NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032012

Metagenome / Metatranscriptome Family F032012

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032012
Family Type Metagenome / Metatranscriptome
Number of Sequences 181
Average Sequence Length 54 residues
Representative Sequence MERAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEA
Number of Associated Samples 159
Number of Associated Scaffolds 181

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.73 %
% of genes near scaffold ends (potentially truncated) 95.58 %
% of genes from short scaffolds (< 2000 bps) 90.06 %
Associated GOLD sequencing projects 150
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.796 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(41.989 % of family members)
Environment Ontology (ENVO) Unclassified
(35.359 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.227 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.22%    β-sheet: 20.99%    Coil/Unstructured: 56.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 181 Family Scaffolds
PF00580UvrD-helicase 64.64
PF13377Peripla_BP_3 16.57
PF13361UvrD_C 4.97
PF08281Sigma70_r4_2 1.66
PF04542Sigma70_r2 1.66
PF13560HTH_31 1.10
PF06445GyrI-like 0.55
PF13245AAA_19 0.55
PF07690MFS_1 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 181 Family Scaffolds
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 64.64
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 64.64
COG3973DNA helicase IVReplication, recombination and repair [L] 64.64
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.66
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.66
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.66
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.80 %
UnclassifiedrootN/A23.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10063652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2081Open in IMG/M
3300005161|Ga0066807_1017188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300005165|Ga0066869_10019942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1003Open in IMG/M
3300005340|Ga0070689_100591132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis960Open in IMG/M
3300005451|Ga0066681_10704246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae615Open in IMG/M
3300005471|Ga0070698_100452044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1220Open in IMG/M
3300005530|Ga0070679_100149746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae2310Open in IMG/M
3300005610|Ga0070763_10534962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300005610|Ga0070763_10535139All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005764|Ga0066903_101709756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1198Open in IMG/M
3300005764|Ga0066903_102934458Not Available924Open in IMG/M
3300006028|Ga0070717_11245152Not Available677Open in IMG/M
3300006041|Ga0075023_100363378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300006050|Ga0075028_100352421Not Available831Open in IMG/M
3300006172|Ga0075018_10550255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300006173|Ga0070716_101101204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix633Open in IMG/M
3300006176|Ga0070765_101084155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300006755|Ga0079222_12451507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300006893|Ga0073928_10815140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales644Open in IMG/M
3300009137|Ga0066709_103086792All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300009545|Ga0105237_12563044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae520Open in IMG/M
3300009672|Ga0116215_1496718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300009683|Ga0116224_10589250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300009698|Ga0116216_10967367Not Available509Open in IMG/M
3300010043|Ga0126380_11131713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia670Open in IMG/M
3300010322|Ga0134084_10361290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300010343|Ga0074044_11156612Not Available505Open in IMG/M
3300010358|Ga0126370_10739833Not Available869Open in IMG/M
3300010362|Ga0126377_10164621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2096Open in IMG/M
3300010379|Ga0136449_101429456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1065Open in IMG/M
3300011106|Ga0151489_1186318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia944Open in IMG/M
3300012502|Ga0157347_1027890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300012971|Ga0126369_13015349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300013104|Ga0157370_10600858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1007Open in IMG/M
3300013104|Ga0157370_11620192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae581Open in IMG/M
3300013296|Ga0157374_10405603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1360Open in IMG/M
3300015241|Ga0137418_10949866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia627Open in IMG/M
3300015372|Ga0132256_100665086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1157Open in IMG/M
3300016341|Ga0182035_11601353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300016357|Ga0182032_10333265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1209Open in IMG/M
3300017822|Ga0187802_10465050Not Available501Open in IMG/M
3300017926|Ga0187807_1292797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300017932|Ga0187814_10163925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori830Open in IMG/M
3300017933|Ga0187801_10408820Not Available565Open in IMG/M
3300017936|Ga0187821_10309431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300017942|Ga0187808_10027771Not Available2326Open in IMG/M
3300017970|Ga0187783_10127131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1879Open in IMG/M
3300018007|Ga0187805_10215188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia878Open in IMG/M
3300018043|Ga0187887_10768892Not Available569Open in IMG/M
3300018060|Ga0187765_10588450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia717Open in IMG/M
3300018062|Ga0187784_11701227Not Available500Open in IMG/M
3300018064|Ga0187773_10707734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300021171|Ga0210405_10154322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1818Open in IMG/M
3300021178|Ga0210408_10664192Not Available823Open in IMG/M
3300021178|Ga0210408_11419812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300021403|Ga0210397_10800934All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300021405|Ga0210387_10099482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2430Open in IMG/M
3300021405|Ga0210387_11179895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia665Open in IMG/M
3300021407|Ga0210383_11212991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300021432|Ga0210384_10443964Not Available1168Open in IMG/M
3300021433|Ga0210391_10274998Not Available1322Open in IMG/M
3300021478|Ga0210402_10615577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1006Open in IMG/M
3300021479|Ga0210410_11386803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300021559|Ga0210409_11045634All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300021953|Ga0213880_10247459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300024232|Ga0247664_1025412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1379Open in IMG/M
3300024283|Ga0247670_1016201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1338Open in IMG/M
3300024295|Ga0224556_1095364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia729Open in IMG/M
3300024323|Ga0247666_1031309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1109Open in IMG/M
3300024325|Ga0247678_1014086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1186Open in IMG/M
3300025320|Ga0209171_10492864Not Available609Open in IMG/M
3300025634|Ga0208589_1142342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300025885|Ga0207653_10017380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae2264Open in IMG/M
3300025912|Ga0207707_10563392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis967Open in IMG/M
3300025916|Ga0207663_10528637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis919Open in IMG/M
3300025927|Ga0207687_11582246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae563Open in IMG/M
3300025928|Ga0207700_10254892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1500Open in IMG/M
3300025929|Ga0207664_11058683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae726Open in IMG/M
3300025935|Ga0207709_10533073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae921Open in IMG/M
3300025939|Ga0207665_10476693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia961Open in IMG/M
3300025940|Ga0207691_10797108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae794Open in IMG/M
3300025941|Ga0207711_10205240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1799Open in IMG/M
3300025945|Ga0207679_10804251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae857Open in IMG/M
3300025981|Ga0207640_10311449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1249Open in IMG/M
3300026078|Ga0207702_11569128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae652Open in IMG/M
3300026374|Ga0257146_1021139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1058Open in IMG/M
3300026494|Ga0257159_1067963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Quadrisphaera → environmental samples → uncultured Quadrisphaera sp.613Open in IMG/M
3300026551|Ga0209648_10220968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1428Open in IMG/M
3300026911|Ga0209620_1000634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae2163Open in IMG/M
3300027174|Ga0207948_1041460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300027297|Ga0208241_1005962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1608Open in IMG/M
3300027497|Ga0208199_1006323All Organisms → cellular organisms → Bacteria2957Open in IMG/M
3300027787|Ga0209074_10078973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1071Open in IMG/M
3300027895|Ga0209624_11019367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300028146|Ga0247682_1106059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae526Open in IMG/M
3300028789|Ga0302232_10011082All Organisms → cellular organisms → Bacteria5422Open in IMG/M
3300028808|Ga0302228_10451357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300028906|Ga0308309_10490959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1061Open in IMG/M
3300030056|Ga0302181_10122765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1264Open in IMG/M
3300030399|Ga0311353_10669409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia899Open in IMG/M
3300030494|Ga0310037_10106072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1300Open in IMG/M
3300030503|Ga0311370_10947018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia969Open in IMG/M
3300030739|Ga0302311_10513601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300031184|Ga0307499_10070981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis899Open in IMG/M
3300031199|Ga0307495_10176088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia572Open in IMG/M
3300031543|Ga0318516_10718079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300031549|Ga0318571_10163560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia776Open in IMG/M
3300031640|Ga0318555_10198000Not Available1083Open in IMG/M
3300031681|Ga0318572_10165973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1280Open in IMG/M
3300031708|Ga0310686_112795038Not Available1047Open in IMG/M
3300031719|Ga0306917_10790607Not Available744Open in IMG/M
3300031736|Ga0318501_10135592All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300031748|Ga0318492_10057041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1838Open in IMG/M
3300031748|Ga0318492_10415788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia708Open in IMG/M
3300031748|Ga0318492_10716533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300031751|Ga0318494_10430418Not Available767Open in IMG/M
3300031765|Ga0318554_10827167All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300031769|Ga0318526_10110708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1102Open in IMG/M
3300031770|Ga0318521_10740620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300031782|Ga0318552_10246897Not Available905Open in IMG/M
3300031782|Ga0318552_10555045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300031795|Ga0318557_10157813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1027Open in IMG/M
3300031795|Ga0318557_10369282Not Available659Open in IMG/M
3300031796|Ga0318576_10607402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300031798|Ga0318523_10235317Not Available915Open in IMG/M
3300031798|Ga0318523_10263526Not Available861Open in IMG/M
3300031798|Ga0318523_10384900All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300031819|Ga0318568_10863783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300031823|Ga0307478_10918744Not Available732Open in IMG/M
3300031831|Ga0318564_10033406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2198Open in IMG/M
3300031831|Ga0318564_10426032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300031833|Ga0310917_10369528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia974Open in IMG/M
3300031833|Ga0310917_11181088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300031835|Ga0318517_10090867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1332Open in IMG/M
3300031835|Ga0318517_10272408Not Available764Open in IMG/M
3300031835|Ga0318517_10481949All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031846|Ga0318512_10725767All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031880|Ga0318544_10204645Not Available762Open in IMG/M
3300031910|Ga0306923_11978981Not Available592Open in IMG/M
3300031912|Ga0306921_10942453Not Available977Open in IMG/M
3300031938|Ga0308175_103232650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300031942|Ga0310916_11477657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300031945|Ga0310913_10605270Not Available777Open in IMG/M
3300031945|Ga0310913_11095535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300031981|Ga0318531_10347157All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300031996|Ga0308176_10952268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis904Open in IMG/M
3300032009|Ga0318563_10228455Not Available1004Open in IMG/M
3300032009|Ga0318563_10549494Not Available623Open in IMG/M
3300032025|Ga0318507_10060861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1509Open in IMG/M
3300032025|Ga0318507_10247600Not Available773Open in IMG/M
3300032039|Ga0318559_10609424All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300032041|Ga0318549_10143823Not Available1059Open in IMG/M
3300032043|Ga0318556_10160124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1164Open in IMG/M
3300032054|Ga0318570_10476394All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300032060|Ga0318505_10584081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300032063|Ga0318504_10163497Not Available1029Open in IMG/M
3300032064|Ga0318510_10370444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300032064|Ga0318510_10500035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300032066|Ga0318514_10564296All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300032067|Ga0318524_10355126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300032068|Ga0318553_10199806Not Available1042Open in IMG/M
3300032076|Ga0306924_11660072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia671Open in IMG/M
3300032089|Ga0318525_10265086Not Available883Open in IMG/M
3300032160|Ga0311301_10192246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3527Open in IMG/M
3300032205|Ga0307472_102665514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300032261|Ga0306920_102467817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300032261|Ga0306920_104178080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300032770|Ga0335085_12173652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300032805|Ga0335078_11490068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300032892|Ga0335081_11664460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia697Open in IMG/M
3300032954|Ga0335083_10125204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura parvosata2475Open in IMG/M
3300033004|Ga0335084_11635564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300033289|Ga0310914_10134061Not Available2168Open in IMG/M
3300033290|Ga0318519_10459715All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300033290|Ga0318519_11074817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300034819|Ga0373958_0032750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora mirobrigensis1028Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil41.99%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.21%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.21%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.21%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.66%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.10%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.10%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.10%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.10%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.10%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.55%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.55%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.55%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.55%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.55%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.55%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.55%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.55%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026911Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027174Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1006365223300001356Peatlands SoilMERAELDQIERVINHELRERFLTGAVERAVLLQHGDDPAIEPGQLLVRVFV
Ga0066807_101718823300005161SoilMERAGQAMVERVINHEMQEPFGAGAVQRAVLLQHGDDPAIE
Ga0066869_1001994223300005165SoilMERAGQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQL
Ga0070689_10059113223300005340Switchgrass RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAW
Ga0066681_1070424613300005451SoilVTGEPTGGGAMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDP
Ga0070698_10045204423300005471Corn, Switchgrass And Miscanthus RhizosphereMERAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLT
Ga0070679_10014974633300005530Corn RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAIEPGQLLVRVFVEA
Ga0070763_1053496213300005610SoilMERAQLDRIERVINHELRERFLAGAMQRAVVLQHGDDPAIEPGQLMVRVFIPPPDEP
Ga0070763_1053513923300005610SoilVERAEKDQLERVINHAVKDRFAAGSVQRAVLLDHGDDPAIEPGQLMVRVFV
Ga0066903_10170975613300005764Tropical Forest SoilMERAEQAMVERVINHEMQERFGAGVVQRAVLLQHGDDPAIEPGQLMVRAFVEASDEPGL
Ga0066903_10293445823300005764Tropical Forest SoilMDQAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEP
Ga0070717_1124515223300006028Corn, Switchgrass And Miscanthus RhizosphereVERAEKNQIERVINHELNGRFLPGAGARAVLLEHGDDPGIGPGELMVRVFVAAPDESAPDEQALAGW
Ga0075023_10036337823300006041WatershedsVERAELDQIERVINHELRERFLVGAVERAVLLQHGDDPVIEPGQ
Ga0075028_10035242123300006050WatershedsMERAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDHPAIEPGELMVRVFVEA
Ga0075018_1055025513300006172WatershedsMERAELDQIERVINHELRERFLTGAVQRAVLLQHGD
Ga0070716_10110120413300006173Corn, Switchgrass And Miscanthus RhizosphereVEQSGKEQAERAINHFLNDMFTAGAVQRAVLLKHGDDPAIG
Ga0070765_10108415513300006176SoilVERADKDQIERVINHTMKERFGLETVERAVLLEHGDDPAIEAGQLMVRVFVPAPDEPADY
Ga0079222_1245150723300006755Agricultural SoilMERAGQAMVERVINHEVQERFGARAVQRAVLLQHGDDPAIEPGQLLVRVFVEA
Ga0073928_1081514033300006893Iron-Sulfur Acid SpringVERADKDQIERVINHTMKERFGLETAERAVLLEHGDDPAIEAGQLMVRVFVPAPDEPADYEQAL
Ga0066709_10308679223300009137Grasslands SoilMDRAEQAVVEEAINREMQERFTAGAVRRAVLLQHGDDP
Ga0105237_1256304413300009545Corn RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAIEPGQLL
Ga0116215_149671823300009672Peatlands SoilMEAAMERAELDQIERVINHELRERFLTGAVERAVLLQHGDDPAIEPG
Ga0116224_1058925023300009683Peatlands SoilMEAAMERAELDQIERVINHELRERFLTGAVERAVLLQHGDD
Ga0116216_1096736723300009698Peatlands SoilMGGTVERADKDRLERVINRTVKERFSAGAVERAVVLEHGDDPAIEPGQLMVRVFVPEP
Ga0126380_1113171323300010043Tropical Forest SoilMDQAEQAMVERVINHEMQERFGAGVVQRAVLLQHGDDP
Ga0134084_1036129013300010322Grasslands SoilEQAMVERVINHEIQERFSAGAVQRAVLLQHDDDPAIEPGELLVRVFVEASDEPALTAWQSAH*
Ga0074044_1115661213300010343Bog Forest SoilMGGTVERADKDRLERVINRTVRERFSAGAVERAVVLEHGDDPAIEPGQLMVRVFVPEPEEPA
Ga0126370_1073983323300010358Tropical Forest SoilMGGTVERAEKDQIERVITHTLKERFSVGAVQEAVLLEHGDDPAIGPGQLMVR
Ga0126377_1016462153300010362Tropical Forest SoilMERAEQAMVERVINHEMQERFGAGVVQRAVLLQHGDDPAIEPGQLMVRAFVEASDEPGLAAWQSA
Ga0136449_10142945633300010379Peatlands SoilMGGTVERAEKDQIERAINHEMKERFGAGAVQGAVLLEHGDDPAIGPGQLMVRVFVPA
Ga0151489_118631823300011106SoilMERAGQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGELMVRVFVEASDEPGLIAWQGAHQEG
Ga0157347_102789013300012502Arabidopsis RhizosphereMERAGQAMVERVINHEMQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRVF
Ga0126369_1301534923300012971Tropical Forest SoilMEQAGQAMVERVINHEMQERFGAGVVQRAVLLQHGDDPAIEPGQLMVRAFVEASDEPGLAAWQSA
Ga0157370_1060085813300013104Corn RhizosphereMERAEQAIVERAINHEIQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRV
Ga0157370_1162019213300013104Corn RhizosphereMAERVINHEMRERFTASAVKRAVLLKQGDDPAIGPGQLMVRVFVEAADDE
Ga0157374_1040560323300013296Miscanthus RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAGLLPHGADPASAPGPPLGRVFVGAS
Ga0137418_1094986613300015241Vadose Zone SoilMERAELDQIERVINHELRERFLTGAVQRAVLLQHGDDPAIEPGQLLVRVFVP
Ga0132256_10066508623300015372Arabidopsis RhizosphereMERAEQAMVERVINHEMQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAW
Ga0182035_1160135313300016341SoilVERAEKDQVERVINHNMKERFAAGTVQRAVLLEHGDDPAIEPGQL
Ga0182032_1033326513300016357SoilMEQAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAVEPGQLLVRVFVEASDEPGLTAWQSAHQ
Ga0187802_1046505013300017822Freshwater SedimentVERAEKEQIERVINHYLSQWFAPGPVQRAVLLEHGDDTAIEPGQLMVRVFVPAPDEPADYERTLA
Ga0187807_129279723300017926Freshwater SedimentVERAEKDQIERVINHGLKERFAAGAVQRVVLLEHGEDPAI
Ga0187814_1016392523300017932Freshwater SedimentVERAEIDQVERVLNHELKERFAGGAVQRGVLLQHGDDAAIGPGQLMVRVF
Ga0187801_1040882023300017933Freshwater SedimentVERAEQDQLERVINHELNERFAAGAVQRAVLLQHGDDPAIEPG
Ga0187821_1030943113300017936Freshwater SedimentVERAEKDQIERAIDHELKERFAAGAVQRAVLLEHGDDPAIGPGQ
Ga0187808_1002777113300017942Freshwater SedimentVERAEKDQIERAISHELKERFAAGAVPRAVLLEHGDDPAIGPGQLMVRVFVPAPDEP
Ga0187783_1012713133300017970Tropical PeatlandVDQADKERVERAINRELREGFAAGVVQRAVLLEHGDDPAIPPGELLVRVFIP
Ga0187805_1021518823300018007Freshwater SedimentVERAEKDQIERAINHELTERFAAGAVQRAVLLERGDHPAIGPGQLMVRVFVPAPDEPSD
Ga0187887_1076889213300018043PeatlandVERAEQDMIERVINHEVQERFAAGAVRRAVLLQPGDDPE
Ga0187765_1058845013300018060Tropical PeatlandMERAEQAMVERAINHEMQERFGAGAVQRAVLLQHGDDPAVEPGQLLVRVFVEASDEPGLTAWQ
Ga0187784_1170122723300018062Tropical PeatlandMERAEQAMVERVINHEMQERFAAGAVQRAVLLQPGDDPAIEPGQLLVRVFIPAADGPPEQALAAWQDANQ
Ga0187773_1070773413300018064Tropical PeatlandMERAEQAMIERVINHEMQERFAAGAVERAVLLQHGDDPAIEPGQLMV
Ga0210405_1015432223300021171SoilMERAQLDRIERVINHELRERFLAGAMQRAVVLQHGDDPAIEPGQLMVRVFIPPPD
Ga0210405_1087010423300021171SoilVERAEKAQIERVINHNLKERFAAGAVQRAVLLEHGEDPAI
Ga0210408_1066419213300021178SoilVERADKDRLERVINRTVKERFGAGAVERAVVLEHGDDPAIEPGQLMVRVFVPAPEEPGDYEQAL
Ga0210408_1141981223300021178SoilVERADKDRIERAINHTVKERFSEGEVERAVLLEHGDDPAVEPGQLMVRVFVAAP
Ga0210397_1080093413300021403SoilVERAELDQIERVINHELRERFLVGAVERAVLLQHGDD
Ga0210387_1009948213300021405SoilMERAQLDRIERVINHELRERFLAGAMQRAVVLQHGDDPAIEPG
Ga0210387_1117989523300021405SoilVERADKDRLERVINHTVKERFGEGAVERAVLLEHGDDPAIEPGQLMVRVFVPAPEKPADYEQ
Ga0210383_1121299113300021407SoilMTRMGGTVERAEIDQIERVLNHELKERFAGGAVQRGVLLRHGDDPAIGPGQLMVRVFIPA
Ga0210384_1044396413300021432SoilVERADKDRLERVINHTVKERFGEGAVERAVLLEHGDDPAIEPGQLMVRVFVPAPEKPA
Ga0210391_1027499813300021433SoilVERAQLDRIERVINHELRERFLAGAMQRAVVLQHGDDPAIEPGQL
Ga0210402_1061557723300021478SoilVERAEKAQIERVINHNLKERFAAGAVQRAVLLEHGEDPAIEPGQLMVRVFVPA
Ga0210410_1138680323300021479SoilVDRADKDRLERVINHTVKERFGAGAVERAVVLEHSDDPAIEPGQLMVR
Ga0210409_1104563423300021559SoilVERADKDRLERVINRTVKERFGAGAVERAVVLEHGDDPAIEPGQLMVRVFVPAPEEPGDY
Ga0213880_1024745923300021953Exposed RockVERAEQDQIERAINHELKGRFAEGAVQRAVLLQHGDDPAIEPGQLMVRVFIPA
Ga0247664_102541223300024232SoilMERAEQAMVERVINHEMQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQSAHQEGI
Ga0247670_101620123300024283SoilMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAI
Ga0224556_109536413300024295SoilMERAEIEQIQRVLNHEMQERFGDGAVQRAVLLRPGDDPAIEPGQLMVRVFLP
Ga0247666_103130913300024323SoilMERAEQAMVERVINHEMQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLT
Ga0247678_101408613300024325SoilMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAIEPGQLLVRVFV
Ga0209171_1049286423300025320Iron-Sulfur Acid SpringVERADKDQIERVINHTMKERFGLETAERAVLLEHGDDPAIEAGQLMVRVFVPAPDHCPPPLPSASD
Ga0208589_114234213300025634Arctic Peat SoilVDRADKDQIERVINHTVRERFSEGAVERAVLLEHGDDPVIEPG
Ga0207653_1001738013300025885Corn, Switchgrass And Miscanthus RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQ
Ga0207707_1056339223300025912Corn RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQSAHQG
Ga0207663_1052863723300025916Corn, Switchgrass And Miscanthus RhizosphereMDRAEQDRLERVINHEVRERFLAGAVRRAVVLRHGDDPGVG
Ga0207687_1158224613300025927Miscanthus RhizosphereMERAEQAMVERVINHEMQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEA
Ga0207700_1025489213300025928Corn, Switchgrass And Miscanthus RhizosphereMDRAEQDRLERVINHEVRERFLAGAVRRAVVLQHGDDPGVGAGQLM
Ga0207664_1105868313300025929Agricultural SoilMDRAEQDRLERVINHEVRERFLAGAVRRAVVLQHGDDPGVGAGQL
Ga0207709_1053307313300025935Miscanthus RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQSAHQGGIDAIRREL
Ga0207665_1047669333300025939Corn, Switchgrass And Miscanthus RhizosphereVEQSGKEQAERAINHFLNDMFTAGAVQRAVLLKHGDDPAIGPLAR
Ga0207691_1079710823300025940Miscanthus RhizosphereMERAEQAMVERVINHEMQERFSAGAVQRAVLLQHGD
Ga0207711_1020524013300025941Switchgrass RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHG
Ga0207679_1080425123300025945Corn RhizosphereMERAEQAIVERAINHEIQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRVF
Ga0207640_1031144913300025981Corn RhizosphereMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGD
Ga0207702_1156912813300026078Corn RhizosphereMDRAEQDRLERIINHEVRERFLAGAVRRVVVLQHGDDPGVGAG
Ga0257146_102113913300026374SoilMERAELDQIERVINHELRERFLTGAVQRAVLLQHGDDPAIEPGQLLVRVFVPPPDRP
Ga0257159_106796313300026494SoilMERAELDQIERVINHELRERFLTGAVQRAVLLQHGDDPAIEPGQLLVRVFVEATDEPGLTAW
Ga0209648_1022096843300026551Grasslands SoilVERAEKDQVERVINHNLKERFAAGAVDRAVLLEHGDDPAI
Ga0209620_100063433300026911Forest SoilMERAEQAMVERVINHEMQERFSAGAVQRAVLLQHDDDPAIEPGQLLVRVFVE
Ga0207948_104146023300027174Forest SoilMERDELDQIERVINHELRERFLTGAVERAVLLQHGDDPAIEPGQ
Ga0208241_100596213300027297Forest SoilVDRADKDRLERVINHTVKERFGAGAVERAVVLEHSDDPAIEPGQLMVRVFVPAPEEPA
Ga0208199_100632313300027497Peatlands SoilMEQAELDQIERVINHELRERFLTGAVERAVLLQHGDDPAIEPGQ
Ga0209074_1007897323300027787Agricultural SoilMDRAEQDRLERVINHEVRERFLAGAVRRAVVLQHGDDPGVGAGQLMVRVF
Ga0209624_1101936723300027895Forest SoilVERADKDQIERVINHTMKERFGLGTAERAVLLEHGDDPAIEAGQLMVRVFVPAPDEPADY
Ga0209168_1056489123300027986Surface SoilVERAEKAQIERVINHNLKERFAAGAVRQAVLLEYGEDPAI
Ga0247682_110605913300028146SoilMERAEQAMVERVINHEMQERFSAGAVRRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQSAHQE
Ga0302232_1001108243300028789PalsaVERAEKDQLERAINHELRERFTAGAVQRAVLLEHGEDPGIGPGELMVRVF
Ga0302228_1045135723300028808PalsaVERAEKDQLERAINHELRERFTAGAVQRAVLLEHGEDPGIGPGQLMV
Ga0308309_1049095933300028906SoilMGGAVERADKDQIERVINHTMKERFGLGTAERAVLLEHGDDPAI
Ga0302181_1012276513300030056PalsaVERAEKDQLERAINHELRERFTAGAVQRAVLLEHGEDPGIGPGELMVRVFVPAPDEPAGYEQAL
Ga0311353_1066940923300030399PalsaMDQAELEQIQRVINHEMRERFALGSAQRAVLLQHGDDPAIEPGQLTVRVFLPP
Ga0310037_1010607213300030494Peatlands SoilVERAEKAQIERVINHNLKERFAAGAVQRAVLLEYGEDPAIEPGQLMVRVFVPAPEE
Ga0311370_1094701823300030503PalsaMDQAELEQIQRVINHEMRERFALGSAQRAVLLQHGDDPAIEPGQLKVRVFLPP
Ga0302311_1051360113300030739PalsaMDQAELEQIQRVINHEMRERFALGSAQRAVLLQHGDDPAIEPGQLTVRVFLPPPEEGEDY
Ga0307499_1007098113300031184SoilMERAEQAMVERVINHEMQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDE
Ga0307495_1017608813300031199SoilMDRAGQAMVERVINHEIQERLGAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQ
Ga0318516_1071807913300031543SoilVERAEKDQIERVITHNLRERFSAGAVRGAVLLEHGDDPAIGPGQLMVRVFVPAPDEPADY
Ga0318571_1016356023300031549SoilMEQAEQAMVERVINHEMQERFGAGAVQRAVLLQPGDDPAVEPGRLLVRVFVEASDEPGLTAWQSAHQAG
Ga0318555_1019800013300031640SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEYGDDPAIEPGQLMVRVFVPAP
Ga0318572_1016597313300031681SoilMEQAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAVEPGQLLVRVFVEASDEPGLTAWQSAHQAGIDAIRRELSLRL
Ga0310686_11279503813300031708SoilVERADKDQIERAINHTVKERFSEGAVERAVLLEHGDDPAIE
Ga0306917_1079060723300031719SoilMERAEQAMVERVINHEMQERFGAGVVQRAVLLQHGDDPAIE
Ga0318501_1013559223300031736SoilMERAEQAMMERVINHEIQERFGAGVVQRAVLLQHGEDPAIEPGELMV
Ga0318492_1005704113300031748SoilVERAEHDQVERAINHELNGRFAEGAVQRAVLLQHGEDPAIEPGQLMVRVFIPAPGGPEDY
Ga0318492_1041578813300031748SoilMERAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGELMVRVFVEASDEPGLTAWQSAHQGG
Ga0318492_1071653313300031748SoilVERAEKDQVERVINHNMKERFAAGTVQRAVLLEHGDDPAIEPGQLMVRVFIQAPD
Ga0318494_1043041823300031751SoilVERAEKDQVERVINHNMKERFAAGTVQRAVLLEHGDDPAIEPGQLMVRVFIQAPDDPADY
Ga0318554_1082716713300031765SoilMERAEQAMVEEVINHEIKERFTLGAVQRAVLLQRGDDPA
Ga0318526_1011070823300031769SoilMERAEQAMMERVINHEIQERFGAGVVQRAVLLQHGEDPAIEPGELMVRVFV
Ga0318521_1074062023300031770SoilMERAEQAMVERVINHEIQERFGAGAVQRAVLLQHGDDPVIEPGQLLVRVFVEASDEPG
Ga0318498_1035572313300031778SoilVERAEKVQIERVINHTLKERFSEGAVQRAVLLEHGDD
Ga0318552_1024689713300031782SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEHGDDPAIEPGQLMVRVFVPAPDEPA
Ga0318552_1055504523300031782SoilMDQAERAMVERAINHEIEERFTAGAVQRAVLMQHGDDPAIEPGHLM
Ga0318557_1015781313300031795SoilVERAEQDQLERVINHEVKERFAAGAVQRAVLLQHGDDPAIGPGQLMVRV
Ga0318557_1036928223300031795SoilVERAEKVQIERVINHTLKERFSEGAVQRAVLLEHGDDPAIGPG
Ga0318576_1060740213300031796SoilVERADKDQIERVINHSMKERFSLGTAERAVLLEYGDDPAIGPGQLMVRVFVPAPDEPTDYEQAASA
Ga0318523_1023531713300031798SoilVERAEKVQIERVINHTLKERFSEGAVQRAVLLEHGDDPAIGPGQLMVRVFVPAPDEPADY
Ga0318523_1026352623300031798SoilMERAEQAMVERAINHEMQERFTAGAVQRAVLMQHGDDPAIEP
Ga0318523_1038490013300031798SoilMEQAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAVEPGQLLVRVFVEASDEPGLTAWQSAHQAGI
Ga0318568_1086378313300031819SoilMERAEQAMIERVINHEMNERFTAGTGARAVLLQHGDDPAIEPGQLMVRVFIPASDRPPEQALDEWRSAHE
Ga0307478_1091874423300031823Hardwood Forest SoilVDRADKDRLERVINHTVKERFGAGAVERAVVLEHSDDPAIEPGQLMVRVFVPAPEEP
Ga0318564_1003340613300031831SoilMERAEQAMLERVINHEMQERFGAGAVQRAVLLQHGDDPAIE
Ga0318564_1042603223300031831SoilMERAEQAMIERVINHEMNERFTAGTGARAVLLQHGDDPAIEPGQLMVRVFIPASDGPPEQALDEWRSAHEAGIDDF
Ga0318499_1033340613300031832SoilVERAEKDQVERVINHNMKERFAAGTVQRAVLLEHG
Ga0310917_1036952823300031833SoilMERAEQAMVERVINHEMQERFGAGVVQRAVLLQHGDDPAIEPGQLMVRVFVEASDEPGLTAWQSAHQGGIDNIRREL
Ga0310917_1118108823300031833SoilMERAEQAMIERVINHEMNERFTAGTGARAVLLQHGDDPAIEPGQLMVRVFIPA
Ga0318517_1009086723300031835SoilMEQAEQAMVERVINHEMQERFGAGVVQRAVLLQHGDDPAIEPGQLMVRV
Ga0318517_1027240823300031835SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEYGDDPAIEPGQLMVRVFV
Ga0318517_1048194913300031835SoilVERADKDQIERVINHSMKERFSLGTAERAVLLEYGDDPAIGPGQLMVRVFV
Ga0318512_1072576713300031846SoilVERAEKVQIERVINHTLKERFSEGAVQRAVLLEHGDDPAIGPGQLMVRVFVPAPDEPA
Ga0318544_1020464513300031880SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEYGDDPAIEPGQLMVRVFVPAPDEPADYEQA
Ga0306923_1197898123300031910SoilVTRMGGTVERAEKAQVERVINHNLKERFAAGAVQRAVLLEHGDDPAIEPGQLMVRVFVPVPEEPA
Ga0306921_1094245313300031912SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEYGDDPAIEPGQLMVRVFVPAPDEPADYEQALASWQ
Ga0308175_10323265023300031938SoilVERAGQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQLLVR
Ga0310916_1147765723300031942SoilMEQAEQANLERVINHEMQERFGAGAVQRAVLLQPGDDPAVEPGRLLVRVFVEASDEPGLTAWQSAHQAGIDAIRRELSL
Ga0310913_1060527023300031945SoilVERAERVQIERVINHSMKERFSLATAERAVLLEHGDDPAIEPGQLMVRVFVPAPD
Ga0310913_1109553523300031945SoilMERAEQAMVERVINHEMQERFGAGVVQRAVLLQHGDDPAIEPGQLMVRVFVEASDEPGLTAWQSAHQGGIDNIRRELSL
Ga0318531_1034715723300031981SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEHGDDPAIEPGQLMVRVFVPAPDEPAHYEQ
Ga0308176_1095226823300031996SoilMERPEQAMVERVINHEMQERFDAGAVQRAVLLQHDDDPAIEPGELLVRV
Ga0318563_1022845513300032009SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEYGDDPAIEPGQLMVRVFVPAPDEPADY
Ga0318563_1054949423300032009SoilVTRMGGTVERAEKAQVERVINHNLKERFAAGAVQRAVLLEHGDDPAIEPGQL
Ga0318507_1006086113300032025SoilMERAEQAMMERVINHEIQERFGAGVVQRAVLLQHGEDPAIEPGELMVRVFVEASDEPGLTAWQSA
Ga0318507_1024760023300032025SoilMEQAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAVEPGQLLVRVFVEASDEPGL
Ga0318559_1060942423300032039SoilMGGTVERAEKVQIERVINHTLKERFSEGAVQRAVLLEHGDDPAIGPG
Ga0318549_1014382323300032041SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEHGDD
Ga0318556_1016012423300032043SoilVERAEKVQIERVINHSMKERFSLETAERAVLLEHGDDPAIEPGQLMVRVFVPAPDEPAHY
Ga0318558_1008631823300032044SoilMERAEQAMMERVINHEIQERFGAGVVQRAVLLQHGED
Ga0318570_1047639423300032054SoilVERADKDQIERVINHSMKERFSLGTAERAVLLEHGDDPAIGPGQLMVRVFVPAPDEPADY
Ga0318505_1058408113300032060SoilMEQAEQAMVERVINHEMQERFGAGAVQRAVLLQPGDDPAVEPGRLLVRVFVEASDEPGLTAWQSAHQA
Ga0318504_1016349723300032063SoilMERAEQAMMERVINHEIQERFGAGVVQRAVLLQHGEDPAIEPGELMVRV
Ga0318510_1037044413300032064SoilVERAEKDQVERVVNHELKERFGQGTIERAVLLQHGDDPAIEPGQLMVRVFVPAPGG
Ga0318510_1050003523300032064SoilMERAEQAMIERVINHEMNERFTAGTGARAVLLQHGDDPAIEPGQLMVRVFI
Ga0318514_1056429613300032066SoilMERAEQAMVEEVINHEIKERFTLGAVQRAVLLQRGDDPAIEPGQLMVRVFIPSSDEPPEQALAAW
Ga0318524_1035512613300032067SoilMERAEQAMVERVINHEMQERFGAGVVQRAVLLQHGEDPAIEPGELMVRVFVEASDEP
Ga0318553_1019980613300032068SoilVERAEKVQVERVISHSMKERFSLETAERAVLLEHGDDPAIEPGQLMVRVFVPAPDEPADY
Ga0306924_1166007223300032076SoilMERAEQAMLERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQSAHQGGIDAIRRE
Ga0318525_1026508613300032089SoilVERAEKDQIERVITHNLRERFSAGAVRGAVLLEHGDDPAIGPGQLMVRVFVPAP
Ga0311301_1019224623300032160Peatlands SoilMERAELDQIERVINHELRERFLTGAVERAVLLQHGDDPAIEPGQ
Ga0307472_10266551413300032205Hardwood Forest SoilMERAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQLVVRVFVEAS
Ga0306920_10246781723300032261SoilMERAEQAMVERAINHEMQERFTAGAVQRAVLLQHGDDPAIEPGRLTVRVFVPAADGPPE
Ga0306920_10417808023300032261SoilMERAEQAMMERVINHEIQERFGAGVVQRAVLLQHGEDPAIEPGELMVRVFVEASDEPGLTAWQSAHQGGIDN
Ga0335085_1217365223300032770SoilMERAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQSAHQGGIDAIR
Ga0335078_1149006823300032805SoilMDQAEQAMVERVINHEMQERFGAGVVQRAVLLQHGDDPAIEPGQLMVRVF
Ga0335081_1166446013300032892SoilMERAEQAMVEEVINREMQERFPGGAVQRAVLLQHGDDPAIEPGQLMVRAFI
Ga0335083_1012520413300032954SoilMERAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEA
Ga0335084_1163556423300033004SoilMDQAEQAMVERVINHEIQERFGAGVVRRAVLLQHGDDPAIEPGQLMVRVFVEASDEPGLTAWQGAHQGGIDNFRRELS
Ga0310914_1013406113300033289SoilMERAEQAMVERVINHEMQERFGAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAW
Ga0318519_1045971523300033290SoilMERAEQAMVEEVINHEIKERFTLGAVQRAVLLQRGDDPAIEPGQLMVRVFIPSSDEPPEQALAAWQNAHQA
Ga0318519_1107481723300033290SoilMGGTVERAEKVQVERVISHSMKERFSLETAERAVLLEHGDDPAIEPGQLMVRVFVPAPDE
Ga0373958_0032750_828_10283300034819Rhizosphere SoilMERAEQAMVERVINHEMQERFSAGAVQRAVLLQHGDDPAIEPGQLLVRVFVEASDEPGLTAWQSAHQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.