Basic Information | |
---|---|
Family ID | F032419 |
Family Type | Metagenome |
Number of Sequences | 180 |
Average Sequence Length | 45 residues |
Representative Sequence | MSHPDPNGPPDRTPRKVGEVWENPVTGERATILERPWDNPAGRA |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 180 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 76.11 % |
% of genes near scaffold ends (potentially truncated) | 93.33 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 145 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.222 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 8.33% Coil/Unstructured: 87.50% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 180 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 3.33 |
PF07228 | SpoIIE | 2.78 |
PF13683 | rve_3 | 1.67 |
PF12704 | MacB_PCD | 1.67 |
PF03401 | TctC | 1.11 |
PF00440 | TetR_N | 1.11 |
PF07992 | Pyr_redox_2 | 1.11 |
PF00753 | Lactamase_B | 1.11 |
PF01909 | NTP_transf_2 | 1.11 |
PF00885 | DMRL_synthase | 1.11 |
PF04909 | Amidohydro_2 | 1.11 |
PF02518 | HATPase_c | 1.11 |
PF00069 | Pkinase | 1.11 |
PF01425 | Amidase | 1.11 |
PF00072 | Response_reg | 0.56 |
PF07729 | FCD | 0.56 |
PF00891 | Methyltransf_2 | 0.56 |
PF02627 | CMD | 0.56 |
PF13432 | TPR_16 | 0.56 |
PF13637 | Ank_4 | 0.56 |
PF03551 | PadR | 0.56 |
PF01979 | Amidohydro_1 | 0.56 |
PF00583 | Acetyltransf_1 | 0.56 |
PF08281 | Sigma70_r4_2 | 0.56 |
PF00122 | E1-E2_ATPase | 0.56 |
PF12680 | SnoaL_2 | 0.56 |
PF00903 | Glyoxalase | 0.56 |
PF16576 | HlyD_D23 | 0.56 |
PF03729 | DUF308 | 0.56 |
PF13207 | AAA_17 | 0.56 |
PF13620 | CarboxypepD_reg | 0.56 |
PF13826 | DUF4188 | 0.56 |
PF01494 | FAD_binding_3 | 0.56 |
PF02371 | Transposase_20 | 0.56 |
PF08450 | SGL | 0.56 |
PF01048 | PNP_UDP_1 | 0.56 |
PF12706 | Lactamase_B_2 | 0.56 |
PF14137 | DUF4304 | 0.56 |
PF08031 | BBE | 0.56 |
PF07592 | DDE_Tnp_ISAZ013 | 0.56 |
PF00462 | Glutaredoxin | 0.56 |
PF04828 | GFA | 0.56 |
PF00482 | T2SSF | 0.56 |
PF08592 | Anthrone_oxy | 0.56 |
PF02897 | Peptidase_S9_N | 0.56 |
PF13424 | TPR_12 | 0.56 |
PF01618 | MotA_ExbB | 0.56 |
PF01252 | Peptidase_A8 | 0.56 |
PF06253 | MTTB | 0.56 |
PF02574 | S-methyl_trans | 0.56 |
PF13675 | PilJ | 0.56 |
PF12142 | PPO1_DWL | 0.56 |
PF12697 | Abhydrolase_6 | 0.56 |
PF13340 | DUF4096 | 0.56 |
PF01568 | Molydop_binding | 0.56 |
PF09351 | DUF1993 | 0.56 |
PF00202 | Aminotran_3 | 0.56 |
PF13858 | DUF4199 | 0.56 |
PF01266 | DAO | 0.56 |
PF00291 | PALP | 0.56 |
PF01068 | DNA_ligase_A_M | 0.56 |
PF13473 | Cupredoxin_1 | 0.56 |
PF12867 | DinB_2 | 0.56 |
PF07040 | DUF1326 | 0.56 |
PF07366 | SnoaL | 0.56 |
PF00924 | MS_channel | 0.56 |
PF13817 | DDE_Tnp_IS66_C | 0.56 |
PF10028 | DUF2270 | 0.56 |
COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.44 |
COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 1.11 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.11 |
COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.11 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.11 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.11 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.56 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.56 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.56 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.56 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.56 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.56 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.56 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.56 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.56 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.56 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.56 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.56 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.56 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.56 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.56 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.56 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.56 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.56 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.56 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.56 |
COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.56 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.56 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.56 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.56 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.56 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.56 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.56 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.56 |
COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.22 % |
Unclassified | root | N/A | 7.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725004|GPKC_F5V46DG02DMU7Q | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
2070309004|prs_FIHLEPW02T4L27 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
2228664022|INPgaii200_c0809384 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2019619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100488325 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300000955|JGI1027J12803_100433002 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300000955|JGI1027J12803_106848646 | Not Available | 1127 | Open in IMG/M |
3300000956|JGI10216J12902_100439791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2217 | Open in IMG/M |
3300001593|JGI12635J15846_10014166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6646 | Open in IMG/M |
3300001593|JGI12635J15846_10301177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
3300002914|JGI25617J43924_10366927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300004092|Ga0062389_101210465 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300004157|Ga0062590_100892061 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300005172|Ga0066683_10226558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1157 | Open in IMG/M |
3300005176|Ga0066679_10248099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1146 | Open in IMG/M |
3300005177|Ga0066690_10119733 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
3300005181|Ga0066678_10249962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
3300005181|Ga0066678_10440769 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300005293|Ga0065715_10171627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1542 | Open in IMG/M |
3300005294|Ga0065705_10552236 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300005331|Ga0070670_100272189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1478 | Open in IMG/M |
3300005341|Ga0070691_10615793 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005367|Ga0070667_101046105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300005436|Ga0070713_101906064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300005437|Ga0070710_10301987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
3300005447|Ga0066689_10500210 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300005471|Ga0070698_100428221 | Not Available | 1258 | Open in IMG/M |
3300005536|Ga0070697_101305666 | Not Available | 647 | Open in IMG/M |
3300005560|Ga0066670_10083589 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
3300005564|Ga0070664_101820907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 577 | Open in IMG/M |
3300005578|Ga0068854_100571103 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300005764|Ga0066903_104765098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
3300005764|Ga0066903_108441844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300005764|Ga0066903_109085578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300006031|Ga0066651_10176052 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300006032|Ga0066696_10159566 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300006032|Ga0066696_10434222 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300006046|Ga0066652_101995508 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300006049|Ga0075417_10552327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300006172|Ga0075018_10659880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300006175|Ga0070712_100500934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1018 | Open in IMG/M |
3300006237|Ga0097621_101726429 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300006354|Ga0075021_10031151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3029 | Open in IMG/M |
3300006791|Ga0066653_10552827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300006796|Ga0066665_10267637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
3300006796|Ga0066665_10491930 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300006797|Ga0066659_10322193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1188 | Open in IMG/M |
3300006845|Ga0075421_102333096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
3300006846|Ga0075430_100184444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1735 | Open in IMG/M |
3300006871|Ga0075434_101335684 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300006904|Ga0075424_101736713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
3300006918|Ga0079216_11341665 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300007258|Ga0099793_10022078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2626 | Open in IMG/M |
3300009098|Ga0105245_10758965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
3300009148|Ga0105243_12020890 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300009156|Ga0111538_11764055 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300009162|Ga0075423_11163663 | Not Available | 822 | Open in IMG/M |
3300009520|Ga0116214_1368757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300009553|Ga0105249_10677237 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300009799|Ga0105075_1017911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 718 | Open in IMG/M |
3300010036|Ga0126305_10863852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium shewense | 617 | Open in IMG/M |
3300010037|Ga0126304_10864245 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300010045|Ga0126311_10473954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
3300010358|Ga0126370_12544453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300010360|Ga0126372_10388342 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300010360|Ga0126372_12235682 | Not Available | 596 | Open in IMG/M |
3300010361|Ga0126378_11163996 | Not Available | 870 | Open in IMG/M |
3300010361|Ga0126378_12031248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
3300010361|Ga0126378_12156782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 636 | Open in IMG/M |
3300010366|Ga0126379_10014356 | All Organisms → cellular organisms → Bacteria | 5714 | Open in IMG/M |
3300010366|Ga0126379_13817263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300010371|Ga0134125_11814829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300010379|Ga0136449_102503908 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300010398|Ga0126383_11869878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
3300011119|Ga0105246_10906450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
3300011439|Ga0137432_1214534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300012200|Ga0137382_10010488 | All Organisms → cellular organisms → Bacteria | 4913 | Open in IMG/M |
3300012200|Ga0137382_10169212 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300012202|Ga0137363_11105565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300012203|Ga0137399_10038110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3388 | Open in IMG/M |
3300012203|Ga0137399_10164406 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
3300012203|Ga0137399_10249697 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300012203|Ga0137399_10265901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1410 | Open in IMG/M |
3300012206|Ga0137380_10106750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2559 | Open in IMG/M |
3300012206|Ga0137380_11351339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300012208|Ga0137376_10216571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1658 | Open in IMG/M |
3300012208|Ga0137376_10460325 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300012208|Ga0137376_10542366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1008 | Open in IMG/M |
3300012210|Ga0137378_10893973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
3300012211|Ga0137377_10411933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1289 | Open in IMG/M |
3300012212|Ga0150985_113213806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300012285|Ga0137370_10484914 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300012350|Ga0137372_10484333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
3300012355|Ga0137369_10442625 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300012357|Ga0137384_11497013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300012481|Ga0157320_1015662 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300012901|Ga0157288_10290575 | Not Available | 567 | Open in IMG/M |
3300012918|Ga0137396_10029440 | All Organisms → cellular organisms → Bacteria | 3619 | Open in IMG/M |
3300012918|Ga0137396_10165446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1616 | Open in IMG/M |
3300012925|Ga0137419_10131491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1783 | Open in IMG/M |
3300012927|Ga0137416_10602137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300012929|Ga0137404_11514794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300012975|Ga0134110_10434461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300013102|Ga0157371_10979707 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300013296|Ga0157374_10074713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3201 | Open in IMG/M |
3300013306|Ga0163162_10648289 | Not Available | 1180 | Open in IMG/M |
3300013308|Ga0157375_10119864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2739 | Open in IMG/M |
3300013308|Ga0157375_13376400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300014157|Ga0134078_10613543 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300014200|Ga0181526_10406308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Vulgatibacteraceae → Vulgatibacter → Vulgatibacter incomptus | 864 | Open in IMG/M |
3300014867|Ga0180076_1082937 | Not Available | 590 | Open in IMG/M |
3300014968|Ga0157379_10063357 | All Organisms → cellular organisms → Bacteria | 3306 | Open in IMG/M |
3300015052|Ga0137411_1370079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1791 | Open in IMG/M |
3300016294|Ga0182041_11855693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300016445|Ga0182038_11854735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300017947|Ga0187785_10359009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
3300017961|Ga0187778_10208827 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300017973|Ga0187780_10917332 | Not Available | 636 | Open in IMG/M |
3300018469|Ga0190270_12510402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300019362|Ga0173479_10385393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300019377|Ga0190264_10285036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
3300021180|Ga0210396_10151029 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
3300021180|Ga0210396_10741025 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300021432|Ga0210384_10056260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3562 | Open in IMG/M |
3300021559|Ga0210409_10009550 | All Organisms → cellular organisms → Bacteria | 9814 | Open in IMG/M |
3300021559|Ga0210409_10145383 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
3300021560|Ga0126371_13842193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300024179|Ga0247695_1061586 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300024288|Ga0179589_10295971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300025679|Ga0207933_1090789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
3300025893|Ga0207682_10265506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 801 | Open in IMG/M |
3300025913|Ga0207695_11543864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300025928|Ga0207700_10847026 | Not Available | 818 | Open in IMG/M |
3300025936|Ga0207670_11040601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
3300025938|Ga0207704_10931377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 732 | Open in IMG/M |
3300025986|Ga0207658_11055609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 742 | Open in IMG/M |
3300025986|Ga0207658_11602027 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300026067|Ga0207678_10247771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1526 | Open in IMG/M |
3300026326|Ga0209801_1051357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1874 | Open in IMG/M |
3300026328|Ga0209802_1129514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
3300026538|Ga0209056_10515892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300026548|Ga0209161_10511587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300027071|Ga0209214_1006878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
3300027548|Ga0209523_1086027 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300027587|Ga0209220_1151316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300027748|Ga0209689_1130058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1252 | Open in IMG/M |
3300027843|Ga0209798_10356995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
3300027894|Ga0209068_10519977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 688 | Open in IMG/M |
3300028536|Ga0137415_11053397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300028558|Ga0265326_10044107 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300028587|Ga0247828_10922507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300028592|Ga0247822_11750432 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300028889|Ga0247827_10778852 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300029943|Ga0311340_10904593 | Not Available | 733 | Open in IMG/M |
3300030007|Ga0311338_11388405 | Not Available | 654 | Open in IMG/M |
3300030007|Ga0311338_11881176 | Not Available | 536 | Open in IMG/M |
3300030336|Ga0247826_11760933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300030490|Ga0302184_10252547 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300030580|Ga0311355_10629274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1008 | Open in IMG/M |
3300030739|Ga0302311_10499120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 837 | Open in IMG/M |
3300031231|Ga0170824_110541643 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
3300031576|Ga0247727_10723566 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300031640|Ga0318555_10713444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
3300031712|Ga0265342_10502993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
3300031719|Ga0306917_10776003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
3300031747|Ga0318502_10683052 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031753|Ga0307477_10049129 | All Organisms → cellular organisms → Bacteria | 2900 | Open in IMG/M |
3300031754|Ga0307475_10048635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3177 | Open in IMG/M |
3300031770|Ga0318521_11035891 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300031782|Ga0318552_10556961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300031890|Ga0306925_11802604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300031908|Ga0310900_11119311 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300031947|Ga0310909_10792194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300031954|Ga0306926_12963763 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300032001|Ga0306922_12357979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300032003|Ga0310897_10070014 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
3300032041|Ga0318549_10540410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300032160|Ga0311301_10480204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1854 | Open in IMG/M |
3300032180|Ga0307471_102805388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300032828|Ga0335080_10662452 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.89% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.22% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.22% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.67% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.11% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.11% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.11% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.56% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.56% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.56% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.56% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKC_04176630 | 2067725004 | Soil | MRHPEPDGLPDRRPIELGEVWENPVTGERGILERPWENDAGRATSEMTALVGARVVGE |
prs_06734960 | 2070309004 | Green-Waste Compost | MSHPDPHGAPDCTPIEVGEVWENPVTRECATILERPWDNPGKAVRPAELTALVGARV |
INPgaii200_08093841 | 2228664022 | Soil | MSHPEPHGPPDRTPIEVGEIWENPATRERATILERPWD |
ICChiseqgaiiDRAFT_20196191 | 3300000033 | Soil | MGRWSHPDPDGPPDRTSIEVGEIWQNPVTRERATILERPWDNPESRAAAELTAL |
INPhiseqgaiiFebDRAFT_1004883251 | 3300000364 | Soil | MSHPEPHGPPDRTPIEVGEIWENPATRERATILERPWDNPAG |
JGI1027J12803_1004330022 | 3300000955 | Soil | MSHPDPIGAPDRRPIKVGEVWENPVTEERSVILERPWDNPASS |
JGI1027J12803_1068486464 | 3300000955 | Soil | NGPPDCRPIKVGEVWENPVTGERSVILERPWDNPASS |
JGI10216J12902_1004397913 | 3300000956 | Soil | MSHPEPHGPPDRTPIQVGEVWENPVTRERATILERPWD |
JGI12635J15846_100141661 | 3300001593 | Forest Soil | SHPDPNGAPDRRPIKVGEVWENPVTGERSVILEGPWDNPASRVTGELTALVARV* |
JGI12635J15846_103011771 | 3300001593 | Forest Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILEGPWDNPASRVTGELTALVARV* |
JGI25617J43924_103669272 | 3300002914 | Grasslands Soil | MSHPDPNGPPDRGPIKVGEVWENPVTGERSVILERPWDNPASRVTG |
Ga0062389_1012104651 | 3300004092 | Bog Forest Soil | VSHPDPFGPPDRTPIEIGEVWENPVTRERATILELPYQNT |
Ga0062590_1008920612 | 3300004157 | Soil | MRHPDPHGPPDHTPIEVGEVWVNPVTRERATILERTWDNP |
Ga0066683_102265581 | 3300005172 | Soil | MSHPDPHGPPDLTPIQIGEVWENPVNRERLTILELPWQNPEGRAVDE |
Ga0066679_102480992 | 3300005176 | Soil | MSHPDPNGAPDRRLIKVGEVWENPVTGERSVILERPWDNPASRVTGELTALVG |
Ga0066690_101197331 | 3300005177 | Soil | MSHPDPNGPPDRRPIKVGEVWENPVTGERLVILERPWDNPA |
Ga0066678_102499622 | 3300005181 | Soil | MSHPDPSGPPNRRPIKVGEVWENPVTGERLVILERPWDNPASRAKSGTWM* |
Ga0066678_104407691 | 3300005181 | Soil | MSHSDPNGAPDRRPIRVGEVWENPVTGERSVILERPWDNPAS |
Ga0065715_101716271 | 3300005293 | Miscanthus Rhizosphere | MRHPDPHGPPDRTPIEVGEVWVNPVTRERATILERTWDNPAGRATAE |
Ga0065705_105522361 | 3300005294 | Switchgrass Rhizosphere | MSHPDPDGPPHRTPITVGEVWENPVTRERATILERPWDNPAGR |
Ga0070670_1002721892 | 3300005331 | Switchgrass Rhizosphere | MSHPDPHGPEDRTPIQVGEVWENPVTRERARILELPNKNREGR |
Ga0070691_106157932 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHPDPHEPPDRTPIQIGEVWENPITQERATILELPDQNPERRVVGELLALAGAHV |
Ga0070667_1010461051 | 3300005367 | Switchgrass Rhizosphere | MVVRVSHPDPNGLADVTPIEVGEVWENPVSGERATILELPQANRDGRCV |
Ga0070713_1019060641 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHPDPNGPPDLTPIEAGEVLENPITRERATVLELPWTNPEGRAVAEMTA |
Ga0070710_103019872 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHPDPNGPPDRRPIKVGEVWEYPVTGERSVILERPWDNPAGRVTGELTALVGAR |
Ga0066689_105002102 | 3300005447 | Soil | MSHPDPHGPPDRSPIQVGEIWENPVTRERATILELPYKNPEGRA |
Ga0070698_1004282212 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHPDPHGPPDRTPIQVGEIWEPERATILELPYKNQEGRATAEPTALVAAM |
Ga0070697_1013056662 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHPDPHGPPDRTPIQVGEIWEPERATILELPYKNQEGRATAELTALV |
Ga0066670_100835891 | 3300005560 | Soil | MRHPDPHGAPDRTPIEVGEVWVNPVTHERATILERTWDNPEGRATAELTALVGA |
Ga0070664_1018209071 | 3300005564 | Corn Rhizosphere | MTHPDPNAPPDRTPIQIGEVWENPMTGERATILELPQQNPERRVVAELLA |
Ga0068854_1005711031 | 3300005578 | Corn Rhizosphere | MAHPDPKGLPDPTPIRVGEVWENPVTRERAVILERPWDNPAGRGV |
Ga0066903_1047650983 | 3300005764 | Tropical Forest Soil | MSHPDPNGPPDRTPIQVGEVWENPITGERATILELPTRT |
Ga0066903_1084418441 | 3300005764 | Tropical Forest Soil | MSHPDPHAPPDRTPIQIGEVWENPITRERATILELPDQNPERRVV |
Ga0066903_1090855781 | 3300005764 | Tropical Forest Soil | MSHPDPHGVPDLRPIEIGEVWENPITRECATILELPHQSPDRRAVAELVAR |
Ga0066651_101760522 | 3300006031 | Soil | MLHPDPNGAPDRRPIKVGEVWENPVRGERSVILERPWDNLASRVTGELTALVG |
Ga0066696_101595661 | 3300006032 | Soil | MRHPDPHGPPDRTPIEVGEVWVNPVTRERATILERTWDNPEGRATAELTALVGA |
Ga0066696_104342221 | 3300006032 | Soil | VSHPDPNGAPDLTPIQVGEVWENPRTGERAKILEL |
Ga0066652_1019955082 | 3300006046 | Soil | LSHPDPHGPPDLTPIEIGEVWENPVNRERLTILELPWQNPEGRAV |
Ga0075417_105523271 | 3300006049 | Populus Rhizosphere | MSHPDPNAKPDLTPIQVGEVWEHPVTGERATILELPWTNPEGRVVAEL |
Ga0075018_106598801 | 3300006172 | Watersheds | MRHPAPDGPQDRTPIEIGEVWENPVTRERATILERTWDNPAGRVTAELTALV |
Ga0070712_1005009341 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHPDPNAPPDRTPIQIGEVWENPMTGERATILELP |
Ga0097621_1017264292 | 3300006237 | Miscanthus Rhizosphere | MRDLGANAHPDPIGAPDRRPIKVGEVSENPVTEERSVILERPWDNPASRVTGELTALV |
Ga0075021_100311511 | 3300006354 | Watersheds | MSHPDPHVLPDRTAIQIGEVWENPVPRERATIFELPHQNPERRAVAEL |
Ga0066653_105528271 | 3300006791 | Soil | MSHPDPHGPPDLTPIQVGEIWENPVTRERATILELPYKNQEGA* |
Ga0066665_102676371 | 3300006796 | Soil | MVRMSHPDPHGPPDVTPIQVGEVWENPVTGERATI |
Ga0066665_104919302 | 3300006796 | Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDSPASPRDRRADGTRWRV* |
Ga0066659_103221933 | 3300006797 | Soil | MAHPDPNGPPDRRPIKVGEVWENPVTGERLVILERPWDNPA |
Ga0075421_1023330961 | 3300006845 | Populus Rhizosphere | MSHPDPNAKPDLTPIQVGEVWEHPVTGERATILELPWTNPEGRVVA |
Ga0075430_1001844443 | 3300006846 | Populus Rhizosphere | MSMSHSEPHGPPDRTPIRVAGVWENPFMERATILERPWDNAAGRGTAEL |
Ga0075434_1013356841 | 3300006871 | Populus Rhizosphere | MSHPDSRAPPDHTPIQIGEVWENPITRERATILELPHQNPER |
Ga0075424_1017367132 | 3300006904 | Populus Rhizosphere | MSHPDPRAPPDHTPIQIGEVWENPITRERATILELPHQNPE |
Ga0079216_113416651 | 3300006918 | Agricultural Soil | VSANKGEILTIARMSHPEPNGPPDRTPVQVGEVWENPITGERATIMERPWDNPAGRGTAELTALVGARVM |
Ga0099793_100220781 | 3300007258 | Vadose Zone Soil | MSHSDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDN |
Ga0105245_107589651 | 3300009098 | Miscanthus Rhizosphere | MRHPDPHGPADRTPIEVGEVWVNPVTCERATILERTWDNPEGRATAELTALVGA |
Ga0105243_120208901 | 3300009148 | Miscanthus Rhizosphere | MSHPDPNGPPDLTPIRIGEIWENPASREQVRIVELSHSNPERR |
Ga0111538_117640552 | 3300009156 | Populus Rhizosphere | MSHPDPNGPPDLTPIQVGEVWENPVTRERATILELPFENREGRVTSS* |
Ga0075423_111636632 | 3300009162 | Populus Rhizosphere | VSHPDPHGPPDLTPIRFGEVLENPVTGERATILELPFTNPEGRA |
Ga0116214_13687571 | 3300009520 | Peatlands Soil | MSHPDPRGPPDRTPIQVGEVWENPVTRERATILELPYKSHEGRATAELTALV |
Ga0105249_106772371 | 3300009553 | Switchgrass Rhizosphere | MSHPDPDAAPDLTPIRLGEVWENPYTGERATIRELPFTNPEGRASAELLALFG |
Ga0105075_10179111 | 3300009799 | Groundwater Sand | MSHPDPNGPADLTPIQTGEVWENPVTGERATILEFPHTNPAGRAVAE |
Ga0126305_108638521 | 3300010036 | Serpentine Soil | MSHPDPHAPPDRTPIQIGEVWENPITRERSTLLELPQQNPESRLVGELLALVGARLVGEHRHPRI |
Ga0126304_108642452 | 3300010037 | Serpentine Soil | MSHPDPHAPPDRTPIQIGEVWENPVTGERSTILEL |
Ga0126311_104739542 | 3300010045 | Serpentine Soil | MSHPDPHGPPDLTPIKVGEVWENPVTGERATILELPW |
Ga0126370_125444532 | 3300010358 | Tropical Forest Soil | MSHPDPRGAPDLRPIEIGEVWENPITRERAIILELPHQN |
Ga0126372_103883421 | 3300010360 | Tropical Forest Soil | MSHPDPYGSEDRTPIQIGEILENPVTGERAKILELPWKNPE |
Ga0126372_122356821 | 3300010360 | Tropical Forest Soil | MSHPDPNAAPDLTPIRLGEVWENPVTGERATVRELPFTNPEGRATAELLALY |
Ga0126378_111639962 | 3300010361 | Tropical Forest Soil | MSHPNPQAPPDRRPIEIGEVWENPITRERVTILERPWDNE |
Ga0126378_120312483 | 3300010361 | Tropical Forest Soil | MSAVRYSVRMSHPNPQAPPDRRPIEIGEVWENPITRERVTILERPWDNE |
Ga0126378_121567821 | 3300010361 | Tropical Forest Soil | MRDLGAMSHPDPNGPADRTPIETGEVWDNPVTGER |
Ga0126379_100143561 | 3300010366 | Tropical Forest Soil | MSHPDPHGEPDRTPIEVGEVWENPVTRERARLVELPWDNPDGRAAA |
Ga0126379_138172631 | 3300010366 | Tropical Forest Soil | MPHPDPHGPPDRTPIKVGEVWENPVTGERATILERPWDNPEGRATAE |
Ga0134125_118148291 | 3300010371 | Terrestrial Soil | MSHPDPNGLPDLTPIQAGEVLENPVTRERATVLELPWTNPEGRAVAEMTALVGAR |
Ga0136449_1025039081 | 3300010379 | Peatlands Soil | MPHPDPDGPPDLTPVHVGEVLENPVTGERATILELPNENPEGRATAEL |
Ga0126383_118698782 | 3300010398 | Tropical Forest Soil | MNEDSARVVRMSHPDPNGPPDRTPIRVGEVWENPVNRERITILERCWDNPEGRATAELTALV* |
Ga0105246_109064501 | 3300011119 | Miscanthus Rhizosphere | MTHPDPNAPPDRTPIQIGEVWENPMTGERATILELPQQNPERR |
Ga0137432_12145341 | 3300011439 | Soil | MSHPDPNGPPDLKPIQVGELWENPVTRERATILELPFKNPEGRVTAELTALA |
Ga0137382_100104881 | 3300012200 | Vadose Zone Soil | NVAPDPNGAPDRRPIKVGEVWVNPVTGERSVILERPWDN* |
Ga0137382_101692121 | 3300012200 | Vadose Zone Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELTALVGA |
Ga0137363_111055651 | 3300012202 | Vadose Zone Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERLVILERLWDNPASRVTGELTALVGAR |
Ga0137399_100381102 | 3300012203 | Vadose Zone Soil | MPHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWNN |
Ga0137399_101644061 | 3300012203 | Vadose Zone Soil | MSHPDPSGPPNRRPIKVGEVWENPVTGERLVILERPWDNPASRVTGELTALVG |
Ga0137399_102496971 | 3300012203 | Vadose Zone Soil | MSHSDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRV |
Ga0137399_102659012 | 3300012203 | Vadose Zone Soil | MSHPDPNGPPDRRPIKVGEVWENPVTGERSVILERPWDNPA |
Ga0137380_101067504 | 3300012206 | Vadose Zone Soil | WRECRTPTPNGPPDRRPIKLGEVWENPVTGERLVILERPWDNPASRVTGELKHSLARV* |
Ga0137380_113513392 | 3300012206 | Vadose Zone Soil | MSHPDPNGQPDLTPIQIGEVWENPVNRERLTILELPWQNPEGRAVDELT |
Ga0137376_102165711 | 3300012208 | Vadose Zone Soil | MSHPDPNGAPDRGPIKVGEVWENPVTGERSVILERPWDNPASRVTG* |
Ga0137376_104603251 | 3300012208 | Vadose Zone Soil | MSHPDPNGPPERRPIKVGEVWENPVTGERLVILERP |
Ga0137376_105423661 | 3300012208 | Vadose Zone Soil | MSHPDPNGPPDRRPIKVGEVWENPVTGERLVILERPRDNPA |
Ga0137378_108939732 | 3300012210 | Vadose Zone Soil | MSHPDPHGPPDLTPIQIGEVWENPVNRERLTILELPWQNPEGR |
Ga0137377_104119331 | 3300012211 | Vadose Zone Soil | VSHPDPHGPPDLTPIEIGEVWENRVNRERLTILELPWQNPEGRAVDELTAL |
Ga0150985_1132138061 | 3300012212 | Avena Fatua Rhizosphere | MRHPDPHGPADRTPIEVGEVWANPVTRERATILERTWDNPEGRATAELTALV |
Ga0137370_104849142 | 3300012285 | Vadose Zone Soil | MSHPDPNGPPDRRPIKVGEVWENPVTGERLVILERPWDNPASRV |
Ga0137372_104843332 | 3300012350 | Vadose Zone Soil | MSHPDPHGPPDLTPIEIGEVWENPVNRERLTILELPWQNPEGRAVNEMT |
Ga0137369_104426251 | 3300012355 | Vadose Zone Soil | MSHPDPNGQPDFTPIQIGEVWENPVNRERLTILELPWQNP |
Ga0137384_114970132 | 3300012357 | Vadose Zone Soil | MSHPDPHGPPDFTPIQIGEIWENRTTGERSTILELPWKNPEGRATAELT |
Ga0157320_10156622 | 3300012481 | Arabidopsis Rhizosphere | VSHPDPNGPPDLRPVRFGEVWENPVTGERATILELPYT |
Ga0157288_102905751 | 3300012901 | Soil | MSHPEPLGPADRTPISVGEVWENPISRERATILERP |
Ga0137396_100294407 | 3300012918 | Vadose Zone Soil | MSHPDPSGPPNRRPIKVGEVWENPVTGERLVILERPWDNPASRVTGELTAL |
Ga0137396_101654461 | 3300012918 | Vadose Zone Soil | NGAPDRRPIKVGEVWENPVTGERLVILERPWDNPASRVKSGTWM* |
Ga0137419_101314913 | 3300012925 | Vadose Zone Soil | MSHPDQNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELTALVGA |
Ga0137416_106021371 | 3300012927 | Vadose Zone Soil | MSHPDPNGAPDRGPIKVGEVWENPVTGERSVILERPWDNPASRVTG |
Ga0137404_115147941 | 3300012929 | Vadose Zone Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELTALVG |
Ga0134110_104344612 | 3300012975 | Grasslands Soil | MSHPDASGPANLTPIQVGEVWENRATGERATILELPHTNPEGRAIAELTAL |
Ga0157371_109797071 | 3300013102 | Corn Rhizosphere | MGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATILERPWDNPEGRATAEL |
Ga0157374_100747136 | 3300013296 | Miscanthus Rhizosphere | MRHPDPHGPPDRTPIEVGEVWVNPVTCERATILERTWDNPEGR |
Ga0163162_106482891 | 3300013306 | Switchgrass Rhizosphere | MNHPDPYGPPDLTPIEIGEVWENPVTRERATILERSWDNPA |
Ga0157375_101198643 | 3300013308 | Miscanthus Rhizosphere | MRHPDPHGPPDRTPIEVGEVWVNPVTCERATILER |
Ga0157375_133764002 | 3300013308 | Miscanthus Rhizosphere | VSHPDPDAPPDLTPIRVGEVWENPVTRERATILELPAQN |
Ga0134078_106135432 | 3300014157 | Grasslands Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWD |
Ga0181526_104063082 | 3300014200 | Bog | VRVSHPDPNGPADLTPIRVGEAFENPATRERAIVLELPHMNAQG |
Ga0180076_10829371 | 3300014867 | Soil | MAHPDPNAPPDLRPIQAGEVWENPVNRERAIVLEV |
Ga0157379_100633571 | 3300014968 | Switchgrass Rhizosphere | MGRLSHPDPHGPPDRTPIEVGEVWENPVTKERATILE |
Ga0137411_13700793 | 3300015052 | Vadose Zone Soil | MSHPDPNGAPDRNHKKVGEVWENHVTGERSVILDVLGQPASRVTGG* |
Ga0182041_118556932 | 3300016294 | Soil | MSHPDAHAPPDRTPIQIGEVWENPITRERATILELPDQNPERRVVGELLALAGARVVEHR |
Ga0182038_118547352 | 3300016445 | Soil | MSHPAPDGPPDRTPIKVGEVWVNPVNRERFTILERFWDNPQGRATAELTALVGARVVG |
Ga0187785_103590091 | 3300017947 | Tropical Peatland | MSHPDPNAPPDTTPIQAGEVWENPITRERATLLELPNHNPE |
Ga0187778_102088271 | 3300017961 | Tropical Peatland | VRHPEPNGPSDRRPIKVGEVWENPVTRERATILEL |
Ga0187780_109173321 | 3300017973 | Tropical Peatland | MSHPNPQAPPDRRPIEIGEVWENPITRERVTILERPWDNEA |
Ga0190270_125104021 | 3300018469 | Soil | VSHPDPSAPADRRAIEPGEVWENPVTGERAVIVELP |
Ga0173479_103853931 | 3300019362 | Soil | MSHPEPLGPADRTPISVGEVWENPISRERATFLERPWDN |
Ga0190264_102850363 | 3300019377 | Soil | MLHPDPHAPPDRTPIQIGEVWENPITREQATVLELPHHNPERRVVAELLARA |
Ga0210396_101510291 | 3300021180 | Soil | MSHPDPNGPPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGEL |
Ga0210396_107410252 | 3300021180 | Soil | MWHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNP |
Ga0210384_100562602 | 3300021432 | Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELSTRWRAARV |
Ga0210409_100095501 | 3300021559 | Soil | MSYPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNP |
Ga0210409_101453831 | 3300021559 | Soil | MSHPDPNGPPDRRPIKVGEVWENPVTGERSVILERPWDNPASLRDRRAD |
Ga0126371_138421931 | 3300021560 | Tropical Forest Soil | MSHPDPHGPADRSPIQVGEIWENPVTRERARILELPYRNPEGRATAELT |
Ga0247695_10615861 | 3300024179 | Soil | MKMAQTSHPEPDGAPDRTPVEVGELWENPVTRERVTILERPWDNPVGRAT |
Ga0179589_102959711 | 3300024288 | Vadose Zone Soil | MSHPDANGAPDRRPIKVGEVWENPVTGERSVILERPWD |
Ga0207933_10907893 | 3300025679 | Arctic Peat Soil | MSHPDPNAPPDLNPIRVGEIFENPVTRERATILELPHTNPESRATAELT |
Ga0207682_102655061 | 3300025893 | Miscanthus Rhizosphere | MRHPDPHGPPDRTPIEVGEVWVNPVTRERATILERTWDNPAGR |
Ga0207695_115438641 | 3300025913 | Corn Rhizosphere | MSHPDPHKPPDRTPIQIGEVWENPITRERATILEL |
Ga0207700_108470262 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHPDPNGPPDLTPIEAGEVLENPITRERATVLELPWTNPEGRAVAEMTAL |
Ga0207670_110406011 | 3300025936 | Switchgrass Rhizosphere | MSHPDPDAAPDLTPIRLGEVWENPVTGERATIRELPF |
Ga0207704_109313771 | 3300025938 | Miscanthus Rhizosphere | MVVRVSHPDPNGLADVTPIEVGEVWENPVSGERATILELPQANRDGRCVVELTA |
Ga0207658_110556091 | 3300025986 | Switchgrass Rhizosphere | MVVRVSHPDPNGLADVTPIEVGEVWENPVSGERATILELPQANRDGRCVVEL |
Ga0207658_116020271 | 3300025986 | Switchgrass Rhizosphere | MGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATI |
Ga0207678_102477712 | 3300026067 | Corn Rhizosphere | MRHPDPHGPPDRTPIEVGEIWVNPVTRERATILERTWDNPAGRATAELTALV |
Ga0209801_10513572 | 3300026326 | Soil | MSHSDPNGAPDRRPIRVGEVWENPVTGERSVILERPWDNPASRVTGE |
Ga0209802_11295142 | 3300026328 | Soil | MSHPDPNGSPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTG |
Ga0209056_105158922 | 3300026538 | Soil | MSHSDPNGAPDRRPIRVGEVWENPVTGERSVILERPWDNPASRVTGELKCFSSV |
Ga0209161_105115871 | 3300026548 | Soil | MSHPDPHGPPDFTPIQIGEIWENPATGERATILELP |
Ga0209214_10068781 | 3300027071 | Forest Soil | MSHPDPNGAPDRRPIKVGEVWEDPVTGERSVILERPWDNAAS |
Ga0209523_10860272 | 3300027548 | Forest Soil | MNTVRNSHPDPDAPVDRTPVQVGELWENPITKERVTILERP |
Ga0209220_11513161 | 3300027587 | Forest Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILEGPWDNPASRVTGELTALVARV |
Ga0209689_11300582 | 3300027748 | Soil | MSHPDPNGSPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELTA |
Ga0209798_103569953 | 3300027843 | Wetland Sediment | MSHPDPHGQPDRTPIAVGEIWENPVTRERARILERPG |
Ga0209068_105199772 | 3300027894 | Watersheds | MRHPDPHGPPDRTPIEVGEVWVNPVTRERATILERTW |
Ga0137415_110533972 | 3300028536 | Vadose Zone Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPAS |
Ga0265326_100441071 | 3300028558 | Rhizosphere | VSHPDPNGPPDLRPIEAGEIWENPATGERATILEAPWHN |
Ga0247828_109225071 | 3300028587 | Soil | MSHPDPNGPADTRPITAGEVWENPVSGEHAILVELPYAHLD |
Ga0247822_117504321 | 3300028592 | Soil | MGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATILERPW |
Ga0247827_107788522 | 3300028889 | Soil | MGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATILERPWDNPEGRAP |
Ga0311340_109045932 | 3300029943 | Palsa | VSHPDPNGPPDLTPIQVGDMLEHPVTGERATTLELPW |
Ga0311338_113884052 | 3300030007 | Palsa | VSHPDPNGPPDLTPIQVGDMLEHPVTGERATTLELPWKNPEGRASAELTALVG |
Ga0311338_118811762 | 3300030007 | Palsa | MICRMSHPDPNGPPDLTPIHEGEIFENPLTRERATILELPTSNPEERAV |
Ga0247826_117609333 | 3300030336 | Soil | MSHPDPNGPADTRPITAGEVWENPVSGEHAILVELPYAHLDGHCV |
Ga0302184_102525471 | 3300030490 | Palsa | MSHPDPNAPPDLTPIQPGEVWTNPVTRERAVLLEFPTENADGR |
Ga0311355_106292743 | 3300030580 | Palsa | VAHPDPNGPADLTPLQIGEVWENPVTRERATLLEFPNKNPEGRASAELTALV |
Ga0302311_104991203 | 3300030739 | Palsa | VAHPDPNGPADLTPLQIGEVWENPVTRERATLLEFPNKNPEGRASAEL |
Ga0170824_1105416434 | 3300031231 | Forest Soil | MSHPDPNGAPDRRPIKVGEVWENPITGERSVILERPWDNPASRVTGGTEEGTP |
Ga0247727_107235663 | 3300031576 | Biofilm | MSHPDPNGPADLTSIQIGEVWENPVTRERATILELPYTNPAGSV |
Ga0318555_107134442 | 3300031640 | Soil | MSHPDPDGPPDLTPIRAGEVWENPVTGERGTILELPTEN |
Ga0265342_105029932 | 3300031712 | Rhizosphere | VSHPDPNGPPDLRPIEAGEIWENPATGERATILEAPWHNPEERGV |
Ga0306917_107760031 | 3300031719 | Soil | MSHPAPDGPPDRTPIKVGEVWVNPVNRERFTILERFWDNPQGRATAELTALVGARVVGE |
Ga0318502_106830521 | 3300031747 | Soil | MSHPDPNGAPDLRPIHVGEVWENPVTRERATVLELPY |
Ga0307477_100491291 | 3300031753 | Hardwood Forest Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILEG |
Ga0307475_100486351 | 3300031754 | Hardwood Forest Soil | MSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELT |
Ga0318521_110358912 | 3300031770 | Soil | MSHPDPHGPSDRTPIDVGEIWENPVTGERATILERPWD |
Ga0318552_105569611 | 3300031782 | Soil | MSHPDPSGPPDLTPIRRGEVWENPVTGERGTILELPTDN |
Ga0306925_118026041 | 3300031890 | Soil | MSHPDPHGSPDRTPIKVGEVWENPVTRERATILERPWDNPAGRATAELT |
Ga0310900_111193112 | 3300031908 | Soil | MSHPEPLVAADRTPIAAGEVWENPITKERATIVERPWDNPE |
Ga0310909_107921941 | 3300031947 | Soil | MSHPAPDGPPDRTPIKVGEVWVNPVNRERFTILERFWDNPQGRATAELTALVGARV |
Ga0306926_129637631 | 3300031954 | Soil | MSHPDAYAPPDRTPIQIGEVWENPMTGERATILELPHQNPERRV |
Ga0306922_123579791 | 3300032001 | Soil | MQESGRMPRPDPNGPADRRPIKVGEVWENPATGER |
Ga0310897_100700141 | 3300032003 | Soil | MGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATILERPWDNPEGR |
Ga0318549_105404101 | 3300032041 | Soil | MRHPEPQGPPDRRTIEVGEVWENPVTGERASILERPWDNPASRVTAE |
Ga0311301_104802041 | 3300032160 | Peatlands Soil | MSHPDPRGPPDRTPIQVGEVWENPVTRERATILELPYKNHEGRATAEL |
Ga0307471_1028053881 | 3300032180 | Hardwood Forest Soil | MSHPDPNGPPDRTPRKVGEVWENPVTGERATILERPWDNPAGRA |
Ga0335080_106624521 | 3300032828 | Soil | MRNDRMSHPDPDAPLDRTPLQVGELWENPITKERVTILERPWDN |
⦗Top⦘ |