Basic Information | |
---|---|
Family ID | F031982 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 181 |
Average Sequence Length | 49 residues |
Representative Sequence | MMTFLATSNEEDLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 181 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 72.88 % |
% of genes near scaffold ends (potentially truncated) | 27.62 % |
% of genes from short scaffolds (< 2000 bps) | 80.11 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (64.641 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (14.917 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.387 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.961 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.32% β-sheet: 0.00% Coil/Unstructured: 73.68% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 181 Family Scaffolds |
---|---|---|
PF03401 | TctC | 2.76 |
PF00089 | Trypsin | 2.21 |
PF02852 | Pyr_redox_dim | 1.66 |
PF07992 | Pyr_redox_2 | 1.66 |
PF03779 | SPW | 1.10 |
PF05135 | Phage_connect_1 | 1.10 |
PF11367 | DUF3168 | 1.10 |
PF09351 | DUF1993 | 1.10 |
PF01370 | Epimerase | 1.10 |
PF13473 | Cupredoxin_1 | 1.10 |
PF01925 | TauE | 0.55 |
PF00033 | Cytochrome_B | 0.55 |
PF00072 | Response_reg | 0.55 |
PF06186 | DUF992 | 0.55 |
PF12071 | DUF3551 | 0.55 |
PF00775 | Dioxygenase_C | 0.55 |
PF14539 | DUF4442 | 0.55 |
PF00697 | PRAI | 0.55 |
PF09335 | SNARE_assoc | 0.55 |
PF03992 | ABM | 0.55 |
PF03372 | Exo_endo_phos | 0.55 |
PF04909 | Amidohydro_2 | 0.55 |
PF12681 | Glyoxalase_2 | 0.55 |
PF13649 | Methyltransf_25 | 0.55 |
PF02738 | MoCoBD_1 | 0.55 |
PF07883 | Cupin_2 | 0.55 |
PF00881 | Nitroreductase | 0.55 |
PF00384 | Molybdopterin | 0.55 |
PF14026 | DUF4242 | 0.55 |
PF04116 | FA_hydroxylase | 0.55 |
PF13539 | Peptidase_M15_4 | 0.55 |
PF07690 | MFS_1 | 0.55 |
PF01391 | Collagen | 0.55 |
PF13365 | Trypsin_2 | 0.55 |
COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
---|---|---|---|
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.76 |
COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 0.55 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.55 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.55 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.55 |
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.55 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.55 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 64.64 % |
All Organisms | root | All Organisms | 35.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035918004|FACENC_F56XM5W01CFZTY | Not Available | 555 | Open in IMG/M |
2088090015|GPICI_9254017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 62-47 | 2043 | Open in IMG/M |
2170459019|G14TP7Y01CMY5N | Not Available | 524 | Open in IMG/M |
2228664021|ICCgaii200_c0292620 | Not Available | 564 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_11097050 | Not Available | 1074 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100654871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1576 | Open in IMG/M |
3300000955|JGI1027J12803_103874899 | Not Available | 731 | Open in IMG/M |
3300003659|JGI25404J52841_10080101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ISL-1 | 682 | Open in IMG/M |
3300003911|JGI25405J52794_10082078 | Not Available | 710 | Open in IMG/M |
3300003994|Ga0055435_10024476 | Not Available | 1309 | Open in IMG/M |
3300004479|Ga0062595_100460731 | Not Available | 938 | Open in IMG/M |
3300004479|Ga0062595_101512581 | Not Available | 620 | Open in IMG/M |
3300004633|Ga0066395_10226877 | Not Available | 991 | Open in IMG/M |
3300005093|Ga0062594_102333123 | Not Available | 583 | Open in IMG/M |
3300005162|Ga0066814_10020775 | Not Available | 911 | Open in IMG/M |
3300005330|Ga0070690_100096075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1958 | Open in IMG/M |
3300005332|Ga0066388_100396290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2026 | Open in IMG/M |
3300005332|Ga0066388_101080699 | Not Available | 1356 | Open in IMG/M |
3300005332|Ga0066388_102534324 | Not Available | 933 | Open in IMG/M |
3300005334|Ga0068869_102004726 | Not Available | 519 | Open in IMG/M |
3300005338|Ga0068868_101442188 | Not Available | 643 | Open in IMG/M |
3300005341|Ga0070691_10098212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
3300005354|Ga0070675_100875696 | Not Available | 823 | Open in IMG/M |
3300005355|Ga0070671_100019878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5472 | Open in IMG/M |
3300005355|Ga0070671_100481385 | Not Available | 1066 | Open in IMG/M |
3300005367|Ga0070667_100493046 | Not Available | 1122 | Open in IMG/M |
3300005434|Ga0070709_11151358 | Not Available | 622 | Open in IMG/M |
3300005434|Ga0070709_11381088 | Not Available | 570 | Open in IMG/M |
3300005436|Ga0070713_100286228 | Not Available | 1513 | Open in IMG/M |
3300005439|Ga0070711_100363741 | Not Available | 1166 | Open in IMG/M |
3300005439|Ga0070711_100463954 | Not Available | 1039 | Open in IMG/M |
3300005439|Ga0070711_101194878 | Not Available | 658 | Open in IMG/M |
3300005457|Ga0070662_100036476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3478 | Open in IMG/M |
3300005458|Ga0070681_11240298 | Not Available | 668 | Open in IMG/M |
3300005543|Ga0070672_100295531 | Not Available | 1372 | Open in IMG/M |
3300005548|Ga0070665_100979168 | Not Available | 858 | Open in IMG/M |
3300005618|Ga0068864_102486902 | Not Available | 524 | Open in IMG/M |
3300005713|Ga0066905_100015419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3856 | Open in IMG/M |
3300005713|Ga0066905_100023608 | All Organisms → cellular organisms → Bacteria | 3336 | Open in IMG/M |
3300005713|Ga0066905_100038213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2815 | Open in IMG/M |
3300005713|Ga0066905_100060153 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
3300005713|Ga0066905_100079958 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
3300005713|Ga0066905_100119294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1836 | Open in IMG/M |
3300005713|Ga0066905_100127283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis | 1790 | Open in IMG/M |
3300005713|Ga0066905_100831112 | Not Available | 803 | Open in IMG/M |
3300005713|Ga0066905_100851210 | Not Available | 794 | Open in IMG/M |
3300005713|Ga0066905_100899789 | Not Available | 774 | Open in IMG/M |
3300005713|Ga0066905_100990537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
3300005713|Ga0066905_101657777 | Not Available | 586 | Open in IMG/M |
3300005764|Ga0066903_101176636 | Not Available | 1421 | Open in IMG/M |
3300005764|Ga0066903_106790712 | Not Available | 595 | Open in IMG/M |
3300005937|Ga0081455_10166128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 62-47 | 1686 | Open in IMG/M |
3300006028|Ga0070717_10556604 | Not Available | 1039 | Open in IMG/M |
3300006041|Ga0075023_100005744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3079 | Open in IMG/M |
3300006041|Ga0075023_100015242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2055 | Open in IMG/M |
3300006049|Ga0075417_10017328 | All Organisms → cellular organisms → Bacteria | 2817 | Open in IMG/M |
3300006049|Ga0075417_10044986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1886 | Open in IMG/M |
3300006049|Ga0075417_10054931 | Not Available | 1730 | Open in IMG/M |
3300006049|Ga0075417_10098329 | Not Available | 1325 | Open in IMG/M |
3300006057|Ga0075026_100951639 | Not Available | 531 | Open in IMG/M |
3300006173|Ga0070716_101151077 | Not Available | 621 | Open in IMG/M |
3300006175|Ga0070712_100254179 | Not Available | 1406 | Open in IMG/M |
3300006175|Ga0070712_100370625 | Not Available | 1176 | Open in IMG/M |
3300006358|Ga0068871_100054938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3232 | Open in IMG/M |
3300006806|Ga0079220_10695939 | Not Available | 746 | Open in IMG/M |
3300006806|Ga0079220_11452439 | Not Available | 585 | Open in IMG/M |
3300006846|Ga0075430_101498724 | Not Available | 554 | Open in IMG/M |
3300006852|Ga0075433_10207936 | Not Available | 1740 | Open in IMG/M |
3300006903|Ga0075426_10258160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis | 1270 | Open in IMG/M |
3300006903|Ga0075426_11552651 | Not Available | 503 | Open in IMG/M |
3300006904|Ga0075424_101084505 | Not Available | 853 | Open in IMG/M |
3300006914|Ga0075436_100347845 | Not Available | 1068 | Open in IMG/M |
3300006914|Ga0075436_100515580 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300009012|Ga0066710_100539936 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
3300009093|Ga0105240_11566623 | Not Available | 690 | Open in IMG/M |
3300009094|Ga0111539_11289775 | Not Available | 848 | Open in IMG/M |
3300009101|Ga0105247_10546633 | Not Available | 851 | Open in IMG/M |
3300009162|Ga0075423_10100819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3022 | Open in IMG/M |
3300009162|Ga0075423_11371410 | Not Available | 756 | Open in IMG/M |
3300009168|Ga0105104_10585104 | Not Available | 634 | Open in IMG/M |
3300009177|Ga0105248_10757624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1096 | Open in IMG/M |
3300009177|Ga0105248_11104761 | Not Available | 896 | Open in IMG/M |
3300009545|Ga0105237_12499370 | Not Available | 527 | Open in IMG/M |
3300009792|Ga0126374_10885122 | Not Available | 690 | Open in IMG/M |
3300009792|Ga0126374_11546731 | Not Available | 546 | Open in IMG/M |
3300010043|Ga0126380_10000363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14581 | Open in IMG/M |
3300010043|Ga0126380_10115384 | Not Available | 1646 | Open in IMG/M |
3300010043|Ga0126380_11015381 | Not Available | 700 | Open in IMG/M |
3300010043|Ga0126380_11541038 | Not Available | 590 | Open in IMG/M |
3300010046|Ga0126384_10023815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3986 | Open in IMG/M |
3300010046|Ga0126384_10300006 | Not Available | 1320 | Open in IMG/M |
3300010046|Ga0126384_11433257 | Not Available | 645 | Open in IMG/M |
3300010046|Ga0126384_12108612 | Not Available | 541 | Open in IMG/M |
3300010047|Ga0126382_10001679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9166 | Open in IMG/M |
3300010047|Ga0126382_10011423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4285 | Open in IMG/M |
3300010047|Ga0126382_10028786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3016 | Open in IMG/M |
3300010047|Ga0126382_10033382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2852 | Open in IMG/M |
3300010047|Ga0126382_10164213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1538 | Open in IMG/M |
3300010359|Ga0126376_10373746 | Not Available | 1273 | Open in IMG/M |
3300010359|Ga0126376_10747951 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300010359|Ga0126376_12364055 | Not Available | 578 | Open in IMG/M |
3300010359|Ga0126376_12979776 | Not Available | 523 | Open in IMG/M |
3300010361|Ga0126378_10399396 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
3300010362|Ga0126377_11456253 | Not Available | 758 | Open in IMG/M |
3300010362|Ga0126377_13542478 | Not Available | 505 | Open in IMG/M |
3300010376|Ga0126381_102338432 | Not Available | 767 | Open in IMG/M |
3300010398|Ga0126383_10347076 | Not Available | 1503 | Open in IMG/M |
3300010999|Ga0138505_100045709 | Not Available | 625 | Open in IMG/M |
3300011119|Ga0105246_10117837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1963 | Open in IMG/M |
3300011120|Ga0150983_12675198 | Not Available | 511 | Open in IMG/M |
3300012948|Ga0126375_10952064 | Not Available | 695 | Open in IMG/M |
3300012948|Ga0126375_11380655 | Not Available | 596 | Open in IMG/M |
3300012951|Ga0164300_10047323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1680 | Open in IMG/M |
3300012957|Ga0164303_10006134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3877 | Open in IMG/M |
3300012957|Ga0164303_10950543 | Not Available | 607 | Open in IMG/M |
3300012958|Ga0164299_10203263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
3300012958|Ga0164299_11030283 | Not Available | 609 | Open in IMG/M |
3300012986|Ga0164304_10231766 | Not Available | 1226 | Open in IMG/M |
3300012987|Ga0164307_10163587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1479 | Open in IMG/M |
3300012987|Ga0164307_10331827 | Not Available | 1096 | Open in IMG/M |
3300012987|Ga0164307_11194468 | Not Available | 630 | Open in IMG/M |
3300014969|Ga0157376_11870210 | Not Available | 637 | Open in IMG/M |
3300015371|Ga0132258_10071640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8039 | Open in IMG/M |
3300015371|Ga0132258_10409552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3370 | Open in IMG/M |
3300015371|Ga0132258_10549933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2893 | Open in IMG/M |
3300015371|Ga0132258_12104877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1418 | Open in IMG/M |
3300015374|Ga0132255_103978026 | Not Available | 627 | Open in IMG/M |
3300017792|Ga0163161_10775930 | Not Available | 804 | Open in IMG/M |
3300017939|Ga0187775_10290801 | Not Available | 641 | Open in IMG/M |
3300017939|Ga0187775_10462349 | Not Available | 537 | Open in IMG/M |
3300017944|Ga0187786_10223143 | Not Available | 730 | Open in IMG/M |
3300018028|Ga0184608_10014612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2747 | Open in IMG/M |
3300018028|Ga0184608_10194311 | Not Available | 887 | Open in IMG/M |
3300018029|Ga0187787_10190027 | Not Available | 719 | Open in IMG/M |
3300018032|Ga0187788_10177263 | Not Available | 816 | Open in IMG/M |
3300018089|Ga0187774_10058918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1739 | Open in IMG/M |
3300019877|Ga0193722_1089808 | Not Available | 746 | Open in IMG/M |
3300019888|Ga0193751_1057327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1646 | Open in IMG/M |
3300021560|Ga0126371_12101290 | Not Available | 680 | Open in IMG/M |
3300022510|Ga0242652_1044390 | Not Available | 548 | Open in IMG/M |
3300022533|Ga0242662_10328516 | Not Available | 517 | Open in IMG/M |
3300025551|Ga0210131_1010561 | Not Available | 1248 | Open in IMG/M |
3300025899|Ga0207642_10489254 | Not Available | 751 | Open in IMG/M |
3300025915|Ga0207693_10092551 | Not Available | 2369 | Open in IMG/M |
3300025916|Ga0207663_10228435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1358 | Open in IMG/M |
3300025916|Ga0207663_10251564 | Not Available | 1301 | Open in IMG/M |
3300025916|Ga0207663_10473070 | Not Available | 970 | Open in IMG/M |
3300025921|Ga0207652_10031180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4475 | Open in IMG/M |
3300025929|Ga0207664_10112863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2263 | Open in IMG/M |
3300025934|Ga0207686_10801953 | Not Available | 755 | Open in IMG/M |
3300025939|Ga0207665_10848788 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300026078|Ga0207702_10307638 | Not Available | 1506 | Open in IMG/M |
3300026089|Ga0207648_11161339 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300027654|Ga0209799_1029067 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1224 | Open in IMG/M |
3300027873|Ga0209814_10001342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 8623 | Open in IMG/M |
3300027894|Ga0209068_10005425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6019 | Open in IMG/M |
3300027910|Ga0209583_10140159 | Not Available | 978 | Open in IMG/M |
3300027915|Ga0209069_10287511 | Not Available | 868 | Open in IMG/M |
3300028379|Ga0268266_12128062 | Not Available | 534 | Open in IMG/M |
3300028793|Ga0307299_10112306 | Not Available | 1021 | Open in IMG/M |
3300028814|Ga0307302_10414071 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 667 | Open in IMG/M |
3300030830|Ga0308205_1010687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
3300030844|Ga0075377_11641774 | Not Available | 599 | Open in IMG/M |
3300030854|Ga0075385_11390092 | Not Available | 571 | Open in IMG/M |
3300031170|Ga0307498_10109098 | Not Available | 864 | Open in IMG/M |
3300031199|Ga0307495_10157446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
3300031226|Ga0307497_10517849 | Not Available | 591 | Open in IMG/M |
3300031719|Ga0306917_10742864 | Not Available | 770 | Open in IMG/M |
3300031720|Ga0307469_12364857 | Not Available | 518 | Open in IMG/M |
3300032174|Ga0307470_10529082 | Not Available | 866 | Open in IMG/M |
3300032770|Ga0335085_11011845 | Not Available | 897 | Open in IMG/M |
3300033433|Ga0326726_10066261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3182 | Open in IMG/M |
3300033433|Ga0326726_11440280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
3300033433|Ga0326726_11821165 | Not Available | 593 | Open in IMG/M |
3300033758|Ga0314868_011047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
3300034090|Ga0326723_0016587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2975 | Open in IMG/M |
3300034090|Ga0326723_0302782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.39% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.29% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.31% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.21% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.66% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.66% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.10% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.10% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.10% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.10% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.10% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.55% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCA_7214550 | 2035918004 | Soil | MTNTNIEKNGECLLTYDVSDEALETAAGSIIAGNYTLAACTGLSVCPG |
GPICI_00027530 | 2088090015 | Soil | MMNFLAASNEEDLLTYEVSDEALESAGADQIVANYTLAACTGLSVCPG |
4MG_02475970 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MTFLATSNEEDLLTHEVSDEALERAGGNEIAGNYTLANCTGLSVCPG |
ICCgaii200_02926201 | 2228664021 | Soil | MMLFLATPAEEDLLSCEVSDEALEAAGANEVVGNYTLAACTGLSECPG |
ICChiseqgaiiFebDRAFT_110970502 | 3300000363 | Soil | MMLFLATPAEEDLLSCEVSDEALEAAGANEVVGNYTLAACTGLSECPG* |
INPhiseqgaiiFebDRAFT_1006548711 | 3300000364 | Soil | MIDAIIRSQEEENLLSYDVSDEAIEAAAKXCAAXNYTLAACTGLSVCPG* |
F14TC_1009959313 | 3300000559 | Soil | MIDAIIRSQEEENLLSYDVSDEAIEAAAKKCAATNYTLAACTGLSVCPG* |
JGI1027J12803_1038748991 | 3300000955 | Soil | MLFLATPAEEDLLSCEVSDEALEAAGANEVVGNYTLAACTGLSECPG* |
JGI25404J52841_100801011 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MMNFLASNEEDLLTYEVSDEALESAGADQIVANYTLAACTGLSVCPG* |
JGI25405J52794_100820782 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MIDAIIRSQEEENLLSYDVSDEAIEAAAKECAAANYTLAACTGLSVCPG* |
Ga0055435_100244762 | 3300003994 | Natural And Restored Wetlands | MTKFLSTLEEEDLLTYEVSDDALETAGGNEIARNYTLAACTGLSVCPG* |
Ga0062595_1004607312 | 3300004479 | Soil | MTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0062595_1015125812 | 3300004479 | Soil | GDRNMMTLLAPAEEDLLTCEVSDETLETAGANEGLGNYTLAACTGLSECPG* |
Ga0066395_102268772 | 3300004633 | Tropical Forest Soil | MTKINLEQNEESLLIYEISDEALETAVGSIIAGNYTLAACSGLSVCPG* |
Ga0062594_1023331231 | 3300005093 | Soil | MKAEDWDTIHSRIKTMTNTNIEKHEESLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0066814_100207752 | 3300005162 | Soil | GTPIHSRIKTMTNTNIEKNEESLLTYEVSDEALETAVGSIIVGNYTLAACTGLSVCPG* |
Ga0070690_1000960754 | 3300005330 | Switchgrass Rhizosphere | MMVLLATSNEEDLLTYEISDEALEAAGENETAGNYTLAACTGLAVCPS* |
Ga0066388_1003962903 | 3300005332 | Tropical Forest Soil | MTDLATTNEDNLLAYEVTDEALEIAGQNALAGNYTLAACTGLSVCPG* |
Ga0066388_1010806993 | 3300005332 | Tropical Forest Soil | MTNTHTERNEKSILVYEISDETLETAVGNIIAGNYTLAACTGLSVCPG* |
Ga0066388_1025343242 | 3300005332 | Tropical Forest Soil | MTKIHATANEDSVLTQEISDEVLEIAGGNEIAGHYTLASCTGLSVCPG* |
Ga0068869_1020047261 | 3300005334 | Miscanthus Rhizosphere | EESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0068868_1014421882 | 3300005338 | Miscanthus Rhizosphere | MTNTNIEKHEESLLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0070691_100982124 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNTNIEKNEETLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0070675_1008756961 | 3300005354 | Miscanthus Rhizosphere | MMVVLSTSNEEDFLTYEISDEALEAAGENETAGNYTLAACTGLSVCPS* |
Ga0070671_1000198784 | 3300005355 | Switchgrass Rhizosphere | MMVLLATSHEEDLLTYEVSDEALEAAGENETAGNYTLAACTGLSVCPS* |
Ga0070671_1004813851 | 3300005355 | Switchgrass Rhizosphere | MKAEDWDTIHSRIKTMTNTNIEKHEESLLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0070667_1004930462 | 3300005367 | Switchgrass Rhizosphere | MTNTNIEKHEESLLTYEVSDEALEIAVGNTVAGNYTLAACTGLSVCPG* |
Ga0070709_111513582 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNTNIEKHEESLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0070709_113810881 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFLSTLDEENLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG* |
Ga0070713_1002862283 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DWDTIHSRIKTMTNTNIEKHEESLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0070711_1003637411 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTFLSALDEEGFLTYEVSDDVLETAGENNIAGNYTLASCTGLSVCPG* |
Ga0070711_1004639543 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIMTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0070711_1011948781 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EEDLLTYEISDEALEAAGENETAGNYTLAACTGLSVCPS* |
Ga0070662_1000364766 | 3300005457 | Corn Rhizosphere | MMVLLATSHEEDLLTYEISDEALEAAGENETAGNYTLAACTGLSVCPS* |
Ga0070681_112402982 | 3300005458 | Corn Rhizosphere | MTNTNIEKHEESLLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVC |
Ga0070672_1002955313 | 3300005543 | Miscanthus Rhizosphere | MKAEDWDTIHSRIKTMTNTNIEKHEESLLTYEVSDEALEIAVGNTVAGNYTLAACTGLSVCPG* |
Ga0070665_1009791682 | 3300005548 | Switchgrass Rhizosphere | MMVLLATSNEEDLLTYEISDEALEAAGENETAGNYTLAACTGLSVCPS* |
Ga0068864_1024869021 | 3300005618 | Switchgrass Rhizosphere | MTNTNIEKHEESLTYEVSDEALEIAVGSIVAGNYTLAACTG |
Ga0066905_1000154193 | 3300005713 | Tropical Forest Soil | MIDATIRSQEEENLLSYDVSDEAIEAAAKKCAAANYTLAACTGLSVCPG* |
Ga0066905_1000236082 | 3300005713 | Tropical Forest Soil | MMNFLATSNEEELVTHEVSDEALESAGSDQIVANYTLAACTGLSVCPG* |
Ga0066905_1000382134 | 3300005713 | Tropical Forest Soil | MIDASIRSQEEENLLSYDVSDEAIEAAATKCAAANYTLAACTGLSVCPG* |
Ga0066905_1000601534 | 3300005713 | Tropical Forest Soil | MMNFLATSNEEDVLSREVSDEVLEAAGSDQIGANYTLAACTGLSVCPG* |
Ga0066905_1000799582 | 3300005713 | Tropical Forest Soil | MMTFLATSKEEDLLTQEVSDEALEAAGGNEAVGNYTLAACTGLSVCPG* |
Ga0066905_1001094193 | 3300005713 | Tropical Forest Soil | MTDPNIGHQEEEYLTYDVSDEAIEAAGSALAGHYTLAACTGLSVCPG* |
Ga0066905_1001192943 | 3300005713 | Tropical Forest Soil | MMTLLATSNEEDLLTHEVSDEALEAAGGNEAVGNYTLAACTGLSVCPG* |
Ga0066905_1001272831 | 3300005713 | Tropical Forest Soil | MMNFLSTSTEEDVLIHEVSDEVLESAGTDQIVANYTLAACTGLSVCPG* |
Ga0066905_1008154702 | 3300005713 | Tropical Forest Soil | MIDAIIRSQEEENLLSYDVSDEAIEAAATKCAAANYTLAACTGLSVCPG* |
Ga0066905_1008311122 | 3300005713 | Tropical Forest Soil | MIDAIIRSQEEENLLSYDVSDEAIEAAAKKCAAANYTLAACTGLSVCPG* |
Ga0066905_1008512102 | 3300005713 | Tropical Forest Soil | MTFLATSNEEDLLTREVSDEALEAAGANEVAGNYTLAACTGLSVCPG* |
Ga0066905_1008997892 | 3300005713 | Tropical Forest Soil | MIDAIIKSQEEENLLSYDVSDEAIEAAAKKCAAANYTLAACTGLSVCPG* |
Ga0066905_1009905372 | 3300005713 | Tropical Forest Soil | MMNFLATSTEEDVLIHEVSDEVLESAGTDQIVANYTLAACTGLSVCPG* |
Ga0066905_1016577771 | 3300005713 | Tropical Forest Soil | MITLLTTLSEEELLTYEVSDEALENAGANETATNYTLAACTGLSVCPG* |
Ga0066905_1017203082 | 3300005713 | Tropical Forest Soil | MIDAIIQEEENLLSYDVSDEAIEAAAKKCAAVNYTLAACTGLSVCPG* |
Ga0066903_1011766362 | 3300005764 | Tropical Forest Soil | MTKILATANEDNVLTREISDEVLEIAGGNEIAGHYTLASCTGLSVCPG* |
Ga0066903_1067907123 | 3300005764 | Tropical Forest Soil | KNEESLLTYEVSDEALETAVGTIIAGNYTLAACTGLSVCPG* |
Ga0081455_101661283 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MINFLAASNEEDALTHEVSDEVLESAGTDQIVANYTLAACTGLSVCPG* |
Ga0070717_105566042 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNTNIEKNGESLLTYDVSDEALETAAGSIIAGNYTLAACTGLSVCPG* |
Ga0075023_1000057446 | 3300006041 | Watersheds | MMKFLSTSNEENPLAYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG* |
Ga0075023_1000152423 | 3300006041 | Watersheds | MTKILSPSKEENLLAYEVSDEALEAAGGTEIAANYTLAACTGLSVCPG* |
Ga0075417_100173285 | 3300006049 | Populus Rhizosphere | MMNFLATSIEEDVLIHEVSDEVLESAGTDQIVANYTLAACTGLSVCPG* |
Ga0075417_100449864 | 3300006049 | Populus Rhizosphere | MIDAIIGSQEEENLLSYDVSDEAIEAAARKCAAANYTLAACTGLSVCPG* |
Ga0075417_100549313 | 3300006049 | Populus Rhizosphere | MTFLATSNEEDLLTHEVSDEALERAGGNEIAGNYTLANCTGLSVCPG* |
Ga0075417_100983292 | 3300006049 | Populus Rhizosphere | MMTFLAEEDLPACEVSDEALEAAGANEVVRNYTLAACTGLSECPG* |
Ga0075026_1009516392 | 3300006057 | Watersheds | MMKFLGTLNEEDLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG* |
Ga0070716_1011510772 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TSNEEDLLTYEISDEALEAAGENETAGNYTLAACTGLSVCPS* |
Ga0070712_1002541793 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTFLSAIDEEGFLTHEVSDDVLETAGGNNIGGNYTLASCTGLSVCPG* |
Ga0070712_1003706252 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDTNIEKNEESLLTYEVSDEALETAVGSTIAGNYTLAACTGLSVCPG* |
Ga0068871_1000549381 | 3300006358 | Miscanthus Rhizosphere | SRIKTMTNTNIEKHEESLLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0079220_106959392 | 3300006806 | Agricultural Soil | MMTLSRSPNEENLLIYQVSDEALETAAGHEIAGNYTLASCTGLSVCPG* |
Ga0079220_114524391 | 3300006806 | Agricultural Soil | NIEKSEESLLTYEISDEALETAVGNIIAGNYTLAACTGLSVCPG* |
Ga0075430_1014987241 | 3300006846 | Populus Rhizosphere | MMTFLAVSSEEDLLTHEVSDEALEAAGGGDAAGNYTLAACTGLSECPG* |
Ga0075433_102079365 | 3300006852 | Populus Rhizosphere | MMTFLAEEDLPACEVSDEALEAAGVNEVVGNYTLAACTGLSECPG* |
Ga0075426_102581601 | 3300006903 | Populus Rhizosphere | NFLATSIEEDVLIHEVSDEVLESAGTDQIVANYTLAACTGLSVCPG* |
Ga0075426_115526512 | 3300006903 | Populus Rhizosphere | MTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCP |
Ga0075424_1010845051 | 3300006904 | Populus Rhizosphere | MMTLLAPAEEDLLTCEVSDETLETAGANEGLGNYTLAAC |
Ga0075436_1003478452 | 3300006914 | Populus Rhizosphere | MIDAIIGSQEEENLLSYDVSDEAIEAAAKKCAATNYTLAACTGLSVCPG* |
Ga0075436_1005155801 | 3300006914 | Populus Rhizosphere | YTCGVLSHLVTGDRNMMTFHTTSNEEDFLIHELSDEALEAAGGNEVAARYTLANCTGLSECPG* |
Ga0066710_1005399362 | 3300009012 | Grasslands Soil | MMTFFSTANEETLLIYEVSDEVLETAGGNEIAGNYTLASCTGLSVCPG |
Ga0105240_115666231 | 3300009093 | Corn Rhizosphere | MKAEDWDTIHSRIKTMTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0111539_112897751 | 3300009094 | Populus Rhizosphere | MMTLLAPAEEDLLTCEVSDETLETAGANEGLGNYTLAACTGLSECPG* |
Ga0105247_105466331 | 3300009101 | Switchgrass Rhizosphere | MTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVC |
Ga0075423_101008194 | 3300009162 | Populus Rhizosphere | MIDAIIRSQEEENLLSYDVSDEAIEAAARKCAAANYTIAACTGLSVCPG* |
Ga0075423_113714101 | 3300009162 | Populus Rhizosphere | MLTFLATSNEENFLIHELPDEALEAAGGNEIAARYTLANCTGLSVCPG* |
Ga0105104_105851042 | 3300009168 | Freshwater Sediment | MAFLATSNEEDPLTHEVSDEALERAGWNEVAGNYTLAACTGLSVCPG* |
Ga0105248_107576242 | 3300009177 | Switchgrass Rhizosphere | MMVLLATSNEEDLLTYEISDEALEAAGENETAGNYTLAACTGLSVC |
Ga0105248_111047611 | 3300009177 | Switchgrass Rhizosphere | EESLLTYEVSDEALEIAVGNTVAGNYTLAACTGLSVCPG* |
Ga0105237_124993703 | 3300009545 | Corn Rhizosphere | SRIKTMTNTNIEKHEESLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0126374_108851221 | 3300009792 | Tropical Forest Soil | MDIEKNEEGLLSYEVSDEALETAVGNIIAGNYTLAACTGLSVCPG* |
Ga0126374_115467311 | 3300009792 | Tropical Forest Soil | RTVCSLLPIFLNHRRQQMMTFLGTSNEEGLPTHEVPDEALERAGGNEVAGNYTLANCTGLSECPG* |
Ga0126380_1000036316 | 3300010043 | Tropical Forest Soil | MMNFLATSIEEDVLSREVSDEVLEAAGSDQIGANYTLAACTGLSVCPG* |
Ga0126380_101153842 | 3300010043 | Tropical Forest Soil | MITFLTTLSEEELLTYEVSDEALENAGANETATNYTLAACTGLSECPG* |
Ga0126380_110153812 | 3300010043 | Tropical Forest Soil | MMTFLATSKEEELLTQEVSDEALEAAGGNEAVGNYTLAACTGLSVCPG* |
Ga0126380_115410381 | 3300010043 | Tropical Forest Soil | MSNMNSEWNEESILAYEISDEVLETAVGNIIAGNYTLASCTGLSVCPG* |
Ga0126384_100238154 | 3300010046 | Tropical Forest Soil | MMKFLSTPDEENLLTYEVSDEALETAGGDEIAGNYTLAACTGLSVCPG* |
Ga0126384_103000061 | 3300010046 | Tropical Forest Soil | TRTERRSRMITFLTTLSEEELLTYEVSDEALENAGANEAATNYTLAACTGLSECPG* |
Ga0126384_114332572 | 3300010046 | Tropical Forest Soil | MTNINTERNEESILVYEISDEALETAVGNIIAGNYTLAACTGLSVCPG* |
Ga0126384_121086121 | 3300010046 | Tropical Forest Soil | RMITFLTTLSEEELLTYEVSDEALENAGANETATNYTLAACTGLSVCPG* |
Ga0126382_100016796 | 3300010047 | Tropical Forest Soil | MTDPNIGHQEEEYLTYDVSDEAIEPAGSALAGHYTLAACTGLSVCPG* |
Ga0126382_100114238 | 3300010047 | Tropical Forest Soil | MITFLTTLSEEELLTYEVSDEALENAGANEAATNYTLAACTGLSECPG* |
Ga0126382_100287862 | 3300010047 | Tropical Forest Soil | MVTGDRNMMTFLATSNEEDLLTHEVSDEALEAAAGNEVVGNYTLAACTGLSVCPG* |
Ga0126382_100333823 | 3300010047 | Tropical Forest Soil | MAQSDLGDCEMMTFLATLSEEDLLTHEVSDEALEAAGGIEAAGNYTLAACTGLSVCPG* |
Ga0126382_101642131 | 3300010047 | Tropical Forest Soil | TSKEEDLLTQEVSDEALEAAGGNEAVGNYTLAACTGLSVCPG* |
Ga0126376_103737463 | 3300010359 | Tropical Forest Soil | MTNTHTERNEESILVYEISDETLETAVGNIIAGNYTLAACTGLSVCPG* |
Ga0126376_107479511 | 3300010359 | Tropical Forest Soil | MVTGDRNMMTFLATSNEEDLLTHEVSDEALEAAGGNEAVGNYTLAACTGLSVCPG* |
Ga0126376_123640552 | 3300010359 | Tropical Forest Soil | RMITFLTTLSEEELLTYEVSDEALENAGANETATNYTLAACTGLSECPG* |
Ga0126376_129797761 | 3300010359 | Tropical Forest Soil | MMTFLATSNEEDLLTCEVSDEALEAAGANEVVGNYTLAACTGLSVCPG* |
Ga0126378_103993961 | 3300010361 | Tropical Forest Soil | MMTFLATSNEEDLLTCEVTDEALEAAGANEVVGNYTLAACTGLSVCPG* |
Ga0126377_114562531 | 3300010362 | Tropical Forest Soil | MSNMNSERNEESILVYEISDEALETAVGNIIAGNYTLASCTGLSVCPG* |
Ga0126377_135424781 | 3300010362 | Tropical Forest Soil | MIDAIIRSQEEENLLSYDVSDEAIEAAAKKCAAVNYTLAACTGLSVCPG* |
Ga0126381_1023384321 | 3300010376 | Tropical Forest Soil | MDIEKNEEGLLSYEVSDEALETAVGNIIAGNYTLAACTGLSVCPG |
Ga0126383_103470761 | 3300010398 | Tropical Forest Soil | ERVPPTRTERRSRMITFLTTLSEEELLTYEVSDEALENAGANETATNYTLAACTGLSECPG* |
Ga0138505_1000457092 | 3300010999 | Soil | MIDAITRSQEEENLLSYDVSDEAIEAAAKKCAAANYTLAACTGLSVCPG* |
Ga0105246_101178373 | 3300011119 | Miscanthus Rhizosphere | MKAEDWDTIHSRIKTMTNTNIEKHEESLTYEVSDEALEIAVGNTVAGNYTLAACTGLSVCPG* |
Ga0150983_126751981 | 3300011120 | Forest Soil | TPIHSRTKSMTDTNIEKNEESLTYEVSDEALETAVGSTIAWNYTLAACTGLSVCPG* |
Ga0126375_109520641 | 3300012948 | Tropical Forest Soil | MMTFLATSNEEDLLTREVSDEALEAAGANEVAGNYTLAACTGLSVCPG* |
Ga0126375_113806551 | 3300012948 | Tropical Forest Soil | MMTFLATLNEDDLLTHEVSDEALEAAGETEIAGNYTLAACTGLSVCPG* |
Ga0164300_100473231 | 3300012951 | Soil | RIKTMTNTNIEKHEESLLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0164303_100061341 | 3300012957 | Soil | MMKFLSASNEENPLVYEVSDEALEIAGGNEIAGNYTLANCTGLSVCPG* |
Ga0164303_109505431 | 3300012957 | Soil | MTNTNIEKNEESLFTYDVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0164299_102032633 | 3300012958 | Soil | SCRVFNHRRSNMMKFLSASNEENPLVYEVSDEALEIAGGNEIAGNYTLANCTGLSVCPG* |
Ga0164299_110302833 | 3300012958 | Soil | TMTNTNIEKHEESLLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG* |
Ga0164304_102317662 | 3300012986 | Soil | MKAEDWDTIHSRIKTMTNTNIEKNEETLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0164307_101635873 | 3300012987 | Soil | NHRRSNMMKFLSASNEENPLVYEVSDEALEIAGGNEIAGNYTLANCTGLSVCPG* |
Ga0164307_103318271 | 3300012987 | Soil | TDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0164307_111944681 | 3300012987 | Soil | RTKTMTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG* |
Ga0157376_118702101 | 3300014969 | Miscanthus Rhizosphere | MMVVLSTSNEEDFLTYEISDEALEAAGENETAGNYTLAAC |
Ga0132258_100716405 | 3300015371 | Arabidopsis Rhizosphere | MTTHMITEINEETLLTYEVPDEALETAVGRIIAGSYTLAACTGLSVCPG* |
Ga0132258_104095524 | 3300015371 | Arabidopsis Rhizosphere | MSNMNSERNEEGILVYEISDEALETAVGNIIAGNYTLASCTGLSVCPG* |
Ga0132258_105499336 | 3300015371 | Arabidopsis Rhizosphere | MMKFPRSSDEVNLLAYEVSDEALETAGGGEIAGNYTLAACTGLSVCPS* |
Ga0132258_121048772 | 3300015371 | Arabidopsis Rhizosphere | MMTFLSALEEEGFLTYEVSDDVLETAGENNIAGNYTLASCTGLSVCPG* |
Ga0132255_1039780261 | 3300015374 | Arabidopsis Rhizosphere | MESMTTSTNIEKSEESLLSYEVSDEALETAVGNMIARHYTLAACTG |
Ga0163161_107759301 | 3300017792 | Switchgrass Rhizosphere | MKAEDWDTIHSRIKTMTNTNIEKHEESLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG |
Ga0187775_102908011 | 3300017939 | Tropical Peatland | MTKILSTLDEEDLLTYEVSDDALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0187775_104623491 | 3300017939 | Tropical Peatland | RSNMMRFLSTSNEEDFLTFEVSDDALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0187786_102231431 | 3300017944 | Tropical Peatland | MNKAMSEQNEEDLLTYEVSDDALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0184608_100146122 | 3300018028 | Groundwater Sediment | MMTFLATSNEEDLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0184608_101943113 | 3300018028 | Groundwater Sediment | MMKFLNTLDEENLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0187787_101900272 | 3300018029 | Tropical Peatland | MTKILSTLDEEDLLTYEVSDDALETAGGNEFAGNYTLAACTGLSVCPG |
Ga0187788_101772632 | 3300018032 | Tropical Peatland | MTETLIEYDESGQTALTYDVSDEVLERTVGEIVAGNYTLAACTGLSVCPG |
Ga0187774_100589182 | 3300018089 | Tropical Peatland | MMKFLSTLDEENLLTYEVSDDALESAGGSEIAGNYTLAACTGLSVCPG |
Ga0193722_10898081 | 3300019877 | Soil | MTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG |
Ga0193751_10573272 | 3300019888 | Soil | MMKSLSTLDEENLLTYEVADEALEAAGGNEIAGNYTLAACTGLSVCPG |
Ga0126371_121012901 | 3300021560 | Tropical Forest Soil | MTKILATANEDNVLTREISDEVLEIAGGNEIAGHYTLASCTGLSVCPG |
Ga0242652_10443901 | 3300022510 | Soil | PIHSRTKTMTNTNIEKNEESLLTYEVSDEAIETAVGSIIAGKYTLAACTGLSVCPG |
Ga0242662_103285163 | 3300022533 | Soil | GTPIHSRTKTMTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG |
Ga0210131_10105613 | 3300025551 | Natural And Restored Wetlands | MTKFLSTLEEEDLLTYEVSDDALETAGGNEIARNYTLAACTGLSVCPG |
Ga0207642_104892542 | 3300025899 | Miscanthus Rhizosphere | MTDRNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG |
Ga0207693_100925514 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDTNIEKNEESLLTYEVSDEALETAVGSTIAGNYTLAACTGLSVCPG |
Ga0207663_102284351 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTFLSALDEEGFLTYEVSDDVLETAGENNIGGNYTLASCTGLSVCPG |
Ga0207663_102515644 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SNEEDLLTYEISDEALEAAGENETAGNYTLAACTGLSVCPS |
Ga0207663_104730702 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNTNIEKNEETLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG |
Ga0207652_100311801 | 3300025921 | Corn Rhizosphere | TNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG |
Ga0207664_101128634 | 3300025929 | Agricultural Soil | MTNTNIEKKHEESLTYEVSDEALEIAVGSIVAGNYTLAACTGLSVCPG |
Ga0207686_108019531 | 3300025934 | Miscanthus Rhizosphere | TIHSRIKTMTNTNIEKHEESLLTYEVSDEALEIAVGNTVAGNYTLAACTGLSVCPG |
Ga0207665_108487882 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNTNIEKNGESLLTYDFSDEALETAAGSIIAGNYTLAACTGLSVCPG |
Ga0207702_103076384 | 3300026078 | Corn Rhizosphere | MMVVLSTSNEEDFLTYEISDEALEAAGENETAGNYTLAACTGLSVCPS |
Ga0207648_111613393 | 3300026089 | Miscanthus Rhizosphere | MTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACT |
Ga0209799_10290672 | 3300027654 | Tropical Forest Soil | MITFLTTLSEEELLTYEVSDEALETAGGDEIAGNYTLAACTGLSVCPG |
Ga0209814_100013429 | 3300027873 | Populus Rhizosphere | MMNFLATSIEEDVLIHEVSDEVLESAGTDQIVANYTLAACTGLSVCPG |
Ga0209068_100054257 | 3300027894 | Watersheds | MMKFLSTSNEENPLAYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0209583_101401593 | 3300027910 | Watersheds | MTKFLSTLNEEDLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0209069_102875113 | 3300027915 | Watersheds | MTKILSPSKEENLLAYEVSDEALEAAGGTEIAANYTLAACTGLSVCPG |
Ga0268266_121280621 | 3300028379 | Switchgrass Rhizosphere | MTNTNIEKHEESLLTYEVSDEALEIAVGSIVAGNYTLAACTGLSV |
Ga0307299_101123061 | 3300028793 | Soil | QDEEILFSYEISDVVLESAGGKEIAGHYTLAACTGLSVCPG |
Ga0307302_104140712 | 3300028814 | Soil | GDSNMMTFLATSNEEDLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0308205_10106872 | 3300030830 | Soil | MMTFLATSNEEDLLTFEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0075377_116417741 | 3300030844 | Soil | MMTFLSALEEEGFLTYEVSDDVLETAGENNIAGNYTLASCTGLSVCPG |
Ga0075385_113900921 | 3300030854 | Soil | MMTFLSALEEECFLTYEVSDDVLETAGENNIAGNYTLASCTGLSVCPG |
Ga0307498_101090981 | 3300031170 | Soil | MMKFLRTLDEENLLTYEVPDEALETAGGNEIAANYTLAACTGLSVCPG |
Ga0307495_101574461 | 3300031199 | Soil | MMTFLSALDEEGFLTYEVSDDVLETAGENNIAGNYTLASRTGLSVCPG |
Ga0307497_105178491 | 3300031226 | Soil | LGTPIHSRTKTMTDTNIEKNEESLLTYEVSDEALETAVGSIIAGNYTLAACTGLSVCPG |
Ga0306917_107428642 | 3300031719 | Soil | MTKILATANEDNVLTYEISDEVLEIAGGNEIAGHYTLASCTGLSVCPG |
Ga0307469_123648572 | 3300031720 | Hardwood Forest Soil | MTDTNIEKNEESLLAYDVSDEALETAVGSIIAGNYTLAACTGLSVCPG |
Ga0307470_105290821 | 3300032174 | Hardwood Forest Soil | MTDTNIEQNEESFLIYDVSDEALETAVGSIIAGNYTLAACTGLSVCPG |
Ga0335085_110118452 | 3300032770 | Soil | MTKVLSASKEENLLAYEVSDEALEAAGGTEIAGNYTLAACTGLSVCPG |
Ga0326726_100662616 | 3300033433 | Peat Soil | MTKVLSASKEENLLAYEVSDEALEAAGGTEIAGSYTLAACTGLSVCPG |
Ga0326726_114402801 | 3300033433 | Peat Soil | MTKILSPSKEENLFAYEVSDEALEAAGGTEIAANYTLAACTGLSVCPG |
Ga0326726_118211651 | 3300033433 | Peat Soil | MMKFLGTLNEEDLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
Ga0314868_011047_1_120 | 3300033758 | Peatland | MTKVLSASKEENLLAYEVSDEALEAAGGTEIAGTYTLAAC |
Ga0326723_0016587_393_539 | 3300034090 | Peat Soil | MMKFLSTLEEEDLLTYEVSDDALETAGGNEIARNYTLAACTGLSVCPG |
Ga0326723_0302782_22_168 | 3300034090 | Peat Soil | MTKILSPSKEENLPAYEVSDEALEAAGGTEIAANYTLAACTGLSVCPG |
⦗Top⦘ |