAGLAKKQLVWKRRRPAPVRRRRCRR |
Ga0207707_101386513 | 3300025912 | Corn Rhizosphere | MEALETYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPVRRRRCRR |
Ga0207707_102775831 | 3300025912 | Corn Rhizosphere | MEAYETYTSVLVALSVALLLIASGLAKKQLVWKRSRPSRGRRRRS |
Ga0207660_114995451 | 3300025917 | Corn Rhizosphere | MEALDTYTSVLTVLSAALLLAAAELAKKQLVRKLAKPVRARRRRGS |
Ga0207657_1000087134 | 3300025919 | Corn Rhizosphere | MEAYETYTSVLVALSVALLLIASGLAKKQLVWKRSRPSRGHRRRS |
Ga0207648_103859112 | 3300026089 | Miscanthus Rhizosphere | MEALETYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPLRRRRCRR |
Ga0209153_10039529 | 3300026312 | Soil | MEALETYTSALAVLSAALLLIAAGLAKKQLVWKRAKPVLARRRRRSF |
Ga0209153_10048161 | 3300026312 | Soil | GAQMEALETYTSALAVRSAALLLIAAGLAKKQLVWKRAKPVLARRRRRSF |
Ga0209687_10119101 | 3300026322 | Soil | ALETYTSALAVRSAALLLIAAGLAKKQLVWKRAKPVLARRRRRSF |
Ga0209805_11045003 | 3300026542 | Soil | MEALETYTSALAVRSAALLLIAAGLAKKQLVWKRAKPVLARRRRRSF |
Ga0209474_101560903 | 3300026550 | Soil | MEALETYTSALAVVSAALLLVAAGLAKKQLVWKRAKPVLARRRRRSF |
Ga0209074_100686981 | 3300027787 | Agricultural Soil | GGALMEALETYTSVVAVLGAALLLVAAGLAKKQLVWKRRRPAPVRRRRCRR |
Ga0268266_100904164 | 3300028379 | Switchgrass Rhizosphere | MELHETYTSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRRRNG |
Ga0307291_10111311 | 3300028707 | Soil | MEALETYTSALAVLSAALLLVAAGFAKKQLVWKRAKPVPARRRRCKR |
Ga0307293_100737861 | 3300028711 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRC |
Ga0307313_100698181 | 3300028715 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRWRR |
Ga0307313_100822052 | 3300028715 | Soil | MEALEAYTSALAVLSAVLLLVAAGLAKKQLVWKRPKPFPARRRRRKP |
Ga0307311_100489713 | 3300028716 | Soil | MEALETYTSALTVLSAALLLVAAGLAKKQLVWKRPKPAPARRPRNR |
Ga0307301_100833972 | 3300028719 | Soil | MEALETYTPALTALSAALLLVAAGLAKKQLIWKRAKPVPVRRRRRSS |
Ga0307315_102702211 | 3300028721 | Soil | LETYTSALAVISAALLLVAAGLAKKQLVWKRAKPVPARRRRCRR |
Ga0307319_100029945 | 3300028722 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRCRR |
Ga0307319_102107252 | 3300028722 | Soil | MENIETYTSVLVVLSAAILLVTGGLAKHQLVWKRRTPVTVRL |
Ga0307318_100193281 | 3300028744 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKQAKPVPARRRRCRR |
Ga0307297_103020242 | 3300028754 | Soil | ETYTSAVAVLSAAVLLIAAGLAKKRLVWRPARPVRARRCRRRS |
Ga0307320_101112102 | 3300028771 | Soil | MEALETYTSTLAVLSAALLLVAAGLAKRQLVWKRAKPVPARRRRQSP |
Ga0307320_104106761 | 3300028771 | Soil | MENLETYTSVLVVLSAAILLVTGGLAKKQLVWKRRTPVT |
Ga0307320_104823161 | 3300028771 | Soil | MEALETYTSALTVLSAALLLVAAGLAKKQLVWKRAKRAPARRRRSP |
Ga0307323_100882301 | 3300028787 | Soil | MEALETYTSALAVISTALLLVAAGLAKKQLVWKRAKPVPARRRRCRR |
Ga0307323_101064532 | 3300028787 | Soil | MEALETYTSALAVISAALLLVAAGLAKKQLVWKRAKPVPARRRRWKR |
Ga0307323_101747301 | 3300028787 | Soil | MEALETYTSAVAVLSAALLLIAAGLARKQLVWKRVKPLPARRRRRKS |
Ga0307283_100039516 | 3300028790 | Soil | MEALETYTSALAVISTALLLVAAGLAKKQLVWKRAKPVPVRRRR |
Ga0307299_102482072 | 3300028793 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWRREKPVSKRRRRSS |
Ga0307299_103298311 | 3300028793 | Soil | SQGGAQMEALDTYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRCKR |
Ga0307287_103803371 | 3300028796 | Soil | MENIETYTSVLVVLSAAILLVTGGLAKHQLVWKRRTPVTVRLHRRRSR |
Ga0307292_101356513 | 3300028811 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKQA |
Ga0307310_107221601 | 3300028824 | Soil | MEALETYTSALTVLSAALLLVAAGLAKKQHVWKRAKPAPARRR |
Ga0307312_106905151 | 3300028828 | Soil | MEAFEAYTSALTVLSAALLLVAAGLAKKQLVWKRAKPAPARRRRSS |
Ga0307289_101434441 | 3300028875 | Soil | MLETYTSILVALTAALLLIASGLAKKQLVWKRAKPCPARRRHRRKP |
Ga0307286_104135992 | 3300028876 | Soil | MEALETYTSAVAVLSAAMLLIAAGLAKKRLVWKPAWPVRARRRRRRS |
Ga0307278_1000012523 | 3300028878 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRCS |
Ga0307278_100102757 | 3300028878 | Soil | MEALETYTSALAVLSAALLLVAAGLGKKQLVWKRATPVPARRRRRSS |
Ga0307278_100129864 | 3300028878 | Soil | MEALETYTSALAVLSAALLLVAAGLAKKQLVWKRAKPVPARRRRRRNF |
Ga0307278_102101622 | 3300028878 | Soil | MLETYTSILVALSAALLLIASGLAKKQLVWKRPTRLRARYRRHRW |
Ga0307277_100033548 | 3300028881 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRTKPVPVRRRRCRR |
Ga0307405_113207542 | 3300031731 | Rhizosphere | MEALETYTSVLALLSAALLLVVAGLATKQLVWKAKPVPMRTRRRRP |
Ga0307412_113904631 | 3300031911 | Rhizosphere | MEALETYTSALVVLSAALLLVAAGLAKKQLVWRRAKPVRARRRRNRF |
Ga0307409_1005211942 | 3300031995 | Rhizosphere | MEALTYTSALVVLSAALLLVAAGLAKKQLVWRRAKPVRAQRRRNRF |
Ga0308176_105837193 | 3300031996 | Soil | MEALETYTSAVAVLSAALLLVAAGLAKKQLVWKRPKPAPGRRRRRKR |
Ga0308176_112361821 | 3300031996 | Soil | MELHETYLSVLTSLSVGLLLIAAGLAKKQLVWKRPRPLPVRRRRRNG |
Ga0307416_1011736273 | 3300032002 | Rhizosphere | VEAVETYTSVLTVLSVAVLLVVLGLAKKQLVWKAKPVPMRRRRRR |
Ga0307411_110459141 | 3300032005 | Rhizosphere | GGAQMEALETYVSALTALSAALLLIAAGLAKKQLVWRRPKPVSARKRRRRR |
Ga0307415_1002140273 | 3300032126 | Rhizosphere | MEALETYTSVLALLSAALLLVAAGLAKKQLVWKAKPVPMRRRRRRS |
⦗Top⦘ |