Basic Information | |
---|---|
Family ID | F031804 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 181 |
Average Sequence Length | 43 residues |
Representative Sequence | MTLKIEKYSDGNSTTIRLIGRMQAEHLEELEKQIRESGPAI |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 181 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 61.67 % |
% of genes near scaffold ends (potentially truncated) | 93.92 % |
% of genes from short scaffolds (< 2000 bps) | 92.82 % |
Associated GOLD sequencing projects | 134 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.713 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.177 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.387 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.409 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 26.09% Coil/Unstructured: 55.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 181 Family Scaffolds |
---|---|---|
PF02954 | HTH_8 | 43.65 |
PF08447 | PAS_3 | 15.47 |
PF13185 | GAF_2 | 2.76 |
PF00106 | adh_short | 2.21 |
PF08240 | ADH_N | 2.21 |
PF00158 | Sigma54_activat | 1.66 |
PF00440 | TetR_N | 1.66 |
PF12680 | SnoaL_2 | 1.10 |
PF03928 | HbpS-like | 0.55 |
PF12802 | MarR_2 | 0.55 |
PF12867 | DinB_2 | 0.55 |
PF04075 | F420H2_quin_red | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.71 % |
Unclassified | root | N/A | 8.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459003|FZN2CUW02G3HZO | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300001083|JGI12678J13193_1001677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
3300001182|JGI12668J13544_1003987 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300001471|JGI12712J15308_10205855 | Not Available | 518 | Open in IMG/M |
3300001593|JGI12635J15846_10041526 | All Organisms → cellular organisms → Bacteria | 3580 | Open in IMG/M |
3300001593|JGI12635J15846_10082686 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
3300001593|JGI12635J15846_10113608 | Not Available | 1923 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100597666 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10351979 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300004082|Ga0062384_101035108 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300004092|Ga0062389_103924369 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300004092|Ga0062389_104930334 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005175|Ga0066673_10532358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 690 | Open in IMG/M |
3300005176|Ga0066679_10534627 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300005177|Ga0066690_11057584 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300005178|Ga0066688_10847797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 568 | Open in IMG/M |
3300005445|Ga0070708_100079719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2962 | Open in IMG/M |
3300005447|Ga0066689_11006854 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005467|Ga0070706_100266118 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300005534|Ga0070735_10081919 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
3300005536|Ga0070697_100818255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 824 | Open in IMG/M |
3300005541|Ga0070733_10205156 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300005542|Ga0070732_10660674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 636 | Open in IMG/M |
3300005556|Ga0066707_10229115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1207 | Open in IMG/M |
3300005560|Ga0066670_10373648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 871 | Open in IMG/M |
3300005591|Ga0070761_10163723 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300005591|Ga0070761_10956020 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005602|Ga0070762_10687540 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300006059|Ga0075017_101060674 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300006796|Ga0066665_10660138 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300006847|Ga0075431_100666963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1019 | Open in IMG/M |
3300006852|Ga0075433_11768646 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300006852|Ga0075433_11798728 | Not Available | 527 | Open in IMG/M |
3300006854|Ga0075425_100890714 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300006880|Ga0075429_100516483 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300006893|Ga0073928_10913827 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300006954|Ga0079219_11467489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300007258|Ga0099793_10399374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300007258|Ga0099793_10465306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300009012|Ga0066710_102647350 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300009038|Ga0099829_10763144 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300009038|Ga0099829_11152032 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300009038|Ga0099829_11476387 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300009090|Ga0099827_10248951 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
3300009143|Ga0099792_10405025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
3300009147|Ga0114129_12098918 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300009162|Ga0075423_11039729 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300009162|Ga0075423_12209744 | Not Available | 598 | Open in IMG/M |
3300010159|Ga0099796_10009759 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
3300010325|Ga0134064_10402159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300010343|Ga0074044_11014178 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300011269|Ga0137392_10524368 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300011270|Ga0137391_11006793 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300011270|Ga0137391_11483660 | Not Available | 523 | Open in IMG/M |
3300011271|Ga0137393_10864834 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300012096|Ga0137389_10300773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1358 | Open in IMG/M |
3300012096|Ga0137389_11538505 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300012199|Ga0137383_10371559 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300012200|Ga0137382_10654207 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300012208|Ga0137376_10384893 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300012208|Ga0137376_10602600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 950 | Open in IMG/M |
3300012208|Ga0137376_11645617 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012209|Ga0137379_11742400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300012210|Ga0137378_10816374 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300012211|Ga0137377_10161776 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300012357|Ga0137384_11170478 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300012360|Ga0137375_10705838 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300012361|Ga0137360_10665181 | Not Available | 893 | Open in IMG/M |
3300012362|Ga0137361_10140661 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300012362|Ga0137361_10489030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
3300012363|Ga0137390_11726172 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012582|Ga0137358_10556004 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300012685|Ga0137397_11188549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300012917|Ga0137395_10830133 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300012918|Ga0137396_11313496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300012922|Ga0137394_10569484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
3300012923|Ga0137359_10532634 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300012923|Ga0137359_10768197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 837 | Open in IMG/M |
3300012925|Ga0137419_11421373 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012927|Ga0137416_10531253 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300012930|Ga0137407_10873583 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300012944|Ga0137410_11583238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300013308|Ga0157375_10362337 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
3300013308|Ga0157375_12573244 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300013831|Ga0120126_1029203 | Not Available | 595 | Open in IMG/M |
3300014501|Ga0182024_11832821 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300014501|Ga0182024_11973867 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300014501|Ga0182024_12557049 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300015054|Ga0137420_1196521 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300015054|Ga0137420_1196522 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300015245|Ga0137409_10298228 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300018061|Ga0184619_10269206 | Not Available | 783 | Open in IMG/M |
3300018468|Ga0066662_12383820 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300019789|Ga0137408_1163452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 707 | Open in IMG/M |
3300019789|Ga0137408_1362049 | All Organisms → cellular organisms → Bacteria | 4025 | Open in IMG/M |
3300019887|Ga0193729_1168993 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300019888|Ga0193751_1045617 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
3300020170|Ga0179594_10238064 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300020579|Ga0210407_10835835 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300020579|Ga0210407_11482325 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300020581|Ga0210399_11176371 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300020583|Ga0210401_11156660 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300021046|Ga0215015_10221676 | Not Available | 502 | Open in IMG/M |
3300021170|Ga0210400_10127662 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
3300021171|Ga0210405_10428924 | Not Available | 1040 | Open in IMG/M |
3300021171|Ga0210405_10947404 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300021178|Ga0210408_10183855 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300021178|Ga0210408_10821992 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300021178|Ga0210408_10902682 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300021178|Ga0210408_11091206 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300021181|Ga0210388_10684588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
3300021181|Ga0210388_10900082 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300021181|Ga0210388_11155702 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300021401|Ga0210393_11184429 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300021403|Ga0210397_10866775 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300021404|Ga0210389_10425584 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300021432|Ga0210384_10698851 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300021433|Ga0210391_10234633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 1441 | Open in IMG/M |
3300021433|Ga0210391_10724128 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300021474|Ga0210390_10713983 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300021478|Ga0210402_10607808 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300021478|Ga0210402_11746933 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300021479|Ga0210410_10654434 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300021559|Ga0210409_10789144 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300024288|Ga0179589_10090790 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
3300025320|Ga0209171_10054990 | All Organisms → cellular organisms → Bacteria | 2629 | Open in IMG/M |
3300025916|Ga0207663_10525333 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300025929|Ga0207664_10398049 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300025938|Ga0207704_10236317 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300026355|Ga0257149_1065739 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300026359|Ga0257163_1019549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1048 | Open in IMG/M |
3300026359|Ga0257163_1082425 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300026469|Ga0257169_1012747 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300026482|Ga0257172_1055568 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300026496|Ga0257157_1038064 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300026499|Ga0257181_1039273 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300026507|Ga0257165_1015598 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300026514|Ga0257168_1060804 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300027371|Ga0209418_1093063 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300027535|Ga0209734_1023238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1144 | Open in IMG/M |
3300027535|Ga0209734_1058248 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300027583|Ga0209527_1147730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300027587|Ga0209220_1108595 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300027652|Ga0209007_1015155 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
3300027660|Ga0209736_1011073 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
3300027667|Ga0209009_1032918 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300027678|Ga0209011_1026304 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300027855|Ga0209693_10403997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300027862|Ga0209701_10377545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
3300027869|Ga0209579_10379353 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300027875|Ga0209283_10540696 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300027875|Ga0209283_10867780 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300027879|Ga0209169_10421488 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300027882|Ga0209590_10468775 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300028906|Ga0308309_10944772 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300028906|Ga0308309_11369136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300030997|Ga0073997_12261440 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300031057|Ga0170834_111458154 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300031122|Ga0170822_11697092 | Not Available | 612 | Open in IMG/M |
3300031122|Ga0170822_15038199 | Not Available | 660 | Open in IMG/M |
3300031170|Ga0307498_10249640 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300031231|Ga0170824_122285094 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300031231|Ga0170824_126093057 | Not Available | 888 | Open in IMG/M |
3300031234|Ga0302325_12990000 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300031469|Ga0170819_12991052 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300031474|Ga0170818_110969756 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031715|Ga0307476_10570489 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300031718|Ga0307474_10220527 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300031718|Ga0307474_11648220 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300031720|Ga0307469_10654002 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300031740|Ga0307468_101792875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300031753|Ga0307477_10747320 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300031753|Ga0307477_11023665 | Not Available | 541 | Open in IMG/M |
3300031754|Ga0307475_10716317 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300031962|Ga0307479_11036361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
3300031962|Ga0307479_11784421 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300032174|Ga0307470_10073663 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
3300032180|Ga0307471_100902879 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300032205|Ga0307472_101638547 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300034268|Ga0372943_0229484 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.89% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.39% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.18% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.87% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.87% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.21% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.66% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.66% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.55% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.55% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300001083 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 | Environmental | Open in IMG/M |
3300001182 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013831 | Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E4A_01454450 | 2170459003 | Grass Soil | VTFKIETYRDEHGTTIRLIGRMQAEHLSDLERQIRESGSSIVLDLKELDLIDVE |
JGI12678J13193_10016771 | 3300001083 | Forest Soil | MTLKIEKYSDGNSTTIRLIGRMQADHLEELEKQIRESGP |
JGI12668J13544_10039871 | 3300001182 | Forest Soil | LPDGSNMTLKIEKYWDGHRTNIRLIGRMRAEHLPELEKQIRESESKIALD |
JGI12712J15308_102058551 | 3300001471 | Forest Soil | MTLKIEKYADEYSTTIRLIGRVQAEHLAELKTQIEESGPKIAMDLEE |
JGI12635J15846_100415263 | 3300001593 | Forest Soil | MTLKIETYSDGSGTKIRLIGRMRAEHLAELEKEIR |
JGI12635J15846_100826863 | 3300001593 | Forest Soil | MTLKIEKYSDGNSSTIRLIGRMRAEHLEELEKQIRESGPAITLDLE |
JGI12635J15846_101136083 | 3300001593 | Forest Soil | MTLKIEKYSDGHGATIRLIGRMRAEHLEELEKQTRESRPVITYAAIPL* |
JGIcombinedJ26739_1005976661 | 3300002245 | Forest Soil | MTLKIEKYSDGYGTTIRLIGRLQAEHLEELEKQIQGSG |
JGIcombinedJ51221_103519792 | 3300003505 | Forest Soil | MTLKIDKYSDEYGTTIRLIGRMRAEHVPEMEKQIRESESKIVLDLE |
Ga0062384_1010351082 | 3300004082 | Bog Forest Soil | MTLKIEKYSDEGITTIRLIGRMGAEHLPELEKQMREGQSKIVLDLEE |
Ga0062389_1039243692 | 3300004092 | Bog Forest Soil | LKIEKYSDENTTTIRLIGRMRAEHLPELEKQMRESESKIVL |
Ga0062389_1049303341 | 3300004092 | Bog Forest Soil | MTLKIEKYSDEDTTTIRLIGRMRGEHLPELEKQMRESESKIVL |
Ga0066673_105323581 | 3300005175 | Soil | MTLKIERDSDGPRTTIRLIGRMRAEHLEELEKQIRESGPA |
Ga0066679_105346271 | 3300005176 | Soil | LPDGSNMTLKIEKYWDGHRTNIRLIGRMRAEHLPELEKQIR |
Ga0066690_110575841 | 3300005177 | Soil | MTLKIEKYWDGHRTNIRLIGRMRAEHLPELEKQIRESESKIA |
Ga0066688_108477972 | 3300005178 | Soil | MTLKIEKYSDEYSTTIRLISDTRAEHVPEMEKQIRESESKIVLDLEELNLVDV |
Ga0070708_1000797193 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKMERYSDGLSTTIRLIGRMRAEHLEELKTQIRESGSKIALD |
Ga0066689_110068542 | 3300005447 | Soil | MTLKIEKYSDGYNTTIRLIGRIRAEHLPELEKQIKESESKITLDLEELKLVDVDA |
Ga0070706_1002661181 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRESSDGSNVTFKIEKHRDRHSTTLRLIGRLRAEDLSELEKQVRESESKIVLDLEEL |
Ga0070735_100819192 | 3300005534 | Surface Soil | MTLKIEKYTDGDRTTIRLTGRMQAEHLEELGKQIRG |
Ga0070697_1008182552 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKIESYSDGLSTTIRLIGRMRAEHLEELKTQIRESGSKI |
Ga0070733_102051562 | 3300005541 | Surface Soil | MTLKIEKHADGYGTTLRLIGRMQVEHLPELEKQIRESESKIVLDLEELNLVDVE |
Ga0070732_106606742 | 3300005542 | Surface Soil | MTLKIETYSDGSGTKIRLIGRMRAEHLAELEKEIRNAGPKILLD |
Ga0066707_102291152 | 3300005556 | Soil | MTLKIERDSDGPRTTIRLIGRMRAEHLEELEKKIRESGPAITLDLEE |
Ga0066670_103736481 | 3300005560 | Soil | MTLKIERYSDGLSTTIRLIGRMRAEHLEELKTQIRESGSKI |
Ga0070761_101637233 | 3300005591 | Soil | MTLKIEKYADGDSATIRLIGRMQTEHLEELEKQIRESGP |
Ga0070761_109560201 | 3300005591 | Soil | MTLKIEKCSDAAGTKIRPIGRMQAEHLAELEKQIRESG |
Ga0070762_106875402 | 3300005602 | Soil | LPSVRRESLDRSDMTLRIEKYADEYSTTIRLIGRMCAEHVPEMEKQIRESESKIVLDLEE |
Ga0075017_1010606741 | 3300006059 | Watersheds | MTLKIEKYADEYSTTIRLIGRMQAEHLTELETLIKESRSKIVLDLE |
Ga0066665_106601383 | 3300006796 | Soil | LPDGSNMTLKIEKYWDGHRTNIRLIGRMRAEHLPEL |
Ga0075431_1006669631 | 3300006847 | Populus Rhizosphere | MTLKIERYSDGLSTTIRLIGRMRAEHLEELKTQIGES |
Ga0075433_117686462 | 3300006852 | Populus Rhizosphere | MTLKIESYSDGLSTTIRLIGRMRAEHLEELKTQIRESGSKITLD |
Ga0075433_117987281 | 3300006852 | Populus Rhizosphere | MTLKIERYSEGSSTTIRLIGRAQAEHLAELEKQIRESGSKIVID |
Ga0075425_1008907141 | 3300006854 | Populus Rhizosphere | MTLKIERCCDGAITTIRLIGRMRAERVMELAQQIAESESK |
Ga0075429_1005164832 | 3300006880 | Populus Rhizosphere | MPLKIEKYSDEYSTTIRLIGRMRAEHLEELEKQIRESGP |
Ga0073928_109138272 | 3300006893 | Iron-Sulfur Acid Spring | MTLKIETYSDGSGTKIRLIGRMQAEYLEELEKQIKWRKVFNG* |
Ga0079219_114674891 | 3300006954 | Agricultural Soil | MTLKIEKYADGDSTTVRLIGRMQTEHLEDLQSLNFWP |
Ga0099793_103993741 | 3300007258 | Vadose Zone Soil | VTFKIEKYRDGHGTTIRLIGRMRAEHLSELEKQIKESESKIVLDLEELNLVDV |
Ga0099793_104653061 | 3300007258 | Vadose Zone Soil | VTFKIEKHRDGHSTTIRLIGRMRAEHLSELEKQIKESESKIVLDLEELNLVDV |
Ga0066710_1026473502 | 3300009012 | Grasslands Soil | MTLKIEKYSDGYCATIRLIGRMRAEHLEELEKQIRESGPAI |
Ga0099829_107631442 | 3300009038 | Vadose Zone Soil | MTLKIEKRADGDSTTIRLIGRMQAEHLEELEKQIRESGPALILDL |
Ga0099829_111520322 | 3300009038 | Vadose Zone Soil | MTLKIEKYSDGNSTTIRLIGRMQAEHLEELEKQIRESGPALILDL |
Ga0099829_114763872 | 3300009038 | Vadose Zone Soil | MTLKIEKYADGDSTTIRLIGRMQAEHLEELEKQIRESGPALILDL |
Ga0099827_102489511 | 3300009090 | Vadose Zone Soil | MTLKIERYSEGPSTKIRLIGRMQAEHLAELEKQVRESESKIVLDLE |
Ga0099792_104050252 | 3300009143 | Vadose Zone Soil | MTLKIEKYSAGGSTTIRLIGRMQAEHLEELEKQIRESGPAITLDL |
Ga0114129_120989182 | 3300009147 | Populus Rhizosphere | MTLRIEKRGDGDSTTIRLIGRMRAEHLEELEKQIRESGP |
Ga0075423_110397292 | 3300009162 | Populus Rhizosphere | MTLKIEKYSDGPSATIRLIGRMRAEHLEELEKQIRESGPAIA |
Ga0075423_122097441 | 3300009162 | Populus Rhizosphere | MTLKIEKYSDGYSTTIRLIGRMRAECLPELEKQIRESES |
Ga0099796_100097591 | 3300010159 | Vadose Zone Soil | VTFKIEKYRDGDSTTIRLIGRMRAEHISDLEKQIRESESKIVLDLEE |
Ga0134064_104021592 | 3300010325 | Grasslands Soil | MTLKIEKCADGDSTTIRLIGRMQAEHLEELEKQIGESGPAIILDLED |
Ga0074044_110141782 | 3300010343 | Bog Forest Soil | MSFRIEKYADVCSTTIRLIGRMQAEHLEELEKQIRESGPA |
Ga0137392_105243682 | 3300011269 | Vadose Zone Soil | MTLKIERHSDWAVTTIRLIGRMRAEYLMELEKQITESESKIVLDLQEVNLVD |
Ga0137391_110067931 | 3300011270 | Vadose Zone Soil | MTLKIEKRADGDSTTIRLIGRMQAEHLEELEKQIRESGPA |
Ga0137391_112469121 | 3300011270 | Vadose Zone Soil | MTLRIEKESDGHSTTIRLIGRLRAEHLDELKAQIKDGGSRIA |
Ga0137391_114836602 | 3300011270 | Vadose Zone Soil | MTLKIETYSDGSGTKIRLIGRMQADHLAELEKEIRNGG |
Ga0137393_108648341 | 3300011271 | Vadose Zone Soil | MTLKIDRYSEGASTKIRLIGRIQAEHLAELEKQVRESESKIVLDLE |
Ga0137389_103007733 | 3300012096 | Vadose Zone Soil | MTLKIEKYADGDSTTIRLIGRMQAEHLEELEKQIR |
Ga0137389_115385051 | 3300012096 | Vadose Zone Soil | MTLKIEKYWDGHRTNIRLIGRMRAEHLPELGKQIGES |
Ga0137383_103715592 | 3300012199 | Vadose Zone Soil | MTLRIEKRADGDSTTIRLIGRMQAEHLEELEKQIRESGPA |
Ga0137382_106542072 | 3300012200 | Vadose Zone Soil | MTLKIERYSDGHSTTIRLIGRMRVEHLPELERQIR |
Ga0137376_103848933 | 3300012208 | Vadose Zone Soil | VTFKIEKHRDRHSTTIRLIGRMRADHLSELEKQISESESKIVLDLEE |
Ga0137376_106026001 | 3300012208 | Vadose Zone Soil | LKIEKYADGDSTTIRLIGRMQTEHLEELEKQIRESGPLLILD |
Ga0137376_116456171 | 3300012208 | Vadose Zone Soil | MTLKIEKCADGDRTTIRLIGRMRAEHLEELEKQIRESEPAVT |
Ga0137379_117424001 | 3300012209 | Vadose Zone Soil | MTLKIERYSEGSSTTIRLIGRMQADHLAELEKQIR |
Ga0137378_108163741 | 3300012210 | Vadose Zone Soil | MTLKIEKCADGDSTTIRLIGRMQAEHLEELEKQIRES |
Ga0137377_101617761 | 3300012211 | Vadose Zone Soil | MTLKIERYSDEYSTTLRLIGRMHAEHLPELEKQIRESES |
Ga0137384_111704782 | 3300012357 | Vadose Zone Soil | MTLKIERYSDELSTTIRLIGRMRAEHLEELKTQIR |
Ga0137375_107058382 | 3300012360 | Vadose Zone Soil | MTLKIERYSDGLSTTIRFIGRMRAEHLEELKTQIRES |
Ga0137360_106651812 | 3300012361 | Vadose Zone Soil | MTLKIEKYSDGYCATIRLIGRMRAEHLEELEKQIRESGPAIT |
Ga0137361_101406612 | 3300012362 | Vadose Zone Soil | MTLKIEKYWDGHRTNIRLIGRMRAEHLPELEKQIRESESKIALDL |
Ga0137361_104890302 | 3300012362 | Vadose Zone Soil | MTLKIEKVTDGHSTTIRLIGRMRAEYLEELKAQIKDSGS |
Ga0137390_117261721 | 3300012363 | Vadose Zone Soil | MTLKIEKHWDGYRTSLRLIGRMQGEHLEDLEKEVRESGPA |
Ga0137358_105560041 | 3300012582 | Vadose Zone Soil | VTFKIEKYRDGNVPTIRLIGRMQSVNLSELEKQNKEGESKIVMHLEDLILVDV |
Ga0137397_111885491 | 3300012685 | Vadose Zone Soil | MTLKIEKYSDGSSTTIRLIGRMRAEHLEELEKQIRES |
Ga0137395_108301332 | 3300012917 | Vadose Zone Soil | MHSDVKRPDRSNMTLKIERYSEGPSTTIRLIGRMQAEHLAELEKQIRESGS |
Ga0137396_113134962 | 3300012918 | Vadose Zone Soil | VTFKIEKYRDGHGTTIRLIGRMRAEHLSELEKQIKES |
Ga0137394_105694842 | 3300012922 | Vadose Zone Soil | MTLKIEKYSDGASTTIRLIGRMRAEHLEELEKQIRES |
Ga0137359_105326341 | 3300012923 | Vadose Zone Soil | MTLKIEKYSAGDSTTIRLIGRMRAEHLEELEKQIRE |
Ga0137359_107681971 | 3300012923 | Vadose Zone Soil | MTLKIEKYADGDRTTLRLIGRMQTEHLEELEKQIRESGPVLILDLDEVT |
Ga0137419_114213731 | 3300012925 | Vadose Zone Soil | MTLKIEKYSAGNSTTIRLIGRMRAEHLEELEKQIRESGPAVTLDLEE |
Ga0137416_105312532 | 3300012927 | Vadose Zone Soil | MTLKIEKYWDGHRTNIRLIGRMRAEHLPELEKQIRE |
Ga0137407_108735831 | 3300012930 | Vadose Zone Soil | MTLKIEKYADGDRTTLRLIGRMQTEHLEELEKQIRESGP |
Ga0137410_115832382 | 3300012944 | Vadose Zone Soil | MTLKIEKVTDGHSTTIRLIGRMRAEYLEELEAQIKDSGSRIALDL |
Ga0157375_103623371 | 3300013308 | Miscanthus Rhizosphere | MTLKIDKYSDGNSTTIRLIGRMRAEHLEVLEKQIREGGPAITL |
Ga0157375_125732441 | 3300013308 | Miscanthus Rhizosphere | MTLKIEKDSDGQQTTIRLIGHMQSEHLEELKAQMQGSGPEIMLDLDE |
Ga0120126_10292032 | 3300013831 | Permafrost | MTLKIEKYADGNSTTIRLIGRMRAEHLKELEKQIRESGPAITYAAIPL* |
Ga0182024_118328211 | 3300014501 | Permafrost | MTLKIETHADGSGTKIRLIGRMQAEHLAELEQQIRNGGPKIALDL |
Ga0182024_119738672 | 3300014501 | Permafrost | MTLKIEKYSDGSSTTLRLIGRMRAEHLEELEKQIRESGP |
Ga0182024_125570492 | 3300014501 | Permafrost | MTLKIEKCSDGNSTTIRLICRMRAEYLEELEKQIKWRKASNG* |
Ga0137420_11965211 | 3300015054 | Vadose Zone Soil | MTLKIEKYADGDSTTIRLIGRMRRMQTEHLEELEKQIRESGPVLILDLDEVTLVKV |
Ga0137420_11965223 | 3300015054 | Vadose Zone Soil | MTLKIEKYADGDSTTIRLIGRMQAEHLEELEKQIRESGPAPILDLDEVTLV |
Ga0137409_102982282 | 3300015245 | Vadose Zone Soil | MTLKIETYSDGSGTKIRLIGRMQAEYLEELEKQIKWRKAFNG* |
Ga0184619_102692062 | 3300018061 | Groundwater Sediment | SDGYGATIRLIGRMRAEHLEELEKQTRESGPVITYAAIPL |
Ga0066662_123838202 | 3300018468 | Grasslands Soil | MTLKNEKHWDGHRQNIRLIGRMRPEHLPESEKQNSE |
Ga0137408_11634521 | 3300019789 | Vadose Zone Soil | MTLRIEKYSDGGSTTIRLIGRMQAEHLSEVERQIDASGPNVTLDL |
Ga0137408_13620497 | 3300019789 | Vadose Zone Soil | MTLKIEKYGDGNSTTIRLIGRMQSEHLEELEKQIRESGPQSYWTWTK |
Ga0193729_11689932 | 3300019887 | Soil | MTLKIEKYSDRNSTTIRLIGRMQAEHLEELEKQIRESGPAIILDL |
Ga0193751_10456172 | 3300019888 | Soil | MTLKIETYSDGSGTKIRLIGRMQGEHLAELEEQIRNGGP |
Ga0179594_102380641 | 3300020170 | Vadose Zone Soil | VPDGSNMTLKIEKYWDGHRTNIRLIGRMRAEHLPELEKQIRE |
Ga0210407_108358352 | 3300020579 | Soil | VRRESSDGSNVTFKIEKHSDRHSTTIRLIGRMRTEDLSELEKQIRESELKIALDLEELDLIDVEAV |
Ga0210407_114823251 | 3300020579 | Soil | MTLKIEKYTDGDKTTIRLIGRMQAEHSEELGKQIRESGPAITLDLEEVTLV |
Ga0210399_111763711 | 3300020581 | Soil | MTLKIEKYADEYSTTIRLIGRVQAEHLAELKTQIKESGPKIAMDLEE |
Ga0210401_111566601 | 3300020583 | Soil | MTLKIETYSDGSGTKIRLIGRMQAEHLAELEKQIRNGGPKI |
Ga0215015_102216761 | 3300021046 | Soil | VTFKIEKHRDGHSTTIRLIGRMRAEHLSELEKQIK |
Ga0210400_101276621 | 3300021170 | Soil | MTLKIEKYTDGDKTTIRLIGRMQAEHSEELGKQIRE |
Ga0210405_104289241 | 3300021171 | Soil | VTFKIEKYRDGHGTTIRLIGRMRVEHLSELERQISESQSKIVLDLEE |
Ga0210405_109474041 | 3300021171 | Soil | MTLRIEKRGDGDSTTIRLIGRMQAEHLEELEKQIR |
Ga0210408_101838551 | 3300021178 | Soil | MTLKIEKYSDGDSTTIRLIGRMQAEHLEELEKQIRESGPALILDLDEVT |
Ga0210408_108219921 | 3300021178 | Soil | MTLRIEKRGDGDSTTIRLIGRMQAEHLEELEKQIRESGP |
Ga0210408_109026821 | 3300021178 | Soil | VTLKIERYSDRAITTIRLVGRMRAEHVMELEQQFAESESTIVLDLEEVKLVD |
Ga0210408_110912062 | 3300021178 | Soil | VTFKIEKHRDGHSTTIRLIGRMRAEHLSELEKQIKENESKIV |
Ga0210388_106845881 | 3300021181 | Soil | VTLKIEKYADRFSTTIRLIGRMRAEHLPELEKQIRDRESKIVLDLEELNLVD |
Ga0210388_109000821 | 3300021181 | Soil | VTFKIEKHRDGHSTTIRLIGRMRAEHLSELEKQIKENESKIVLDLEELNLVDV |
Ga0210388_111557021 | 3300021181 | Soil | MSLKIEKYTDGDRTTIRLIGRMQAEHLEELGKQIRESGPAITLDLEEVTL |
Ga0210393_111844292 | 3300021401 | Soil | VTFKIEKYRDGQSTTIRLIGRMRAEHLSELEKQIRES |
Ga0210397_108667751 | 3300021403 | Soil | MTLKIEKYSDEYSTTLRLIGRMRAEHLPELEKQIRDSGSKIVLD |
Ga0210389_104255842 | 3300021404 | Soil | MTLKIEKYADEYSTTIRLIGRVQAEHLAELKTQIKESGSKIALDLEE |
Ga0210384_106988511 | 3300021432 | Soil | MTLKIETYSDGSGTEIRLIGRMQAEHLAELEKEIRNAGPK |
Ga0210391_102346331 | 3300021433 | Soil | MRESSGKANVTFKIEKLHDANSTTIRLIGRMRAEHLSELEKQITESESKIVLDLEELN |
Ga0210391_107241282 | 3300021433 | Soil | MTFRIEKYAKEYSTTIRLIGRMQAEHSAEVETQIEESGSKIVLDLGE |
Ga0210390_107139831 | 3300021474 | Soil | MILKIEKYADGDSTTIRLIGRMQAEHLEELEKQIRESGPALIL |
Ga0210402_106078081 | 3300021478 | Soil | MTLKIEKYSDGDSTTIRLIGRMQAEHLEELEKQIRESGPALI |
Ga0210402_117469331 | 3300021478 | Soil | VRRESSDRSNVTFKIEKHRDRHSTTIRLIGRMRAEHLSELEKQIRESESKIVLDLEEL |
Ga0210410_106544341 | 3300021479 | Soil | MTLKIEKYSDGDSTTIRLIGRMQAEHLEELEKQIRES |
Ga0210409_107891442 | 3300021559 | Soil | MTLKIEKYSVGNSRTLRLIGRLRAEHLPELEKQIRESESKIVLDLEELNLVDV |
Ga0179589_100907901 | 3300024288 | Vadose Zone Soil | MTLKIEKYADGDSTTIRLIGRMQAEHLEELEKQIRESGPALILDLDEVTL |
Ga0209171_100549903 | 3300025320 | Iron-Sulfur Acid Spring | MTLKIETYSDGSGTKIRLIGRMQAEYLEELEKQIKWRKVFNG |
Ga0207663_105253331 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKIERYSDGLSTTIRLIGRMRAEHLEELKTQIRESGSKITLD |
Ga0207664_103980492 | 3300025929 | Agricultural Soil | MTLKIEKYWDGHRTNIRLIGRMRAEHLPELEKQIRESESKIALDLEDLN |
Ga0207704_102363172 | 3300025938 | Miscanthus Rhizosphere | MTLKIERYSDGLSTTIRLIGRMRAEHLEELKTQIRESESK |
Ga0257149_10657392 | 3300026355 | Soil | MTLKIEKYSAGGSTTIRLIGRMRAEHLKELEKQIRESGPAITLDPEEVTL |
Ga0257163_10195491 | 3300026359 | Soil | MTLKIEKYADGDSTTIRLIGRMQTEHLEELEKQIRE |
Ga0257163_10824251 | 3300026359 | Soil | MTLKIEKYSAGDSTTIRLIGRMRAEHLEELEKQIRESRPAIAL |
Ga0257169_10127472 | 3300026469 | Soil | MTLKIEKYWDGYRTSLRLIGRMQAEHLEDLEKEVRESGSPITLDLEELTMVDVEAVRFV |
Ga0257172_10555682 | 3300026482 | Soil | MTLKIEKYSAGDSTTIRLIGRMRAEHLEELEKQIRESGPAIILD |
Ga0257157_10380642 | 3300026496 | Soil | VTFKIEKYRDGHGTTIRLIGRMRAEHLSELEKQIKESESKI |
Ga0257181_10392731 | 3300026499 | Soil | VTFKIEKYRDGHGTTIRLIGRMRAEHLSELEKQIKESESKIV |
Ga0257165_10155981 | 3300026507 | Soil | MTLKIEKYWDGYRTSLRLIGRMQAEHLEDLEKEVRE |
Ga0257168_10608041 | 3300026514 | Soil | MTLKIEKYWDGYRTSLRLIGRMQAEHLEDLEKEVRESGSAITLDLEELTM |
Ga0209418_10930631 | 3300027371 | Forest Soil | VTFKIEKYRDGHSTTIRLIGRMRAEHLSELEKQIKESESKIVLDLEELNLVDV |
Ga0209734_10232382 | 3300027535 | Forest Soil | MTLKIETYFDGSGTKIRLIGRMQAEYLEELEKQIKWRKVFNG |
Ga0209734_10582481 | 3300027535 | Forest Soil | MTFKIEKYSDGYSTTIRLIGRMQAEHLEELEKQIRES |
Ga0209527_11477301 | 3300027583 | Forest Soil | VTFKIEKHRDGHSTTIRLIGRMRAEHLSELEKQIKE |
Ga0209220_11085952 | 3300027587 | Forest Soil | LPDGSNMTLKIEKYWDGHRTNIRLIGRMRAEHLPELEKQI |
Ga0209007_10151552 | 3300027652 | Forest Soil | MTLKIEKYTDGDRTTIRLIGRMQAEHLEELGKQIRESGPAITLDLEE |
Ga0209736_10110732 | 3300027660 | Forest Soil | MTLKIETYFDGSGTKIRLIGRMQAEYLEELEKQFK |
Ga0209009_10329181 | 3300027667 | Forest Soil | MTLKIEKYADGDRTTIRLIGRMQTEHLEELEKQIRE |
Ga0209011_10263042 | 3300027678 | Forest Soil | MTLKIEKYADGDSTTIRLIGRMQAEHLEELEKQIRESGP |
Ga0209693_104039971 | 3300027855 | Soil | VTLKIEKYADRYSTTIRLIGRMRAEHLPELEKQIRDSESKI |
Ga0209701_103775451 | 3300027862 | Vadose Zone Soil | MTLKIERHPEGPGTTIRLIGRVQAEHLAELEKQIRESGSKVVIDLEE |
Ga0209579_103793531 | 3300027869 | Surface Soil | MTLKIEKYSDEYSTTLRLIGRMRAEHVPEMEKQIRESES |
Ga0209283_105406961 | 3300027875 | Vadose Zone Soil | MTLKIEKYSDGNSTTIRLIGRMRAEHLEELEKQIRE |
Ga0209283_108677801 | 3300027875 | Vadose Zone Soil | MTLKIERHPEGPGTTIRLIGRVQVEHLAELEKQIRES |
Ga0209169_104214882 | 3300027879 | Soil | MTFKIEKYSDECGTTIRLIGRMQAEHLAELKTQIKESGSR |
Ga0209590_104687751 | 3300027882 | Vadose Zone Soil | MTLKIEKYSDGNSTTIRLIGRMQAEHLEELEKQIRESGPAI |
Ga0308309_109447721 | 3300028906 | Soil | MTLKIEKYSEGTCTTIRLIGRIQAEHLAELEKQIRESASKIA |
Ga0308309_113691361 | 3300028906 | Soil | MTLKIEKYSDGAGTKIRLIGRMQAEHLAELEKQIRESRLKIVIDMEE |
Ga0073997_122614401 | 3300030997 | Soil | DRSNMTLKIETYSDGSGTKIRLIGRMQAEYLEELEKQIKWRKVFNG |
Ga0170834_1114581541 | 3300031057 | Forest Soil | VTFKIEKYRDEHDTTIRLIGRMRAEHLPDLEKQIRKSESKIVLDLEE |
Ga0170822_116970921 | 3300031122 | Forest Soil | VTFKIEKYRDEHGMTIRLIGRMGAEHLPELEKQIGESESKIV |
Ga0170822_150381991 | 3300031122 | Forest Soil | VSCESSDGSNVTFKIEKHRDRHSTTIRLIGRMRADHLSELEQQIRESESKIVLDLEELNLVDVE |
Ga0307498_102496401 | 3300031170 | Soil | MTLKIERYSDGLSTTIRLIGRMRAEHLEELKTQIGESGSMIALDLE |
Ga0170824_1222850941 | 3300031231 | Forest Soil | LSDGSNMTLKIEKYSDGYSTTIRLIGRMRAEHLVELEKQIRESGP |
Ga0170824_1260930571 | 3300031231 | Forest Soil | MTMTLKIEKYSDAGSTMIRLIGRMRQEHLEELKSQMKDGG |
Ga0302325_129900001 | 3300031234 | Palsa | MTLRIEKVPDGPTTTIRLIGRMRADLLEELNSQIKAS |
Ga0170819_129910521 | 3300031469 | Forest Soil | MTLKIEKYADEYGTTIRLIGRVQAEHLAELETQIKESGSKI |
Ga0170818_1109697561 | 3300031474 | Forest Soil | MTLKIEKHSDGNSTTIRLIGRMRAEHLEKLEKQIHE |
Ga0307476_105704892 | 3300031715 | Hardwood Forest Soil | MRESSRSNMTLKIEKYADGNSTTIRLIGRMQAEHLEELEKQIREP |
Ga0307474_102205271 | 3300031718 | Hardwood Forest Soil | MTLKIERYADGDSTTIRLIGRMQAEHLEELEKQIRESGPAI |
Ga0307474_116482201 | 3300031718 | Hardwood Forest Soil | MTLKIEKYSDEYRTTLRVIGRMHVEHLPELEKQIRECE |
Ga0307469_106540022 | 3300031720 | Hardwood Forest Soil | MTLKIERYSDELSTTIRLIGRMRAEHLEELKTQIRE |
Ga0307468_1017928751 | 3300031740 | Hardwood Forest Soil | MTLRIEKYSDGHGTTIRLIGRMQAHHLPELEKRISEGDQKIVLDLEE |
Ga0307477_107473202 | 3300031753 | Hardwood Forest Soil | MTLKIEKYADEYSTTIRLIGRVQAEHLAELETQIKES |
Ga0307477_110236653 | 3300031753 | Hardwood Forest Soil | MTLRIEKVPDGPSTTIRLIGRMRAEHLEELKAQITGSGAIVV |
Ga0307475_107163171 | 3300031754 | Hardwood Forest Soil | VRRESSGGSNVTFKIEKHCDGHSTTIRLIGRMRAEDLFELEKQIKESESKIVLDLEELNLVDGE |
Ga0307479_110363611 | 3300031962 | Hardwood Forest Soil | VTFKIEKHRDGHSTTIRLIGRMRAEHLSELEKQIKESESKI |
Ga0307479_117844211 | 3300031962 | Hardwood Forest Soil | LKIEKYADRYSTTIRLIGRMRAEHLPELEKQIRESESKIVLDLEELNL |
Ga0307470_100736631 | 3300032174 | Hardwood Forest Soil | MTLKIEKYADEYSTTIRLIGRVQAEHLAELETQIKESGSKIALD |
Ga0307471_1009028792 | 3300032180 | Hardwood Forest Soil | MTLKIEKYSDRNSTTIRLIGRMRAEHLEELEKQIRESGPA |
Ga0307472_1016385472 | 3300032205 | Hardwood Forest Soil | MTLKIGRASDGHRTTIRLIGRMQAEHLEELERQIR |
Ga0372943_0229484_2_118 | 3300034268 | Soil | MTLKIEKYPAGDSTTIRLIGRMRAEHLEELEKQIRESGP |
⦗Top⦘ |