NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F031938

Metagenome / Metatranscriptome Family F031938

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031938
Family Type Metagenome / Metatranscriptome
Number of Sequences 181
Average Sequence Length 43 residues
Representative Sequence MEKRLVTRYAMRSADAADENQRRVEGVFDELAAAKPDNVSY
Number of Associated Samples 164
Number of Associated Scaffolds 181

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.18 %
% of genes near scaffold ends (potentially truncated) 96.69 %
% of genes from short scaffolds (< 2000 bps) 94.48 %
Associated GOLD sequencing projects 160
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.663 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.470 % of family members)
Environment Ontology (ENVO) Unclassified
(27.072 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.961 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.43%    β-sheet: 0.00%    Coil/Unstructured: 69.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 181 Family Scaffolds
PF00903Glyoxalase 5.52
PF07883Cupin_2 5.52
PF01022HTH_5 3.31
PF04828GFA 2.76
PF04075F420H2_quin_red 2.21
PF16859TetR_C_11 2.21
PF12840HTH_20 2.21
PF00795CN_hydrolase 1.66
PF08327AHSA1 1.66
PF12120Arr-ms 1.66
PF03795YCII 1.10
PF00583Acetyltransf_1 1.10
PF05899Cupin_3 1.10
PF07676PD40 1.10
PF01609DDE_Tnp_1 0.55
PF00230MIP 0.55
PF14333DUF4389 0.55
PF00211Guanylate_cyc 0.55
PF03992ABM 0.55
PF00005ABC_tran 0.55
PF00144Beta-lactamase 0.55
PF09413DUF2007 0.55
PF00342PGI 0.55
PF13460NAD_binding_10 0.55
PF13673Acetyltransf_10 0.55
PF13304AAA_21 0.55
PF13427DUF4111 0.55
PF01757Acyl_transf_3 0.55
PF12681Glyoxalase_2 0.55
PF01386Ribosomal_L25p 0.55
PF00437T2SSE 0.55
PF01872RibD_C 0.55
PF00781DAGK_cat 0.55
PF07690MFS_1 0.55
PF13577SnoaL_4 0.55
PF13193AMP-binding_C 0.55
PF09948DUF2182 0.55
PF07040DUF1326 0.55
PF03466LysR_substrate 0.55
PF02653BPD_transp_2 0.55
PF11999Ice_binding 0.55
PF00106adh_short 0.55
PF01152Bac_globin 0.55
PF00501AMP-binding 0.55
PF01195Pept_tRNA_hydro 0.55
PF06224HTH_42 0.55
PF02567PhzC-PhzF 0.55
PF01168Ala_racemase_N 0.55
PF00775Dioxygenase_C 0.55
PF02744GalP_UDP_tr_C 0.55
PF00400WD40 0.55
PF13483Lactamase_B_3 0.55
PF13602ADH_zinc_N_2 0.55
PF02156Glyco_hydro_26 0.55
PF02655ATP-grasp_3 0.55
PF00027cNMP_binding 0.55
PF13302Acetyltransf_3 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 181 Family Scaffolds
COG3791Uncharacterized conserved proteinFunction unknown [S] 2.76
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 1.10
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.10
COG0166Glucose-6-phosphate isomeraseCarbohydrate transport and metabolism [G] 0.55
COG0193Peptidyl-tRNA hydrolaseTranslation, ribosomal structure and biogenesis [J] 0.55
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.55
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.55
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.55
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.55
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.55
COG1825Ribosomal protein L25 (general stress protein Ctc)Translation, ribosomal structure and biogenesis [J] 0.55
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.55
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.55
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.55
COG2367Beta-lactamase class ADefense mechanisms [V] 0.55
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.55
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.55
COG3293TransposaseMobilome: prophages, transposons [X] 0.55
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.55
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.55
COG4124Beta-mannanaseCarbohydrate transport and metabolism [G] 0.55
COG5421TransposaseMobilome: prophages, transposons [X] 0.55
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.55
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.55
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.66 %
UnclassifiedrootN/A17.68 %
PolyangiumgenusPolyangium1.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908009|FWIRA_GRAM18401CL5AVAll Organisms → cellular organisms → Bacteria501Open in IMG/M
2170459007|GJ61VE201C102SAll Organisms → cellular organisms → Bacteria502Open in IMG/M
3300000880|AL20A1W_1257883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300001454|JGI20204J15135_1015733Not Available702Open in IMG/M
3300001537|A2065W1_10656912All Organisms → cellular organisms → Bacteria → Terrabacteria group887Open in IMG/M
3300001538|A10PFW1_10601171Not Available518Open in IMG/M
3300001991|JGI24743J22301_10100787Polyangium → Polyangium aurulentum622Open in IMG/M
3300004463|Ga0063356_104616947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae592Open in IMG/M
3300004480|Ga0062592_101968999All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300005093|Ga0062594_101520463All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300005334|Ga0068869_100539512All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300005341|Ga0070691_11022174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis orientalis517Open in IMG/M
3300005364|Ga0070673_102268836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300005468|Ga0070707_102082006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300005518|Ga0070699_101070358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300005526|Ga0073909_10666878All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005536|Ga0070697_100493011All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300005544|Ga0070686_101724691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300005545|Ga0070695_100441353All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300005558|Ga0066698_10419528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria917Open in IMG/M
3300005558|Ga0066698_10654174All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005559|Ga0066700_10419076All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300005586|Ga0066691_10569209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium675Open in IMG/M
3300005718|Ga0068866_10595314Not Available746Open in IMG/M
3300006028|Ga0070717_10410039All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300006055|Ga0097691_1162572All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300006059|Ga0075017_101305230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300006102|Ga0075015_100189904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1089Open in IMG/M
3300006102|Ga0075015_100672211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300006102|Ga0075015_100724331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300006176|Ga0070765_101407706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300006573|Ga0074055_11288229Not Available506Open in IMG/M
3300006575|Ga0074053_10704768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella655Open in IMG/M
3300006575|Ga0074053_11311914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300006576|Ga0074047_11986315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia909Open in IMG/M
3300006581|Ga0074048_10055463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1361Open in IMG/M
3300006581|Ga0074048_11514861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium633Open in IMG/M
3300006642|Ga0075521_10597484All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300006796|Ga0066665_11167887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300006796|Ga0066665_11487276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300006800|Ga0066660_10348084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1203Open in IMG/M
3300006844|Ga0075428_100292501All Organisms → cellular organisms → Bacteria1752Open in IMG/M
3300006871|Ga0075434_102148982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300006953|Ga0074063_13802639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300006954|Ga0079219_10695443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300009011|Ga0105251_10647634Polyangium → Polyangium aurulentum505Open in IMG/M
3300009093|Ga0105240_10051453All Organisms → cellular organisms → Bacteria5182Open in IMG/M
3300009101|Ga0105247_11063920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium636Open in IMG/M
3300009101|Ga0105247_11853877Not Available503Open in IMG/M
3300009162|Ga0075423_12380441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300009176|Ga0105242_11207526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300009553|Ga0105249_12271849Not Available615Open in IMG/M
3300009610|Ga0105340_1232404All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300009627|Ga0116109_1181509All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300009759|Ga0116101_1104988All Organisms → cellular organisms → Bacteria → Terrabacteria group660Open in IMG/M
3300009811|Ga0105084_1041480All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300009815|Ga0105070_1120973All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300010322|Ga0134084_10136796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium813Open in IMG/M
3300010325|Ga0134064_10326081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300010397|Ga0134124_10325663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1440Open in IMG/M
3300010401|Ga0134121_12642419Not Available546Open in IMG/M
3300011106|Ga0151489_1714333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M
3300011270|Ga0137391_10744052All Organisms → cellular organisms → Bacteria → Terrabacteria group812Open in IMG/M
3300011271|Ga0137393_11291992All Organisms → cellular organisms → Bacteria → Terrabacteria group618Open in IMG/M
3300012010|Ga0120118_1109048Not Available670Open in IMG/M
3300012010|Ga0120118_1119001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300012011|Ga0120152_1037793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1647Open in IMG/M
3300012011|Ga0120152_1038914All Organisms → cellular organisms → Bacteria → Terrabacteria group1613Open in IMG/M
3300012014|Ga0120159_1018975All Organisms → cellular organisms → Bacteria2587Open in IMG/M
3300012201|Ga0137365_10370174All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300012208|Ga0137376_10232029All Organisms → cellular organisms → Bacteria → Terrabacteria group1599Open in IMG/M
3300012208|Ga0137376_11261387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300012211|Ga0137377_11833086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium525Open in IMG/M
3300012349|Ga0137387_10933487Not Available626Open in IMG/M
3300012892|Ga0157294_10183948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → Deinococcus alpinitundrae604Open in IMG/M
3300012917|Ga0137395_10014750All Organisms → cellular organisms → Bacteria4388Open in IMG/M
3300012930|Ga0137407_11638955Not Available613Open in IMG/M
3300012955|Ga0164298_11262295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300012985|Ga0164308_11279070Not Available665Open in IMG/M
3300012987|Ga0164307_10530153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium895Open in IMG/M
3300013307|Ga0157372_12435746Not Available601Open in IMG/M
3300013768|Ga0120155_1174978All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300013770|Ga0120123_1052505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium877Open in IMG/M
3300014829|Ga0120104_1016339All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1316Open in IMG/M
3300014968|Ga0157379_12333536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300015358|Ga0134089_10346901All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300015359|Ga0134085_10122052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300015359|Ga0134085_10128368All Organisms → cellular organisms → Bacteria → Terrabacteria group1066Open in IMG/M
3300015359|Ga0134085_10267697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300015373|Ga0132257_103546871Not Available568Open in IMG/M
3300015374|Ga0132255_101563666All Organisms → cellular organisms → Bacteria → Terrabacteria group999Open in IMG/M
3300017943|Ga0187819_10715253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300017965|Ga0190266_11250614All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300018030|Ga0187869_10577495All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300018047|Ga0187859_10592125All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018061|Ga0184619_10418446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300018071|Ga0184618_10371188All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300018071|Ga0184618_10419981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300018079|Ga0184627_10302260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium839Open in IMG/M
3300018081|Ga0184625_10336520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300019361|Ga0173482_10333526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → unclassified Propionibacteriaceae → Propionibacteriaceae bacterium681Open in IMG/M
3300019786|Ga0182025_1039785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1508Open in IMG/M
3300020016|Ga0193696_1017699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1920Open in IMG/M
3300021080|Ga0210382_10458470All Organisms → cellular organisms → Bacteria → Terrabacteria group565Open in IMG/M
3300021082|Ga0210380_10515357Not Available548Open in IMG/M
3300021344|Ga0193719_10239635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium769Open in IMG/M
3300022694|Ga0222623_10273050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae651Open in IMG/M
3300023058|Ga0193714_1044662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300023259|Ga0224551_1013709All Organisms → cellular organisms → Bacteria → Terrabacteria group1361Open in IMG/M
3300024224|Ga0247673_1074682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300024295|Ga0224556_1003802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4243Open in IMG/M
3300025326|Ga0209342_11191522Not Available563Open in IMG/M
3300025579|Ga0207927_1076151Not Available803Open in IMG/M
3300025634|Ga0208589_1097764All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300025878|Ga0209584_10443831All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300025893|Ga0207682_10535929Not Available554Open in IMG/M
3300025899|Ga0207642_10397184Not Available824Open in IMG/M
3300025924|Ga0207694_11229969Polyangium → Polyangium aurulentum634Open in IMG/M
3300025934|Ga0207686_10580247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium880Open in IMG/M
3300025934|Ga0207686_11438682Not Available568Open in IMG/M
3300025935|Ga0207709_11351921Not Available589Open in IMG/M
3300026088|Ga0207641_10511622Not Available1167Open in IMG/M
3300026088|Ga0207641_12229777All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300026089|Ga0207648_12162461All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300026142|Ga0207698_11808159Not Available626Open in IMG/M
3300026300|Ga0209027_1197834All Organisms → cellular organisms → Bacteria → Terrabacteria group650Open in IMG/M
3300026328|Ga0209802_1330891All Organisms → cellular organisms → Bacteria → Terrabacteria group504Open in IMG/M
3300026799|Ga0207485_100124All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300027648|Ga0209420_1093678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria858Open in IMG/M
3300027738|Ga0208989_10014476All Organisms → cellular organisms → Bacteria2702Open in IMG/M
3300027882|Ga0209590_10469629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300027903|Ga0209488_10046127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3205Open in IMG/M
3300027910|Ga0209583_10771269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300028572|Ga0302152_10278207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium548Open in IMG/M
3300028709|Ga0307279_10084150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300028716|Ga0307311_10086876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium863Open in IMG/M
3300028719|Ga0307301_10269020Not Available558Open in IMG/M
3300028722|Ga0307319_10170206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300028780|Ga0302225_10133532All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300028791|Ga0307290_10101475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1049Open in IMG/M
3300028793|Ga0307299_10110499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1029Open in IMG/M
3300028802|Ga0307503_10411702All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300028802|Ga0307503_10580259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300028803|Ga0307281_10237554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces666Open in IMG/M
3300028807|Ga0307305_10347953All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300028819|Ga0307296_10121162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1406Open in IMG/M
3300028828|Ga0307312_10160167All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300028860|Ga0302199_1233516Not Available556Open in IMG/M
3300028875|Ga0307289_10263507Not Available709Open in IMG/M
3300028878|Ga0307278_10064951All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300028906|Ga0308309_11483677All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300029952|Ga0311346_10035582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7516Open in IMG/M
3300029984|Ga0311332_11006722All Organisms → cellular organisms → Bacteria → Terrabacteria group669Open in IMG/M
3300029994|Ga0302283_1350017All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300031058|Ga0308189_10272161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300031092|Ga0308204_10082376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium853Open in IMG/M
3300031093|Ga0308197_10215682All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300031238|Ga0265332_10343638All Organisms → cellular organisms → Bacteria → Terrabacteria group616Open in IMG/M
3300031251|Ga0265327_10214207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium868Open in IMG/M
3300031455|Ga0307505_10682244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300031474|Ga0170818_103325473All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300031671|Ga0307372_10286900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium941Open in IMG/M
3300031671|Ga0307372_10333293Not Available825Open in IMG/M
3300031708|Ga0310686_102589236All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300031712|Ga0265342_10517581Not Available607Open in IMG/M
3300031747|Ga0318502_10309496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300031765|Ga0318554_10197966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1143Open in IMG/M
3300031769|Ga0318526_10118763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1065Open in IMG/M
3300031862|Ga0315280_10304695Not Available795Open in IMG/M
3300031879|Ga0306919_10527050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria911Open in IMG/M
3300031946|Ga0310910_10934791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300031962|Ga0307479_11735187Not Available577Open in IMG/M
3300032000|Ga0310903_10781266All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300032043|Ga0318556_10039382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2243Open in IMG/M
3300032067|Ga0318524_10149691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1179Open in IMG/M
3300032163|Ga0315281_11205008All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300032177|Ga0315276_12231501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300032893|Ga0335069_10776150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1082Open in IMG/M
3300034129|Ga0370493_0301609Not Available550Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.08%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost6.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.42%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.31%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.76%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.21%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.21%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.66%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.66%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.66%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.10%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.10%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.10%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.10%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.10%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.10%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.10%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.10%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.10%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.10%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.10%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.55%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.55%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.55%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.55%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.55%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.55%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.55%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.55%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.55%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.55%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908009Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2EnvironmentalOpen in IMG/M
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001454Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012EnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009627Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025427Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025579Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026799Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06.2A2a-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031671Soil microbial communities from Risofladan, Vaasa, Finland - OX-1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300034129Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIRA_070795002124908009SoilMEKRLVTRYAMRSSGDADENQRRVEDVFAELAETRPDNVSYIV
L02_027699702170459007Grass SoilMEKRLVTRYAMQSADDADENQRRIEGVFAELAANKPDNVSYIVL
AL20A1W_125788313300000880PermafrostMQKRLVTRYAMPSAEAADENQRRVEGVFAELEATTPDSVSY
JGI20204J15135_101573323300001454Arctic Peat SoilVEERLVARYATQSHAATDENQKRIEGVFEELDLTKPDNVSD
A2065W1_1065691223300001537PermafrostMQKRLVTRYAMQSAEAANENQRRVEGVFDELAATKPDNV
A10PFW1_1060117123300001538PermafrostVQKRLVTRYAMRSAEAADENQKRVEGVFAEPATAKPDNVSYIV
JGI24743J22301_1010078723300001991Corn, Switchgrass And Miscanthus RhizosphereMEKRLVTRYAMQSAEAADENQRRVEGVFDELATTNPDNVSY
Ga0063356_10461694713300004463Arabidopsis Thaliana RhizosphereMQKRLVTRYATRSAEAADENQRRVEGVFDELAATKPDTVSYIVLRLADD
Ga0062592_10196899923300004480SoilVEKRLVTRYAMRSAEEADENQRRIEGVFRELATAQPDNVSYLVLRLA
Ga0062594_10152046333300005093SoilMEKRLVTRYAMRSVEAADENQRRVEGVFDELAATKPETVSYIVLRLADDSFV
Ga0068869_10053951233300005334Miscanthus RhizosphereMEKRLVTRYAMRSVEAADENQRRVEGVFDELAATKPETVSYIVLR
Ga0070691_1102217413300005341Corn, Switchgrass And Miscanthus RhizosphereMHKRLVTRYAMKSPEAADENQQRIERVFEELAAAKPDTVSYIV
Ga0070673_10226883613300005364Switchgrass RhizosphereVEKRLVTRYAMWSAEAADENQRRVEGVFDELAATKPDNVSYIVLRL
Ga0070707_10208200613300005468Corn, Switchgrass And Miscanthus RhizosphereMQKRLVTRYAMRSAEVADENQRRVEGVFAELSAARPDTVSYIVLRL
Ga0070699_10107035813300005518Corn, Switchgrass And Miscanthus RhizosphereVEKRLVTRYAMRSAEAADENQRRVEGVFDELAVSEPDNVS
Ga0073909_1066687823300005526Surface SoilMEKRLVTRYATKSAEAADENQRRVEAVFDELAAAK
Ga0070697_10049301133300005536Corn, Switchgrass And Miscanthus RhizosphereVQKRLVTRYAMPTAEAANENQRRIEGVFAELAAAKPNNVSYIVLRLADDSF
Ga0070686_10172469123300005544Switchgrass RhizosphereVEKRLVTRYAMWSAEAADENQRRVEGVFDELAATKPDNVS
Ga0070695_10044135313300005545Corn, Switchgrass And Miscanthus RhizosphereMQKRLVTRYAMRSVEAADENQRRVEGVFAELAATKPDNVSYIVLRL
Ga0066698_1041952823300005558SoilMQKRLVTRYAMRSAEAANENQQRVEGVFAELAASKPDSVS
Ga0066698_1065417423300005558SoilLQKRLVTRYAMRSAEAANENQQRVEGVFAELAASKPDSVS
Ga0066700_1041907613300005559SoilVEKRLVTRYAMRSAEEADENQRRVEGVFDELAAGKPDNVSYIVLRLADDSF
Ga0066691_1056920913300005586SoilMHKRLVTSYATQNSIAADENQRRIEAVFTELAANQP
Ga0068866_1059531413300005718Miscanthus RhizosphereVEKRLVTRYAMRSAEDADENQRRVEGVFQELAAAQP
Ga0070717_1041003933300006028Corn, Switchgrass And Miscanthus RhizosphereMQKRLVTRYATRSPEAAAENQRRVESVFAELAETKPANVSYLVL
Ga0097691_116257223300006055Arctic Peat SoilMEKRLVTRYAMRSAEAADENERRVEGVFAELAANKPDNVSYIV
Ga0075017_10130523013300006059WatershedsMEKRLVTQYAMKSSDAADENQRRVEAVFAELAATAPPN
Ga0075015_10018990413300006102WatershedsVEKRLVTRYAMKSAEAADENQRRVEGVFAELARAKPDSVSYIV
Ga0075015_10067221113300006102WatershedsMNKRLVTRYWTQSADAAEENQRRVEAVFAELAETRPDTVSYLVL
Ga0075015_10072433133300006102WatershedsMQKRLVTRYAMQSADAADENQKRVEGVFAELAANKPDNVSYIVL
Ga0070765_10140770613300006176SoilMEKRLVTRYATRSPDAADENQKRIEGVFTELADAKPDNV
Ga0074055_1128822923300006573SoilMEKRLVTRYAMRSAAAADENQRRVEGVFAELAAAK
Ga0074053_1070476813300006575SoilMHKRLVTRYATSSRAAADENQRRVEAVFDELAATKPDI
Ga0074053_1131191423300006575SoilMEKRLVTRYAMRSAAAADENQRRVEGVFAELAAAKP
Ga0074047_1198631523300006576SoilMEKRLVTRYAMRSAAAADENQRRVEGVFAELAAAKPDSVSYIVLRLADDS
Ga0074048_1005546313300006581SoilMEKRLVTRYAMRSTEAADENQRRVEGVFAELNATKPD
Ga0074048_1151486123300006581SoilMEKRLVTRYAMQSAEAADENQRRVEGVFEELSTTKPDNVSYIVLRLADDSF
Ga0075521_1059748413300006642Arctic Peat SoilMQKRLVRRYATQLAEAANENQRRVEGVFDELSATRPDMVSYIVLRLEDDHLCTC
Ga0066665_1116788723300006796SoilMEKRLVTRYAMRSAEAANENQRRVEGVFDELAAATPGNVSYSV
Ga0066665_1148727613300006796SoilMEKRLVTRYATRSAEAADENQQRVEAVFDELAAAAPDNVSYIVLRLA
Ga0066660_1034808433300006800SoilMQKRLVTRYAMQSAEAADENQRRVEGVFAELAEAGPENVSYIVLRLADD
Ga0075428_10029250113300006844Populus RhizosphereVEKRLVTRYAMRSAEAADENQRRVEGVFEELADTRPDNVSYLVL
Ga0075434_10214898213300006871Populus RhizosphereMEKRLVTRYASRSPEAADENQRRVEAVFDELAAAK
Ga0074063_1380263923300006953SoilMEKRLVTRYASRSPEAADENQRRIEAVFDELAASKPDNVSYIVL
Ga0079219_1069544323300006954Agricultural SoilVQFRLVTRYASRSAEAADDNQRRVEAVFAELDRARPGNVSYLVLRL
Ga0105251_1064763423300009011Switchgrass RhizosphereMEKRLVTRYAMQSAEAADENQRRVEGVFDELATTNPDN
Ga0105240_1005145313300009093Corn RhizosphereVTSNLQEAHVQKRLVTRYAMRSTGDADENQRRIEGVFADLAASQPDNVSYVV
Ga0105247_1106392023300009101Switchgrass RhizosphereVQFRLVTRYASRSAEAADDNQRRVEAVFAELDRTRPDNVSYLVM
Ga0105247_1185387713300009101Switchgrass RhizosphereMEKRLVTRYAMRSSEDADENQRRVEAVFAQLAEDAPNN
Ga0075423_1238044123300009162Populus RhizosphereMPQPERSNPVEKRLVTRYAMRSAEAADENQRRVEGVFEELADTGPDNVSYLVLRL
Ga0105242_1120752613300009176Miscanthus RhizosphereMQKRLVTRYAMQSAEEADENQRRVEGVFAELEATAPDNVS*
Ga0105249_1227184913300009553Switchgrass RhizosphereMTNSEPVQYRLVTRYASSSADAADENQRRIEGVFAELAENAPDNVSYI
Ga0105340_123240423300009610SoilMQERLVTRYAMPSTEAADENQRRVEGVFAELDTSKPDNVSYLVLRLA
Ga0116109_118150913300009627PeatlandMMARNKENSMEKRLVTQYATKSSDDADENQRRIEGVFAELAEVQPDNV
Ga0116101_110498823300009759PeatlandVEKRLVTRYATKSKADADENQRRVEGVFEELALNRPYDVSYIV
Ga0105084_104148033300009811Groundwater SandMEKRLVTRYATRSAEAANENQRRVEGVFDELAATKPDNV
Ga0105070_112097313300009815Groundwater SandVSQEPGIGERSNVKKRLVTRYAMRSAEAANENQRRVEGVFDELAAAKPDNVS
Ga0134084_1013679633300010322Grasslands SoilMEKRLVTRYATKSPEAADENQRRIEGVFEDLAANRPGTVS
Ga0134064_1032608123300010325Grasslands SoilMEKRLVTCYATRSVEAADENQRRVEAVFDELEAAKPDSVSYI
Ga0134124_1032566313300010397Terrestrial SoilVQFRLVTRYASRSAEAADDNQRRVEAVFAELDRTRPDNVSYLVMRLA
Ga0134121_1264241923300010401Terrestrial SoilTISQPVQYRLVTRYASSSADAADDNQRRIEGVFAELAENAPDCVWCP*
Ga0151489_171433313300011106SoilVQFRLVTRYASRSAEAADDNQRRVEAVFAELDQTRPGNVSYLVL
Ga0137391_1074405223300011270Vadose Zone SoilMQKRLVTRYAMQSSEAADENQQRVEGVFSELAATAPDNVSYIVLRLAD
Ga0137393_1129199223300011271Vadose Zone SoilVEKRLVTRYAMRSADAADENQRRVEGVFAELAASKPDSVSY
Ga0120118_110904813300012010PermafrostVQKRLVTRYAMRSAEAADENQQRIEGVFAELAASKPDTVSY
Ga0120118_111900113300012010PermafrostMQKRLVTSYAMQSPEAADENQRRVEGVFAELAANRPDNVSYIVLR
Ga0120152_103779323300012011PermafrostMQKRLVTRYAMQSAEAANENQRRVEGVFDELAATKPDNVSYI
Ga0120152_103891423300012011PermafrostMHKRLVTRYATQSSVAADENQRRIEGVFAELAANKPDNVSYIVLRL
Ga0120159_101897553300012014PermafrostMQKRLVTRYAMQSAEAADENQRRVEGVFAELVATAP
Ga0137365_1037017413300012201Vadose Zone SoilVKKRLVTRYAMRSAEAANENQRRVEGVFDELAAAKPDSVSYMVLRLADDSF
Ga0137376_1023202923300012208Vadose Zone SoilMHKRLVTSYATQNSIAADENQRRIEAVFAELAKNQPD
Ga0137376_1126138713300012208Vadose Zone SoilMEKRLVTRYATRSVEAADENQRRVEAVFDELETGKPDNVSYIVLRLADESF
Ga0137377_1183308623300012211Vadose Zone SoilVQFRLVTRYARRSAGAAEDNQRRVEAVFAELDRARPGNVSYLVLRLADDSFVH
Ga0137387_1093348713300012349Vadose Zone SoilMQKRLVTHYGMRSAEAADENQRRVEGVFAELGETKPDSVSYIVLRLADD
Ga0157294_1018394813300012892SoilMEKRLVTRYAMRSVEAADENQRRVEGVFDELATTKPDTVSYIVLRLADDS
Ga0137395_1001475043300012917Vadose Zone SoilMHKRLVTRYATQSSIAADENQRRIEGVFAELAANKPDNVSYIVLRL
Ga0137407_1163895513300012930Vadose Zone SoilMEKRLVTRYAMASAEAADENQRRVEGVFADLAAAKPGNVSYLVL
Ga0164298_1126229513300012955SoilMQKRLVTRYAMPSAEAADENQRRVEGLFAELEAATPDNVSY
Ga0164308_1127907023300012985SoilMTNSEPVQYRLVTRYASSSADAADENQRRIEGVFAELAENAPDNVSYTVLRLQDDSFL
Ga0164307_1053015333300012987SoilMQKRLVTRYATQSAEAADENQRRVEGVFGELAASKPG
Ga0157372_1243574613300013307Corn RhizosphereMHKRLVTRYAMKSAEDAEENQRRVEGVFADLEQTKPDNVSYLVLRL
Ga0120155_117497813300013768PermafrostMQKRLVTRYAMQSPEAADENQRRVEGVFAELATNTPDNVSY
Ga0120123_105250533300013770PermafrostMQKRLVTRYAMRSAEAADENQRRVEGVFDELAADN
Ga0120104_101633913300014829PermafrostMQKRLVTRYATKSAEAADENQRRGGAVFSELAGAQPDK
Ga0157379_1233353623300014968Switchgrass RhizosphereVQKRLVTRYAMPSAEAADENQRRVEGVFDELAETRPDSVSYIVLRLAD
Ga0134089_1034690123300015358Grasslands SoilMEKRLVTRYAMRSAEEADENQQRVEGVFAELAVSKPDNVSYI
Ga0134085_1012205223300015359Grasslands SoilMQKRLVTRYAMRSAEAANENQRRIEGVFDELAAAKPDNVSY
Ga0134085_1012836813300015359Grasslands SoilMEKRLVTRYATKSPEAADENQRRIEGVFEDLAANRPGIVSYIVLR
Ga0134085_1026769713300015359Grasslands SoilMEKRLVTRYAMRSVEAANENQRRVEGVFAELAAAEPDSVSYI
Ga0132257_10354687123300015373Arabidopsis RhizosphereMEKRLVTRYAMRSSEDADENQRRVEAVFAQLAEDAPNNVSYI
Ga0132255_10156366613300015374Arabidopsis RhizosphereMEKRLVTRYDTKSAEAADENQRRVEAVFEELAATKPDN
Ga0187819_1071525323300017943Freshwater SedimentMQKRLVTRYATKSPADTDENQRRIESVFAELKETQ
Ga0190266_1125061423300017965SoilMQKRLVTRYATQSAEAADENQRRVEGVFDELVATKPDNVSYIVLR
Ga0187869_1057749523300018030PeatlandMKKRLVTRYATQSTEAADENERRVKGVFAELEASKPDNVSYIV
Ga0187859_1059212513300018047PeatlandMQKRLVTRYATKSTEAADENELRVKGVFAELEANKPDNVSYIVLRL
Ga0184619_1041844613300018061Groundwater SedimentMEKRLVTRYAMRSADAADENQRRVEGVFDELAAAK
Ga0184618_1037118813300018071Groundwater SedimentMKKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPDSVSYIVLRLA
Ga0184618_1041998123300018071Groundwater SedimentMQKRLVTRYAMTSAEAADENQRRVEGVFAELVANKPDSVSYIVLRLAD
Ga0184627_1030226013300018079Groundwater SedimentMKKRLVTRYAMRSAEAANENQRRVEGVFDELAAAKPDS
Ga0184625_1033652033300018081Groundwater SedimentMEKRLVTRYAMRSAEAADENQRRVEVVFDELAAAKPDNVSYIVLRLAD
Ga0173482_1033352613300019361SoilMTNSEPVQYRLVTRYATSSADAADENQRRIEGVFAELADNGPDNVSYIAAVG
Ga0182025_103978513300019786PermafrostMEKRLVTRYSTKSKDDADENQRRVEAVFVELNESKPDNVSQRQLHRPS
Ga0193696_101769953300020016SoilMEKRLVTRYAMQSAEAADENQRRVEGVFDELATTNPDNVSYIVLRLAD
Ga0210382_1045847013300021080Groundwater SedimentMEKRLVTRYSMQSAEAADENQRRVEGVFDELAETKPESVSYIVLRLAD
Ga0210380_1051535723300021082Groundwater SedimentVEKRLVTRYAMRSAEEADENQRRVEGVFQELAATQPD
Ga0193719_1023963513300021344SoilMQKRLVTRYAMQSAEAADENQRRVEGVFAELEATTPDNVSY
Ga0222623_1027305023300022694Groundwater SedimentMQKRLVTRYAMQSAESADENQRRVEGVFVELEATTPD
Ga0193714_104466213300023058SoilMQKRLVTRYAMQSAEASDENQRRVEGVFAELEATTPDNVSYIVL
Ga0224551_101370913300023259SoilVEKRLVTRYATKSEVAADENQKRIEGVFEELDNTKPDNVSYI
Ga0247673_107468223300024224SoilMEKRLVTRYAMRSAEAANENQRRVEGVFDELAAAKPDNVSYIVLRLA
Ga0224556_100380253300024295SoilVEKRLVTRYATQSQVAADENQKRIEGVFEELAKKRPDNV
Ga0209342_1119152213300025326SoilMKKRLVTRYAMRSAEAANENQRRVEAVFDELAAAKPDS
Ga0208077_106239013300025427Arctic Peat SoilLNEGIHVEKRLVTRYATKSPDAADENQRRIEGVFDELSQ
Ga0207927_107615113300025579Arctic Peat SoilMEKRLVTRYAMRSAEAADENERRVEGVFAELAANKPDNVSYIVLRL
Ga0208589_109776433300025634Arctic Peat SoilMHKRLVTRYATKSKESADENQRRVEGVFAELEANK
Ga0209584_1044383113300025878Arctic Peat SoilMQKRLVRRYATQLAEAANENQRRVEGVFDELSATRPDMVS
Ga0207682_1053592913300025893Miscanthus RhizosphereMEKRLVTRYAMRSVEAADENQRRVEGVFDELAATKPETV
Ga0207642_1039718423300025899Miscanthus RhizosphereVEKRLVTRYAMRSAEDADENQRRVEGVFQELAAAQPHNVSYLV
Ga0207694_1122996913300025924Corn RhizosphereMEKRLVTRYAMQSAEAADENQRRVEGVFDELATTNPDNVSYIV
Ga0207686_1058024723300025934Miscanthus RhizosphereMQKRLVTRYAMRSAEEADENQRRVEGVFAELEATAPDNVS
Ga0207686_1143868213300025934Miscanthus RhizosphereMEKRLVTRYAVRSAEDADENQRRIEGVFAELAEAKPDNVSY
Ga0207709_1135192113300025935Miscanthus RhizosphereMEKRLVTRYAMRSSEDADEYQRRVEAVFAQLAEDAPNNVSYI
Ga0207641_1051162213300026088Switchgrass RhizosphereVEKRLVTRYAMQSPEAADENQRRVEGVFAELEAAKPGNVSYLVFRLVD
Ga0207641_1222977713300026088Switchgrass RhizosphereMEKRLVTSYAMRSAEDADENQRRVEGVFAELAEAKPEN
Ga0207648_1216246123300026089Miscanthus RhizosphereVEKRLVTRYAMRSAEDADENQRRVEGVFQELAAAQPDNVSYLVL
Ga0207698_1180815923300026142Corn RhizosphereVTNSEPVQYRLVTRYATSSADAADENQRRIEGVFAELADNGPDNVSYIAAVG
Ga0209027_119783423300026300Grasslands SoilVEKRLVTRYAMRSAEAADENQRRVEGVFDELAAARPDNVSYIVLR
Ga0209802_133089123300026328SoilVEKRLVTRYAMRSADAADENQRRVEGVFAELAASKPDSVSYIV
Ga0207485_10012413300026799SoilMQKRLVTRYAMRSAEAAAENQRRVEGVFEELAAAKPDNVSYIVLRLA
Ga0207726_103841013300027045Tropical Forest SoilMEKRLVTRYASKSSEAADENERRIRDVFADLEQSRP
Ga0209420_109367833300027648Forest SoilMQKRLVTRYATKSKEAADENQRRVEGVFAELEANTP
Ga0208989_1001447613300027738Forest SoilMHKRLVTRYATQSAIAADENQRRIEAVFGDLAAKKPDNVSYIVLRL
Ga0209590_1046962913300027882Vadose Zone SoilMQKRLVTRYSMRSTEAANENQRRVEGVFDELAATEPG
Ga0209488_1004612743300027903Vadose Zone SoilMQKRLVTRYAMRSAEAADENQQRVEGVFAELTASKPDNVSYIVLRLAD
Ga0209583_1077126913300027910WatershedsMHKRLVTRYAMKSAEDADENQRRVEGVFAELAANQPDTVSYIV
Ga0302152_1027820723300028572BogMFISMEGCNVEKRLFTRYATSSQVAADENQKRIEGVFEELAQKKPDNVSYIVLRLADD
Ga0307279_1008415023300028709SoilMQKRLVTRYAMQSAEAADENQRRVEGVFAELEATTPDNVSYIVLRL
Ga0307311_1008687633300028716SoilMQKRLVTRYAMRSAEEADENQRRVEGVFAELEATTPDNVSYIVLRLAD
Ga0307301_1026902013300028719SoilMEKRLVTRYAMQSAEAADENQRRVEGVFDELVANKPD
Ga0307319_1017020613300028722SoilMEKRLVTRYAMKSAETADENQRRVEGVFDELAAAKP
Ga0302225_1013353213300028780PalsaMQKRLVTRYATKSTEAADENQRRVEGVFAELEANKPGNVSYIV
Ga0307290_1010147513300028791SoilMQKRLVTRYAMQSAEAADENQRRVEGVFAELDSTA
Ga0307299_1011049913300028793SoilMEKRLVTRYAMRSADAADENQRRVEGVFDELAAAKPDNVSY
Ga0307503_1041170213300028802SoilMEKRLVTRYAMRSAEDADENHRRIEGVFAELAEAKPDNVSYIVL
Ga0307503_1058025913300028802SoilMQKRLVTRYAMQSAEAADENQRRVEGVSAELEATKPGNVS
Ga0307281_1023755423300028803SoilMTTSQPVQFRLVTRYASSSTEAADENQRRIEGVFAELADNAPDNVSY
Ga0307305_1034795313300028807SoilMEKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPDNVSYVVL
Ga0307296_1012116213300028819SoilMEKRLVTRYAMSSPEAANENQRRVEGVFAELAAAQPD
Ga0307312_1016016733300028828SoilVNKRLVTRYAMRSTEAADENQRRVEGVFADLAVTKPDNVSYIVLRL
Ga0302199_123351623300028860BogVEKRLVTRYATKSRADADENQKRIEGVFTELALNQ
Ga0307289_1026350713300028875SoilMKKRLVTRYAMRSAEAADENQRRVEGVFDELTAAKPDSVSYIVLRLADD
Ga0307278_1006495113300028878SoilVKKRLVTRYATRSAEAANENQRRVEGVFDALAAAKPDSVSYIVLRLADG
Ga0308309_1148367723300028906SoilMHKRLVTRYATKSKEAADDNQRRAEGVFAELEANKPGN
Ga0311346_1003558293300029952BogVEKRLFTRYATSSQVAADENQKRIEGVFEELAQKKPDNVSYIVLRLADD
Ga0311332_1100672223300029984FenMQKRLVTRYAMRSAEDADENQRRVEAVFDKLAAAEPDTVSYIVLRLA
Ga0302283_135001713300029994FenVEKRLVTRYATKSRADADENQKRIEGVFTELALNQPEDVSYIVLRLADDSFVH
Ga0308189_1027216133300031058SoilMQKRLVTRYAMQSAEASDENQRRVEGVFAELEATTPD
Ga0308204_1008237613300031092SoilMQKRLVTRYAMQSAEAADENQRRVEGVFAELEAAAPDN
Ga0308197_1021568213300031093SoilMEKRLVTRYAMPSGEAADENQRRVEGVFDELVETKPDNV
Ga0265332_1034363823300031238RhizosphereVQKRLVTRYAMQSAEAADENQRRVEGVFAELAETNPETGSYIVLRLADDSFV
Ga0265327_1021420723300031251RhizosphereVQKRLVTRYAMRSADDADENQRRIEGVFEALAADQPDNVSYLV
Ga0307505_1068224413300031455SoilMEKRLVTRYAMRSAEEADENQRRVEGVFEELAATRPGNVSYIVLR
Ga0170818_10332547313300031474Forest SoilMHKRLVTRYATQSQEAADENQRRVEGVFAELEANKPDNVS
Ga0307372_1028690013300031671SoilMQKRLVTHDATRSAAADENQRRVEAVFADLAASRPSSV
Ga0307372_1033329323300031671SoilMHKRLVTRYATKSKEAADENQRRVEGVFAELEANKPGNVSYIVL
Ga0310686_10258923613300031708SoilMEKRLVTRYRTSSQAAADENQKRIEGVFEELAATKPDNVSYIVLRLA
Ga0265342_1051758123300031712RhizosphereMHKRLVTRYAMKSADDADENQRRVEGVFAELAANKPDNV
Ga0318502_1030949633300031747SoilMQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVFRLADGS
Ga0318554_1019796643300031765SoilMQKRLVTRYATNSPADADENQRRVEGVFAALEASQPDNVSY
Ga0318526_1011876343300031769SoilMQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVFRL
Ga0315280_1030469523300031862SedimentMKKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPDSVSYIVLRLAD
Ga0306919_1052705033300031879SoilMQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVLR
Ga0310910_1093479133300031946SoilMQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVFRLADG
Ga0307479_1173518723300031962Hardwood Forest SoilMEKRLVTRYATRSAEAADENQRRVEAVFEELAAAQPDNVSYLVLR
Ga0310903_1078126613300032000SoilMQKRLVTRYAMPTTEAADENQRRVAGVFAELDTAKPDNVSYIV
Ga0318556_1003938213300032043SoilMQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVLRL
Ga0318524_1014969113300032067SoilMQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNV
Ga0315281_1120500823300032163SedimentMKKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPDSVSYI
Ga0315276_1223150113300032177SedimentMKKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPD
Ga0335069_1077615033300032893SoilMEKRLVTRYATTSQDAAHENQRRIEGVFTELEATRPDNVSYIVLRL
Ga0370493_0301609_418_5493300034129Untreated Peat SoilMSAPIQYRLVTRYTAASPETADENQRRIEKVFAELDAAQPDNVS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.