NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F031975

Metagenome / Metatranscriptome Family F031975

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031975
Family Type Metagenome / Metatranscriptome
Number of Sequences 181
Average Sequence Length 50 residues
Representative Sequence MKRAFLLIVVPALLVALGFAQTPAASINTDQTNIKGCLGGSDGNYTVV
Number of Associated Samples 146
Number of Associated Scaffolds 181

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 86.74 %
% of genes from short scaffolds (< 2000 bps) 76.80 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.768 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(10.497 % of family members)
Environment Ontology (ENVO) Unclassified
(29.282 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.094 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 25.00%    β-sheet: 0.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 181 Family Scaffolds
PF08282Hydrolase_3 3.31
PF01850PIN 2.76
PF01144CoA_trans 1.10
PF00486Trans_reg_C 1.10
PF07238PilZ 1.10
PF14559TPR_19 1.10
PF02367TsaE 1.10
PF00196GerE 0.55
PF08281Sigma70_r4_2 0.55
PF00702Hydrolase 0.55
PF15594Imm50 0.55
PF15919HicB_lk_antitox 0.55
PF00392GntR 0.55
PF13536EmrE 0.55
PF13517FG-GAP_3 0.55
PF00144Beta-lactamase 0.55
PF01238PMI_typeI_C 0.55
PF14534DUF4440 0.55
PF13358DDE_3 0.55
PF02577BFN_dom 0.55
PF11984DUF3485 0.55
PF04185Phosphoesterase 0.55
PF00515TPR_1 0.55
PF07885Ion_trans_2 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 181 Family Scaffolds
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 3.31
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 3.31
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 3.31
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 3.31
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 3.31
COG0802tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaETranslation, ribosomal structure and biogenesis [J] 1.10
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 1.10
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 1.10
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 1.10
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 0.55
COG1482Mannose-6-phosphate isomerase, class ICarbohydrate transport and metabolism [G] 0.55
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.55
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.55
COG2367Beta-lactamase class ADefense mechanisms [V] 0.55
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.77 %
UnclassifiedrootN/A18.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10340341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7530Open in IMG/M
3300001413|JGI20180J14839_1005455All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300001471|JGI12712J15308_10028694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1441Open in IMG/M
3300001593|JGI12635J15846_10511856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7707Open in IMG/M
3300003368|JGI26340J50214_10153303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7576Open in IMG/M
3300003505|JGIcombinedJ51221_10193305All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300004156|Ga0062589_100319386All Organisms → cellular organisms → Bacteria → Acidobacteria1212Open in IMG/M
3300004643|Ga0062591_100811135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8865Open in IMG/M
3300005434|Ga0070709_10662409Not Available809Open in IMG/M
3300005435|Ga0070714_100163327All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300005435|Ga0070714_100577184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1078Open in IMG/M
3300005436|Ga0070713_100069888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2963Open in IMG/M
3300005541|Ga0070733_11004282All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7560Open in IMG/M
3300005542|Ga0070732_10248435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1065Open in IMG/M
3300005542|Ga0070732_10506131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7731Open in IMG/M
3300005577|Ga0068857_100530256All Organisms → cellular organisms → Bacteria → Acidobacteria1107Open in IMG/M
3300006052|Ga0075029_100001261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 8314550Open in IMG/M
3300006059|Ga0075017_100286444Not Available1213Open in IMG/M
3300006059|Ga0075017_101278415All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7575Open in IMG/M
3300006086|Ga0075019_10077986All Organisms → cellular organisms → Bacteria → Acidobacteria1884Open in IMG/M
3300006102|Ga0075015_100294586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7891Open in IMG/M
3300006162|Ga0075030_100442865All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300006162|Ga0075030_100882413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7706Open in IMG/M
3300006174|Ga0075014_100041158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1935Open in IMG/M
3300006175|Ga0070712_100852887All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans784Open in IMG/M
3300006175|Ga0070712_101863763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300006237|Ga0097621_100069742All Organisms → cellular organisms → Bacteria2903Open in IMG/M
3300006854|Ga0075425_101610507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300009523|Ga0116221_1429666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7576Open in IMG/M
3300009523|Ga0116221_1564174All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7500Open in IMG/M
3300009552|Ga0116138_1044153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71294Open in IMG/M
3300009618|Ga0116127_1000123All Organisms → cellular organisms → Bacteria77597Open in IMG/M
3300009618|Ga0116127_1154233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7573Open in IMG/M
3300009632|Ga0116102_1127337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300009632|Ga0116102_1209773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7521Open in IMG/M
3300009634|Ga0116124_1149288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7654Open in IMG/M
3300009643|Ga0116110_1016380All Organisms → cellular organisms → Bacteria → Acidobacteria2930Open in IMG/M
3300009764|Ga0116134_1046807All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1666Open in IMG/M
3300009764|Ga0116134_1228058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7645Open in IMG/M
3300009824|Ga0116219_10547856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7638Open in IMG/M
3300009839|Ga0116223_10006665All Organisms → cellular organisms → Bacteria → Acidobacteria9412Open in IMG/M
3300009839|Ga0116223_10248507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71073Open in IMG/M
3300010341|Ga0074045_10168630All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha1479Open in IMG/M
3300010379|Ga0136449_101406219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1077Open in IMG/M
3300010379|Ga0136449_104467829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7515Open in IMG/M
3300012210|Ga0137378_10085894All Organisms → cellular organisms → Bacteria → Acidobacteria2873Open in IMG/M
3300012918|Ga0137396_10405182All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300012984|Ga0164309_11782985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7528Open in IMG/M
3300012986|Ga0164304_10088991All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300014056|Ga0120125_1171824All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7533Open in IMG/M
3300014159|Ga0181530_10482724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7620Open in IMG/M
3300014164|Ga0181532_10563044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7621Open in IMG/M
3300014489|Ga0182018_10016911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4931Open in IMG/M
3300014657|Ga0181522_10053278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2278Open in IMG/M
3300014839|Ga0182027_12177283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300014968|Ga0157379_10480301All Organisms → cellular organisms → Bacteria → Acidobacteria1150Open in IMG/M
3300015373|Ga0132257_103605459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter563Open in IMG/M
3300015374|Ga0132255_104696425Not Available579Open in IMG/M
3300017822|Ga0187802_10067356All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300017941|Ga0187850_10144321All Organisms → cellular organisms → Bacteria → Acidobacteria1120Open in IMG/M
3300017941|Ga0187850_10229683All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300017998|Ga0187870_1336903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7500Open in IMG/M
3300018004|Ga0187865_1274457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7559Open in IMG/M
3300018013|Ga0187873_1186989All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300018016|Ga0187880_1082346All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300018019|Ga0187874_10154653All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300018020|Ga0187861_10197598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7901Open in IMG/M
3300018022|Ga0187864_10295522All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7725Open in IMG/M
3300018025|Ga0187885_10012855All Organisms → cellular organisms → Bacteria5264Open in IMG/M
3300018026|Ga0187857_10106731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1358Open in IMG/M
3300018030|Ga0187869_10539789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7553Open in IMG/M
3300018030|Ga0187869_10624983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7508Open in IMG/M
3300018040|Ga0187862_10213836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1258Open in IMG/M
3300018044|Ga0187890_10756765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7549Open in IMG/M
3300018057|Ga0187858_10021909All Organisms → cellular organisms → Bacteria4970Open in IMG/M
3300018057|Ga0187858_10117902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1795Open in IMG/M
3300018057|Ga0187858_10428369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7818Open in IMG/M
3300018057|Ga0187858_10715376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7597Open in IMG/M
3300019361|Ga0173482_10449824All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7612Open in IMG/M
3300019787|Ga0182031_1382318All Organisms → cellular organisms → Bacteria1670Open in IMG/M
3300019872|Ga0193754_1032483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7554Open in IMG/M
3300019888|Ga0193751_1040511All Organisms → cellular organisms → Bacteria → Acidobacteria2086Open in IMG/M
3300020579|Ga0210407_11487582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7500Open in IMG/M
3300020581|Ga0210399_10051197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3318Open in IMG/M
3300020581|Ga0210399_11453730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7534Open in IMG/M
3300020582|Ga0210395_10791150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7707Open in IMG/M
3300021170|Ga0210400_11551472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7524Open in IMG/M
3300021403|Ga0210397_11516403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7520Open in IMG/M
3300021406|Ga0210386_10790841All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300021432|Ga0210384_11308387All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300021433|Ga0210391_10481187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7975Open in IMG/M
3300021475|Ga0210392_10590075Not Available823Open in IMG/M
3300021475|Ga0210392_10917801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7655Open in IMG/M
3300021477|Ga0210398_10041232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3825Open in IMG/M
3300021559|Ga0210409_10747889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7849Open in IMG/M
3300021559|Ga0210409_11648145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7518Open in IMG/M
3300022557|Ga0212123_10780370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7577Open in IMG/M
3300023075|Ga0224520_1154626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7500Open in IMG/M
3300025414|Ga0208935_1062113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7503Open in IMG/M
3300025439|Ga0208323_1039307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium898Open in IMG/M
3300025480|Ga0208688_1035969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1148Open in IMG/M
3300025498|Ga0208819_1122110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7536Open in IMG/M
3300025553|Ga0208080_1116313All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7532Open in IMG/M
3300025579|Ga0207927_1087853Not Available722Open in IMG/M
3300025915|Ga0207693_11462617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7505Open in IMG/M
3300025922|Ga0207646_11360712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7618Open in IMG/M
3300025928|Ga0207700_10674907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7922Open in IMG/M
3300025929|Ga0207664_10895801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7797Open in IMG/M
3300026223|Ga0209840_1015142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1762Open in IMG/M
3300026273|Ga0209881_1182520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7524Open in IMG/M
3300026514|Ga0257168_1030457All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300027521|Ga0209524_1101431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7603Open in IMG/M
3300027562|Ga0209735_1087743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7676Open in IMG/M
3300027575|Ga0209525_1146253Not Available542Open in IMG/M
3300027605|Ga0209329_1041172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7974Open in IMG/M
3300027605|Ga0209329_1156901All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7500Open in IMG/M
3300027645|Ga0209117_1030853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71675Open in IMG/M
3300027648|Ga0209420_1089484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7883Open in IMG/M
3300027660|Ga0209736_1027688All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71698Open in IMG/M
3300027898|Ga0209067_10033018All Organisms → cellular organisms → Bacteria → Acidobacteria2641Open in IMG/M
3300027898|Ga0209067_10655998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7606Open in IMG/M
3300027905|Ga0209415_10590044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7827Open in IMG/M
3300027905|Ga0209415_11020002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7548Open in IMG/M
3300027910|Ga0209583_10077352All Organisms → cellular organisms → Bacteria → Acidobacteria1235Open in IMG/M
3300027910|Ga0209583_10382104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7665Open in IMG/M
3300027911|Ga0209698_10131497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2065Open in IMG/M
3300027911|Ga0209698_10396880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71078Open in IMG/M
3300027915|Ga0209069_10302745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300028047|Ga0209526_10607469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7700Open in IMG/M
3300028666|Ga0265336_10241722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7536Open in IMG/M
3300028775|Ga0302231_10248622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7744Open in IMG/M
3300028780|Ga0302225_10312292Not Available745Open in IMG/M
3300028798|Ga0302222_10407784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7531Open in IMG/M
3300029636|Ga0222749_10801885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7515Open in IMG/M
3300029943|Ga0311340_11423437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7546Open in IMG/M
3300029943|Ga0311340_11597107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7507Open in IMG/M
3300029944|Ga0311352_11154572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7590Open in IMG/M
3300029987|Ga0311334_10527555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium952Open in IMG/M
3300029993|Ga0302304_10013343All Organisms → cellular organisms → Bacteria3673Open in IMG/M
3300030003|Ga0302172_10092100Not Available920Open in IMG/M
3300030007|Ga0311338_10570924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71170Open in IMG/M
3300030007|Ga0311338_11600937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7596Open in IMG/M
3300030053|Ga0302177_10278204All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7898Open in IMG/M
3300030294|Ga0311349_10485297Not Available1169Open in IMG/M
3300030494|Ga0310037_10233300All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300030659|Ga0316363_10001491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis20415Open in IMG/M
3300030707|Ga0310038_10443599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7557Open in IMG/M
3300031233|Ga0302307_10495019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7619Open in IMG/M
3300031715|Ga0307476_10648591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7782Open in IMG/M
3300031715|Ga0307476_10957427All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300031726|Ga0302321_101781091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300031820|Ga0307473_10547955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7789Open in IMG/M
3300031962|Ga0307479_10446770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71277Open in IMG/M
3300032160|Ga0311301_11620330Not Available786Open in IMG/M
3300032160|Ga0311301_11913108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7698Open in IMG/M
3300032180|Ga0307471_101132032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7948Open in IMG/M
3300032756|Ga0315742_10745616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7907Open in IMG/M
3300034070|Ga0334822_120330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7548Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.39%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds8.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.18%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.31%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.21%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.21%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.66%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.66%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.10%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.10%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.10%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.55%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.55%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.55%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.55%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.55%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.55%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.55%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.55%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.55%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001413Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019872Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025553Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025579Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029998Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1EnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1034034113300001356Peatlands SoilMKRAFLLIVVPALLVALGFAQTPTASINTDQTIKGCLAGSDGNYTVVE
JGI20180J14839_100545513300001413Arctic Peat SoilMKRAFLLIVVPALLVALGLAQTPAASSNTDQTIKGCLGGSDGNY
JGI12712J15308_1002869413300001471Forest SoilMKKAFLLIVLPALLVALGFAQTPAPSGNTDPANIQGCLGG
JGI12635J15846_1051185613300001593Forest SoilMKRAFLLMVVPALLVALGFAQTPAASINTDQTNIKGCL
JGI26340J50214_1015330313300003368Bog Forest SoilMKRAFLLIVVPALLVALGFAQTPAASINTDPTNIKGCLGSSDG
JGIcombinedJ51221_1019330523300003505Forest SoilMKRACLLIVVPALLVALGFAQTPAASSNTDPTSIKGCLGGSDSNYTLVEDN
JGIcombinedJ51221_1022311313300003505Forest SoilMKRVFLLMVVSALLVTLGFAQTPDARSNTDQATVNGCLGGSDGNYTVAEDGSRQILKITASS
JGIcombinedJ51221_1026943213300003505Forest SoilMKKVFLLMVVSALLVTLGFAQTPDARSNTDQATVNGCLGGSDGNYTVAEDGSRQILKITASS
Ga0062589_10031938613300004156SoilMKRVLLLIVASALLVALGSAQTPAASGNTEQLNIKGCLGGS
Ga0062591_10081113533300004643SoilMKRIFLLIAVPALLVALGFAQTPAASNNTDQSIIQGCLSGSDGNFTIAQDNTGQILKLATGS
Ga0070709_1066240913300005434Corn, Switchgrass And Miscanthus RhizosphereMKRAFLLIVVPALLVVLGFAQIPTASSDTGQNSIKGCLSGSAGNYTVAEDNT
Ga0070714_10016332713300005435Agricultural SoilMKRASLLIVVPALLVALGFAQTPTASSNTDSTSIKGCLGGADSNYTLVEDNTGHNFKL
Ga0070714_10057718413300005435Agricultural SoilMKRASLLIVVPALLVALGFAQTAQTPTASSNTDSTSIKGCLGGADSNYTLVEDNTGHNFK
Ga0070713_10006988813300005436Corn, Switchgrass And Miscanthus RhizosphereMKKIFLLIFVPALLVAMGFAQAPATSSNADPMNVKGCVGGSDGNYSVLENNTGKTFKITT
Ga0070713_10124498523300005436Corn, Switchgrass And Miscanthus RhizosphereMKRIFLLMAASVLLVVSGFAQTPAAGDNTDQASIKGCLGGSAGNYTVAEDGTSQILKITT
Ga0070713_10213998213300005436Corn, Switchgrass And Miscanthus RhizosphereMKRVFLLIVVSALLVMLGFAQTPGAGSNTDQANIKGCLGG
Ga0073909_1037687313300005526Surface SoilMKKVLLFVVVSAAVVALGFAQTPDASSNTDQVNIQGCLG
Ga0070733_1100428213300005541Surface SoilMKRVFLLIVVPALLVAIGFAQTPAASGNTDQINVKGCLGGTDGNYTLAED
Ga0070732_1024843523300005542Surface SoilMKRVFLLIVVPALLVAMGLAQTPAAGGNTDQINIKGCLGGSEG
Ga0070732_1050613123300005542Surface SoilMKRVFLLIVVPALLVGMGFAQTPAASGNTDQIDIKGCLAGTDGNYTIAEDNTGKIFKITTSS
Ga0070704_10020739613300005549Corn, Switchgrass And Miscanthus RhizosphereMNRVFLVMVVSALLVTLGLAQTPDAGSNTAPANVKGCLGGSEGNYTVVEDGTRQTFKITT
Ga0068857_10053025613300005577Corn RhizosphereMKRVLLLIVASALLVALGSAQTPAASGNTEQLNIKGCLGGSDGNYTLAEENTGRVFKLTSSSAD
Ga0075023_10032098113300006041WatershedsMKRAFLLIAVSALLVTLGFAQTPDASSNTDQANVKGCLGGSDGNYTVAEDGTRQIF
Ga0075029_10000126113300006052WatershedsMKRVFLLIVVPALLVALGFAQTPTASGNTDQVNIKGCLGGSDGSY
Ga0075017_10028644433300006059WatershedsMKRVFLLIVVPALLVALGFAQTPTASGNTDQVNIK
Ga0075017_10127841523300006059WatershedsMKRAFLLIVVPALLVALGFAQSPAASVNTDQTIKGCLAGSDGNYTVVEDGTGHIF
Ga0075019_1007798613300006086WatershedsMKRVFLLIVVPALLVALGFAQTPTASGNTDQVNIKGCLGGS
Ga0075015_10029458613300006102WatershedsMKRACLLIVVPALLVALGFGQTPTASSNPAPTSIKGCLGGSDGNYTLAENNTGHNFK
Ga0075030_10044286533300006162WatershedsMKRACLLIAVPALLVALGFAQTPTASSNPAPTSIKGCLGGSDGNYTLTEDNTGHN
Ga0075030_10088241313300006162WatershedsMKRVFLLMVVPALLVAMGVAQTPAASGNTDLINVKGCLGGSEGNYNIAEDNT
Ga0075014_10004115813300006174WatershedsMKRACLLMVVPALLVALGFAQTSAASTNTDQTNIKGCLGGSDGNYT
Ga0070712_10085288713300006175Corn, Switchgrass And Miscanthus RhizosphereMKRVFLLMVVSALLVTLGFAQTPDAGSNTDQANIKGCLGGSDGNYTVAEDGTRQIFKITTSSVD
Ga0070712_10186376313300006175Corn, Switchgrass And Miscanthus RhizosphereMKKVFLLIVVPALLVAMGFAQTPPASGNTDQITVKGCLGGSDGNYTVTEDNTGKIFKITTSS
Ga0097621_10006974233300006237Miscanthus RhizosphereMKNVFLLLVVSALVVTLGFAQTPAVDGNTDRASVDGCLGGTEGNYTVAEDGTGQSFKITTSTVDL
Ga0079222_1019424213300006755Agricultural SoilMKNVFLLMVVSALHVTLGFAQTPGAGSNTSVANVSGCLGGSDGAYTVTEDGTRQVFKIT
Ga0075425_10161050713300006854Populus RhizosphereMKRVFLLIAISALLVALGFAQTPAAGSNTDSTNIKGCLGGSDDNYTVMEDG
Ga0073928_1001289473300006893Iron-Sulfur Acid SpringMKKVFLLMVVSGLLVTLGFAQTPADNSAAQANIKGCLGGSDGNYTVAEDGTHQIFNIHYQQC*
Ga0116221_142966613300009523Peatlands SoilMKRVFLLIVVPALLVAMGFAQSPAASGSADQMNVKGCVGGSDGNYTVLENN
Ga0116221_146062013300009523Peatlands SoilMKKVFLLMVVSGLLVTLGFAQTPDAGSNADQANVKGCLGGADGNYTVAEDGTSQIFK
Ga0116221_156417413300009523Peatlands SoilMKRAFLLIVVPALLVALGFAQTPAASINTDQTIKGCLSGSDGNYTVLGDSTGHIFKITTNSVDFK
Ga0116138_104415313300009552PeatlandMKRAFLLIVAPALLVALGFAQTPTASINTDQTTIRGCLGGSD
Ga0116127_1000123633300009618PeatlandMKRAFLLIVVPALLVALGFAQTPATSINTDQTNIKGCLGGSDGNYT
Ga0116127_115423313300009618PeatlandMKRALLLIVVPALLVALGFAQTPATSINTDQTNIKGCLGGSDGNYT
Ga0116102_112733713300009632PeatlandMKRALLLIVVPALLVALGFAQTPAASINTDQTIKGCLGASGGNYTVVEDGT
Ga0116102_120977313300009632PeatlandMKRTFLLIVVPALLVALGFAQTPPASINTDQTNIKGCLGGSD
Ga0116124_114928823300009634PeatlandMKRAFLLIVVPALLVALAFAQTPAASINTDQTIKGCLGGSD
Ga0116110_101638013300009643PeatlandMLIVVPALLVALGFAQTPAASINTDQTIKGCLGGSDGNYT
Ga0116134_104680743300009764PeatlandMKKAFLLIVVPALLVALGWAQTPAASINPDQTIKGCLAGSDGNYTVAEDGTGHILKVT
Ga0116134_122805813300009764PeatlandMKRAFLLIVVPALLVALAFAQTPAASINTDRTIKGCLGARTVTTQ
Ga0116219_1054785623300009824Peatlands SoilMKRALLLIVVPALLVALGFAQAPAASINTDQTIKGCLGGSDGNY
Ga0116223_1000666513300009839Peatlands SoilMKRAFLLIVVPALLVALGFAQTPTASINTDQTIKGCLAGSD
Ga0116223_1024850713300009839Peatlands SoilMKKAFLLIVVPALLAALAFAQTPAASTNTEQTNIKGCLGGS
Ga0074045_1016863013300010341Bog Forest SoilMEDSMKRLFLLVVVPALLIALGSAQTPAASVDSDPTIEGCLGGTDGNYT
Ga0136449_10140621923300010379Peatlands SoilMKRALLLIVVPALLVALGLAQTPAASTNTDQTTIKGCLG
Ga0136449_10446782913300010379Peatlands SoilMKKVFVLIVVPALLVAMGFAQTPAATGNTDQVNIRGCLGGSDGNYTVAEDNTGKI
Ga0137378_1008589463300012210Vadose Zone SoilMKRIFLLIVVPALLVAMGSAQTPAASGNTDQIDIKGCLGGSDGNYTVAEDN
Ga0137396_1040518213300012918Vadose Zone SoilMTKIFLLIVVLATVVTLGFGQTPGASSNTDQISIKGCLI
Ga0164303_1116397713300012957SoilMKKVLLFVVVSAAVVALGFAQTPDASSNTDQVNIQGCLGGSDGNYT
Ga0164302_1095557813300012961SoilMKRALLLIAVSALLVTLGFAQTPAAGDNPDPANVKGCLGGSDGSYTVAEDGT
Ga0164309_1178298523300012984SoilMKKVFLLIVVPALLVAMGFAQTPAASGNTDQITVKGCLGGSEGNYTVTEDNTGKIFKITT
Ga0164304_1008899143300012986SoilMKRAFLLIVVPALLVVLGFAQIPTASSDTGQNSIKGCLSGSAGNYTVAEDNTG
Ga0120125_117182413300014056PermafrostMKKVFLLIVVPALLVALGFAQTPAASGITDQVNIKGCLGGSEGNYTVAED
Ga0181530_1048272413300014159BogMKKIFLLIVVPALLVAMGFAQTPTASDNTDQINIKGCLGGS
Ga0181532_1056304413300014164BogMKRAFLLIVVPTLLVALGFAQTPAASSNTDQTIQGCLAGSDGNYTVVED
Ga0182018_1001691193300014489PalsaMKRAFLLIVVPALLVALGFAQTPAASSNTDQTIKGCLGG
Ga0181522_1005327843300014657BogMKRAFLLIVAPALLVALGFAQTPTASINTDQTTIR
Ga0182027_1217728313300014839FenMKRAFLLIVVPALLVALGFAQTPAVSINIDQTIKGCLGG
Ga0157379_1044821823300014968Switchgrass RhizosphereMKRVLLLMFASALLATLGFAQTPASGGNTDLANVKGCLGGSDGNYTVAEDGTRQIFKITT
Ga0157379_1048030113300014968Switchgrass RhizosphereMKRVLLLIVASALLVALGSAQTPAASGNTEQLNIKG
Ga0157379_1229717813300014968Switchgrass RhizosphereMKKVLLFVVVSAAVVALGFAQTPDASSNTDQVNIQGGLGGSDGNYTVA
Ga0132258_1398829313300015371Arabidopsis RhizosphereMKKVLLFVVVSAAVVSLGFAQTPDASSNTDQVNIQGCLGGSDGNYTVAEDGSGQIFKI
Ga0132257_10360545913300015373Arabidopsis RhizosphereMLEDSMKSLFLLIGVPVLLAALGFAQTPTPSSDTDQIAIKGCLSGADHNYTVTEDNTGRILKL
Ga0132255_10469642513300015374Arabidopsis RhizosphereMKRACLLIVVPALLVALGFAQTPTPSSATDSTSIKG
Ga0187802_1006735623300017822Freshwater SedimentMKKVFLLIVVPALLVAMGFAQTPAASGNTDQINIRGCLGGSDGNYTVAEDNTGKIFKI
Ga0187850_1014432133300017941PeatlandMKRALLLIVVPALLVALGFAQTPAASINTDQTNIKGCLGGSDGNYTVVQDN
Ga0187850_1022968313300017941PeatlandMKRVFLLIVVPALLAALGFAQTPAASINTDQTIKGCL
Ga0187870_133690313300017998PeatlandMKRALLLIVVPVLLVALGSAQTPAASVNTDQTIKGCLGGSD
Ga0187865_127445713300018004PeatlandMKRALLLIVVPALLVALGFAQTPAASINTDQSNIKGCLGGSVGNYTVVQDNTG
Ga0187873_118698913300018013PeatlandMKRAFLLIVVPALLVALAFAQTPAASINTDQTIKGCLG
Ga0187880_108234643300018016PeatlandMKRAFLLIVVPALLVALAFAQTPAASINTDQTIKGCLGGSDGNYTVVED
Ga0187874_1015465313300018019PeatlandMKRALLLIVVPALLVALGFAQTPAASINTDQSNIKGCLGGSVGNYTVVQDNTGRIFK
Ga0187861_1019759813300018020PeatlandMKRALLLIVVPALLVALGFAQTPAASINTDQTIKGCLGAS
Ga0187864_1029552213300018022PeatlandMKRAFLLIAVPTLLVALGFAQTPAASTNPDQTNIKGCLGGSDGNYTV
Ga0187885_1001285563300018025PeatlandMKRAFLLIAVPTLLVALGFAQTPAASTNPDQTNIKGCLGGSDGNYTVMEDNTGRIFKLTT
Ga0187857_1010673113300018026PeatlandMKRALLLIVVPALLVALGFAQAPVASINTDQTIKGCLGGS
Ga0187869_1053978913300018030PeatlandMKRALLLIVVPSLLVALGFAQAPVASINTDQTIKGCLGGSDGNYTVVEDSTGHIFKITT
Ga0187869_1062498313300018030PeatlandMKRVFLLIVVPALLVAMGFAQTPATSGNANQMNVKGCLSG
Ga0187862_1021383613300018040PeatlandMKRALMLIVVPALLVALGFAQTPAASINTDRTIKGCLGGSDGNYTVVEDSTGHIFKI
Ga0187890_1075676513300018044PeatlandMKRAFLLIVIPALLVALGFAQTPAASSNTDQANIKGCLGGSDGNYTVVQDNTGQIFKITS
Ga0187858_1002190963300018057PeatlandMKRAFLLIAVPTLLVALGFAQTPAASINTQTNIKGCLGGSDGNYTIVEDNTGRIF
Ga0187858_1011790233300018057PeatlandMKRALLLIVVPALLVALGFAQTPAASINTDQSNIKGCLGGSVG
Ga0187858_1042836913300018057PeatlandMKRVFVLIVIPALLVALGFAQTPTASSNTDPINIKGCLGGSDGNYTVVEDNTGKIFKITTSS
Ga0187858_1071537613300018057PeatlandMKRAFLLIAVLTLLVALGFAQTPAASTNTDQTNIKGCLGGSDGNYTVVQDNT
Ga0173482_1044982413300019361SoilMKKAFLLIVVPALLVALGFAQTPGASIKTDQTNIKGCLGGSDGNYT
Ga0182031_138231843300019787BogMKRALLLIVIPALLIALGFAQTPAASINTDQTNIK
Ga0193754_103248313300019872SoilMKRVFLLIVAPALLAALGFAQTPTATSNTDQTSIKGCLGGTDGNFTIAE
Ga0193751_104051123300019888SoilMKRVFLLIVVPALLVALGFAQTPAASSNTDQVNIKGCLGGSDG
Ga0210407_1148758213300020579SoilMNRAFLLIVVPALLGALGFAQTPASNNPDQVNVRGCLGGSDSSYTVAEDNTGKI
Ga0210399_1005119733300020581SoilMKRLFLLIVIPALLVALGFAQNPAASINTDQTNIKGCLGGSDGNYTIAQDNTGHIFKVTS
Ga0210399_1145373013300020581SoilMKRAFLLIFVVALLAALGLAQTPAASPNTDQTNIKGCLGGSDGNYTVVEDNTGHLFKITTSSV
Ga0210395_1079115013300020582SoilMKRVFLLIVVPALLVAMGFAQTPAASGNSDRINIKGCLGGSDGNYTVAEDNT
Ga0210404_1035300513300021088SoilMKKILLLLVASALLVTLGLAQTPDAASNTDPATLKGCLGGSDSNYTIAEHGSRQIFKITTSSV
Ga0210400_1155147223300021170SoilMKKVLLLIVFSTLLVALGFAQIPAANSNTDQTNIKGCLGGSDGNYTIAEEIG
Ga0210397_1151640323300021403SoilMKKVLLLIVFSTLLVALGFAQIPAANSNTDQTNIK
Ga0210386_1079084113300021406SoilMKRACLLIVVPALLVALGFAQTPAASGNTDPTSIKG
Ga0210384_1130838723300021432SoilMKKVLLLIVFSTLLVALGFAQIPAANTNTDQTNIKGCLGGSDGNYTIAE
Ga0210391_1048118723300021433SoilMKRVFLLIVVPALLVALGFAQTPAASGNTDPTSIKGCLGGSDSNYTLVEDNTGHN
Ga0210392_1059007523300021475SoilMKRVFLLISIPILFVALGIAQTPAPSNDTDQIAIKG
Ga0210392_1091780123300021475SoilMKRVFLLIVVPALLVAMGLAQTPAAGGNTDQINIKGCLGGSDGNYNIAEDNTGKI
Ga0210398_1004123253300021477SoilMKRTFLLMVGPALLVAMAFAQTPAASTNPDQTMKG
Ga0210409_1074788923300021559SoilMKRVFLLIVVPALLVAMGLAQTPAAGGNTDQINIKGCL
Ga0210409_1164814523300021559SoilMKRACLLIVVPALLVALGFAQTPAASSNPAPTSIKGCLGGSDGNYTLTE
Ga0212123_1078037013300022557Iron-Sulfur Acid SpringMKNAFLLIAVVALLVALGLAQTPAASPNPDQTNIKGCLGGSDG
Ga0224520_115462613300023075SoilMKRALLLMVVPALLVALGFAQTPAASVNADQTNIKGCLGGADGNYTVVQDNTGHVFKI
Ga0208935_106211313300025414PeatlandMNRALLTIAAPALLLALGLAQTPAASSNTDQTIKGCLAGSAGNYTVVEDNTGHI
Ga0208323_103930723300025439PeatlandMKRAFLLIVVPALLVALGFAQTPATSINTDQTNIKGCLGGSDGNYTVVQDNTGRIFKITTSS
Ga0208688_103596913300025480PeatlandMKRAFLLIVVPALLVALGFAQTPATSINTDQTNIKGCLGGSDGNYTVVQDNTGRIFKITTSSVD
Ga0208819_112211013300025498PeatlandMKRAFLLIAVPTLLVALGFAQTPAASTNPDQTNIKGCLGGSDGNYTVMEDNTGRIFKLT
Ga0208080_111631313300025553Arctic Peat SoilMKRAFLLIVVPALLVALGFAQTPAASINTDQTNIKGCLGGSDGNYTVV
Ga0207927_108785323300025579Arctic Peat SoilMKRVFLLIVVPVLLVALGFAQTPAASTNTDQTNIP
Ga0207688_1046966423300025901Corn, Switchgrass And Miscanthus RhizosphereMKNVFLLLVVSALVVTLGFAQTPAVDGNTDRASVDGCLGGTEGNYTVAEDGTGVARHARGHGPV
Ga0207671_1103147723300025914Corn RhizosphereMKKVLLFVVVSAAVVALGFAQTPDASSNTDQVNIQGCLGGSDGNYTVAEDGSGQIFKITT
Ga0207693_1146261713300025915Corn, Switchgrass And Miscanthus RhizosphereMKRVFLLIVVPALLVAMGFAQTPAASGNTDQINVKGCLGGSEGSYNVAEDSTGKIFRITT
Ga0207646_1136071213300025922Corn, Switchgrass And Miscanthus RhizosphereMKRAFLLIVIPALLVALGFAQTPAASINTDQTNIKGCLGGSDGNYTIAQDNTGHIFKV
Ga0207700_1067490723300025928Corn, Switchgrass And Miscanthus RhizosphereMKRACLLIVVPALLVALGFAQTPAASSNTDPTSIKGCLGGSDSNYTLVEDNTGHNFKITT
Ga0207664_1089580113300025929Agricultural SoilMKKVFLLIVVPALLVAMGFAQTPAASGTPDQVNIQGCLGGTDGNYTVAE
Ga0207709_1026293823300025935Miscanthus RhizosphereMKNVFLLLVVSALVVTLGFAQTPAVDGNTDRASVDGCLGGTEGNYTVAEDGTGQSFKITT
Ga0209840_101514233300026223SoilMKRAFLSIVVPALLVALGFAQTPAASINTDQTNIKGCLGGSDG
Ga0209881_118252013300026273SoilMKRAFLSIVVPALLVALGFAQTPAASINTDQTNIKGCLGGSDGNY
Ga0257168_103045713300026514SoilMKRVFLLIVIPALLVALGFAQTPTASINTDQTNIKGCLGGSDGNYTIAQDNTGHIFKVTSTVTA
Ga0209524_110143113300027521Forest SoilMKKAFLLIVVPALLVALGFAQTPAASSNTDQTNIRGCLGGSADNYTVAEDNTGQIFKITTSSV
Ga0209735_108774313300027562Forest SoilMKRVFLLIVAPALLAALGFAQTPTATSNSDQTSIKGCL
Ga0209525_114625313300027575Forest SoilMKRTCLLMVVPALLAAMAFAQTPTASSDPDQTIKGCMAGSDGNYTVAEDGTGHIFKVTASNVDLQ
Ga0209329_104117213300027605Forest SoilMKSAFLSIAVVALLVPLGLAQTPAASPNPDQTNIKGCLGGSDGNYTVVED
Ga0209329_115690113300027605Forest SoilMKRLFLLMVVSALLVMLGFAQTPGAGSNTDQINVKGCLGGSDGNYTVAEDGTRQIFKITTSSV
Ga0209117_103085313300027645Forest SoilMKRVFLLIVIPALLVALGFAQTPAASINTDQTNIMGCLG
Ga0209420_108948413300027648Forest SoilMKRTFLLMVAPALLVAMAFAQTPAASTNPDQTIKGCLAGSDGNYTV
Ga0209736_102768823300027660Forest SoilMKRAFLLMVVPALLVALGFAQTPAVSSNTDQVTVKGCLGGSDGNYTVAEDNT
Ga0209074_1016029113300027787Agricultural SoilMKNVFLLMVVSALLVSLGFAQTPGAGSNTSVANVSGCLGGSDGAYTVTEDGTRQVFKITTSR
Ga0209067_1003301813300027898WatershedsMKRVFLLIVVPALLVALGFAQTPTASGNTDQVNIKGCLGGSDGSYT
Ga0209067_1065599813300027898WatershedsMKRVFLLIVVPALLVAMGLAQTPAASGNTDQINIKGCLGGSEGNYNIAEDNTGK
Ga0209415_1059004413300027905Peatlands SoilMKRAFLLIVAVALLVALGFAQTPAASTNIKGCLSGSDGNYTVVENNTGRILKIT
Ga0209415_1102000223300027905Peatlands SoilMKKAFLLIVVPALLAALAFAQTPAASTNTEQTNIKGCLGGSDGNYTVVEDNTGQIFKIST
Ga0209583_1007735213300027910WatershedsMKRACLLIVVPALLVALGFAQTPTTSSNTDPTSIKGCLGGSDGNYTFVED
Ga0209583_1038210413300027910WatershedsMKRAFLLIAVSALLVTLGFAQTPDASSNTDQANVKGCLGGSDGNYTVAEDGTRQIFKITTSSV
Ga0209698_1013149713300027911WatershedsMKRVFLLIVVPALLVALGFAQTPTASGNTDQVNIKGCL
Ga0209698_1039688013300027911WatershedsMKRVFLLIVVPALLVALGFAQTPAASGNTDQVNIKGCLGGSDGSYT
Ga0209069_1030274523300027915WatershedsMKRACLLMAVPALLVALGFAQTPAASSNPDQTNIKGCLGG
Ga0209526_1060746913300028047Forest SoilMKRAFLLIVISALLVALGFAQTPAASINTDQTNIKGCLGGS
Ga0265336_1024172213300028666RhizosphereMKRVFLLIVVPALLVAMGFAQTPATSGNADQMNVKGCLSGSDGN
Ga0302231_1024862213300028775PalsaMKKVFLLIVVPALLVALGFAQTPATSINTDQTTIKGCLGGSDGNYTVVEDNTGHIFKIA
Ga0302225_1031229213300028780PalsaMKRVFLLILVPALLVGLGFAQTPAANGNTDLPVKGCLGGSD
Ga0302222_1040778413300028798PalsaMKRVFLLVVAPALLIALGFAQTPAASVNTDQTIKGCLGGSDGNYTVVEDGTGHIFKISAASVDF
Ga0222749_1080188523300029636SoilMKSAFLLIAVVALLVALGLAQTPVASPNPDQTNIK
Ga0311340_1142343713300029943PalsaMKRTCLLIVVLALLVALGFAQTPATGSNADQTTVKGCLGGSDGNYT
Ga0311340_1159710713300029943PalsaMKRALLLIVVPTLLVALGFAQTPAVSVNTDLTIKGCLGGSDGNYTVVEDSTGHIFKITTTSV
Ga0311352_1115457213300029944PalsaMKRVFLLVVAPALLIALGFAQTPAASVNTDQTIKGCLGGSDGNYTVVED
Ga0311334_1052755513300029987FenMKRAFLLIVVPALLVALGFAQTPGASGNTDQTSIKGCLGGSDGNYTVVQDNTGHIFKIT
Ga0302304_1001334313300029993PalsaMKRTFLLIVIPALMAGLGFAQTSPASTNTDQTNIKGCLGGSDG
Ga0302271_1053965813300029998BogMKRVFLLIVVSALLVTLGFAQTPDAGSNTDQVDVRGCLGGSDGNYTVAEDGTPQIFKI
Ga0302172_1009210013300030003FenMKRAFLLIVIPALVLALGFSQTPTPSVNTDQTNIKGCLGGSDG
Ga0311338_1057092413300030007PalsaMKRVFLLVVAPALLIALGFAQTPAASVNTDQTIKGCLGGS
Ga0311338_1160093723300030007PalsaMKRTCLLIVVLALLVALGFAQTPATGSNADQTTVKGCLGGSDGNYTLVEDN
Ga0302177_1027820413300030053PalsaMKRALLLIVVPALLVALGFAQTPAPGSNPEQSNIKGCLGGSDGNYTLVEDSTGRI
Ga0311349_1048529723300030294FenMKRAFLLIVIPALVLALGFSQTPTPSVNTDQTNIKGCLGGSEGNYTVAEDNT
Ga0310037_1023330023300030494Peatlands SoilMKKVFLLMVVSGLLVTLGFAQTPDAGSNADQANVKGCLGGADGNYTVAEDGTSQIFKITSSSVD
Ga0316363_1000149113300030659Peatlands SoilMKRAFLLIVVPALLVALAFAQTPAASINTDQTIKG
Ga0310038_1044359913300030707Peatlands SoilMKRAFLLIVVPALLVALGFAQTPAASINTDQTTIKGCLGGSD
Ga0302307_1049501913300031233PalsaMKRACLLIVVPALLVALGFAQTPATGSNTDQTTVKGCLG
Ga0307476_1064859113300031715Hardwood Forest SoilMKRACLLIVVPALLVALGFAQTPAASSNPAPTSIKGCLGGSDGNYTLTEDNTGH
Ga0307476_1095742713300031715Hardwood Forest SoilMNKARLLIVVPVLLVALGAQTPTAGSNSDPTSIKGCL
Ga0307469_1102476723300031720Hardwood Forest SoilMKRVFLLMVIPALLVAMGLAQTPAAGGNTDQINIQGCLGG
Ga0302321_10178109123300031726FenMKRAFLLIVVPALLVALGFAQTPGASGNTDQTSIK
Ga0307473_1054795513300031820Hardwood Forest SoilMKRACLLIVLPALLVALAFAQTPMASSNPAPTSIKGCLGGSDGNYTL
Ga0307479_1044677023300031962Hardwood Forest SoilMKRAFLLIAVPVLLVVLGFAQTPAASSNTDQTTIKGCLGG
Ga0311301_1162033033300032160Peatlands SoilMKKIFLLIFVPTLLVALGFAQVPAASGSADPMNVKGCVSGS
Ga0311301_1191310813300032160Peatlands SoilMKKVFLLIVALALLAALGFAQTPAASINTDQTIKGCLSGSDGNYTVMEDNTGHIFKI
Ga0307471_10113203213300032180Hardwood Forest SoilMKSVFLLIVVPALLVALGFAQTPAASGNTDQINIQGCLGGSDVNYTVAEDNTGKIFKITTSSSD
Ga0315742_1074561623300032756Forest SoilLLIAVVALLVALGLAQTPAASPNPDQTNIKGCLGGSDGNYTVVEDNTGH
Ga0310811_1087544313300033475SoilMKTVFLQVVLAALLVVSGLAQTPDSRSNPDQATITGCLGGSDGNYTVAEEGARQILKISTSS
Ga0334822_120330_406_5463300034070SoilMKRALLLIVVPALLIALGFAQTPAASINTDQTNIKGCLGGSDGNYTV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.