NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F032419

Metagenome Family F032419

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032419
Family Type Metagenome
Number of Sequences 180
Average Sequence Length 45 residues
Representative Sequence MSHPDPNGPPDRTPRKVGEVWENPVTGERATILERPWDNPAGRA
Number of Associated Samples 156
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.11 %
% of genes near scaffold ends (potentially truncated) 93.33 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 145
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.222 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(15.000 % of family members)
Environment Ontology (ENVO) Unclassified
(31.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.17%    β-sheet: 8.33%    Coil/Unstructured: 87.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF07883Cupin_2 3.33
PF07228SpoIIE 2.78
PF13683rve_3 1.67
PF12704MacB_PCD 1.67
PF03401TctC 1.11
PF00440TetR_N 1.11
PF07992Pyr_redox_2 1.11
PF00753Lactamase_B 1.11
PF01909NTP_transf_2 1.11
PF00885DMRL_synthase 1.11
PF04909Amidohydro_2 1.11
PF02518HATPase_c 1.11
PF00069Pkinase 1.11
PF01425Amidase 1.11
PF00072Response_reg 0.56
PF07729FCD 0.56
PF00891Methyltransf_2 0.56
PF02627CMD 0.56
PF13432TPR_16 0.56
PF13637Ank_4 0.56
PF03551PadR 0.56
PF01979Amidohydro_1 0.56
PF00583Acetyltransf_1 0.56
PF08281Sigma70_r4_2 0.56
PF00122E1-E2_ATPase 0.56
PF12680SnoaL_2 0.56
PF00903Glyoxalase 0.56
PF16576HlyD_D23 0.56
PF03729DUF308 0.56
PF13207AAA_17 0.56
PF13620CarboxypepD_reg 0.56
PF13826DUF4188 0.56
PF01494FAD_binding_3 0.56
PF02371Transposase_20 0.56
PF08450SGL 0.56
PF01048PNP_UDP_1 0.56
PF12706Lactamase_B_2 0.56
PF14137DUF4304 0.56
PF08031BBE 0.56
PF07592DDE_Tnp_ISAZ013 0.56
PF00462Glutaredoxin 0.56
PF04828GFA 0.56
PF00482T2SSF 0.56
PF08592Anthrone_oxy 0.56
PF02897Peptidase_S9_N 0.56
PF13424TPR_12 0.56
PF01618MotA_ExbB 0.56
PF01252Peptidase_A8 0.56
PF06253MTTB 0.56
PF02574S-methyl_trans 0.56
PF13675PilJ 0.56
PF12142PPO1_DWL 0.56
PF12697Abhydrolase_6 0.56
PF13340DUF4096 0.56
PF01568Molydop_binding 0.56
PF09351DUF1993 0.56
PF00202Aminotran_3 0.56
PF13858DUF4199 0.56
PF01266DAO 0.56
PF00291PALP 0.56
PF01068DNA_ligase_A_M 0.56
PF13473Cupredoxin_1 0.56
PF12867DinB_2 0.56
PF07040DUF1326 0.56
PF07366SnoaL 0.56
PF00924MS_channel 0.56
PF13817DDE_Tnp_IS66_C 0.56
PF10028DUF2270 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 4.44
COG00546,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)Coenzyme transport and metabolism [H] 1.11
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.11
COG0597Lipoprotein signal peptidaseCell wall/membrane/envelope biogenesis [M] 1.11
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.11
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.11
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.56
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.56
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.56
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.56
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.56
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.56
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.56
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.56
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.56
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.56
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.56
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 0.56
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.56
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.56
COG1770Protease IIAmino acid transport and metabolism [E] 0.56
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.56
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.56
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.56
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.56
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.56
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.56
COG2216K+ transport ATPase, ATPase subunit KdpBInorganic ion transport and metabolism [P] 0.56
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.56
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.56
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.56
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.56
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.56
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.56
COG3547TransposaseMobilome: prophages, transposons [X] 0.56
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.56
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.56
COG5598Trimethylamine:corrinoid methyltransferaseCoenzyme transport and metabolism [H] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.22 %
UnclassifiedrootN/A7.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG02DMU7QAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
2070309004|prs_FIHLEPW02T4L27All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
2228664022|INPgaii200_c0809384All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2019619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium871Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100488325All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300000955|JGI1027J12803_100433002All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300000955|JGI1027J12803_106848646Not Available1127Open in IMG/M
3300000956|JGI10216J12902_100439791All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2217Open in IMG/M
3300001593|JGI12635J15846_10014166All Organisms → cellular organisms → Bacteria → Acidobacteria6646Open in IMG/M
3300001593|JGI12635J15846_10301177All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1003Open in IMG/M
3300002914|JGI25617J43924_10366927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300004092|Ga0062389_101210465All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300004157|Ga0062590_100892061All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300005172|Ga0066683_10226558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591157Open in IMG/M
3300005176|Ga0066679_10248099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1146Open in IMG/M
3300005177|Ga0066690_10119733All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300005181|Ga0066678_10249962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1147Open in IMG/M
3300005181|Ga0066678_10440769All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300005293|Ga0065715_10171627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1542Open in IMG/M
3300005294|Ga0065705_10552236All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005331|Ga0070670_100272189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1478Open in IMG/M
3300005341|Ga0070691_10615793All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005367|Ga0070667_101046105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300005436|Ga0070713_101906064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300005437|Ga0070710_10301987All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1045Open in IMG/M
3300005447|Ga0066689_10500210All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005471|Ga0070698_100428221Not Available1258Open in IMG/M
3300005536|Ga0070697_101305666Not Available647Open in IMG/M
3300005560|Ga0066670_10083589All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300005564|Ga0070664_101820907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059577Open in IMG/M
3300005578|Ga0068854_100571103All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300005764|Ga0066903_104765098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria722Open in IMG/M
3300005764|Ga0066903_108441844All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300005764|Ga0066903_109085578All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300006031|Ga0066651_10176052All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300006032|Ga0066696_10159566All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300006032|Ga0066696_10434222All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300006046|Ga0066652_101995508All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006049|Ga0075417_10552327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300006172|Ga0075018_10659880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300006175|Ga0070712_100500934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1018Open in IMG/M
3300006237|Ga0097621_101726429All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006354|Ga0075021_10031151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3029Open in IMG/M
3300006791|Ga0066653_10552827All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300006796|Ga0066665_10267637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1360Open in IMG/M
3300006796|Ga0066665_10491930All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300006797|Ga0066659_10322193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1188Open in IMG/M
3300006845|Ga0075421_102333096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300006846|Ga0075430_100184444All Organisms → cellular organisms → Bacteria → Terrabacteria group1735Open in IMG/M
3300006871|Ga0075434_101335684All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300006904|Ga0075424_101736713All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300006918|Ga0079216_11341665All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300007258|Ga0099793_10022078All Organisms → cellular organisms → Bacteria → Proteobacteria2626Open in IMG/M
3300009098|Ga0105245_10758965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1006Open in IMG/M
3300009148|Ga0105243_12020890All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300009156|Ga0111538_11764055All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300009162|Ga0075423_11163663Not Available822Open in IMG/M
3300009520|Ga0116214_1368757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300009553|Ga0105249_10677237All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300009799|Ga0105075_1017911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium718Open in IMG/M
3300010036|Ga0126305_10863852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium shewense617Open in IMG/M
3300010037|Ga0126304_10864245All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300010045|Ga0126311_10473954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300010358|Ga0126370_12544453All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300010360|Ga0126372_10388342All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300010360|Ga0126372_12235682Not Available596Open in IMG/M
3300010361|Ga0126378_11163996Not Available870Open in IMG/M
3300010361|Ga0126378_12031248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300010361|Ga0126378_12156782All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21636Open in IMG/M
3300010366|Ga0126379_10014356All Organisms → cellular organisms → Bacteria5714Open in IMG/M
3300010366|Ga0126379_13817263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300010371|Ga0134125_11814829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300010379|Ga0136449_102503908All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300010398|Ga0126383_11869878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300011119|Ga0105246_10906450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300011439|Ga0137432_1214534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300012200|Ga0137382_10010488All Organisms → cellular organisms → Bacteria4913Open in IMG/M
3300012200|Ga0137382_10169212All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300012202|Ga0137363_11105565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300012203|Ga0137399_10038110All Organisms → cellular organisms → Bacteria → Acidobacteria3388Open in IMG/M
3300012203|Ga0137399_10164406All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300012203|Ga0137399_10249697All Organisms → cellular organisms → Bacteria1455Open in IMG/M
3300012203|Ga0137399_10265901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1410Open in IMG/M
3300012206|Ga0137380_10106750All Organisms → cellular organisms → Bacteria → Acidobacteria2559Open in IMG/M
3300012206|Ga0137380_11351339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300012208|Ga0137376_10216571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1658Open in IMG/M
3300012208|Ga0137376_10460325All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300012208|Ga0137376_10542366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1008Open in IMG/M
3300012210|Ga0137378_10893973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300012211|Ga0137377_10411933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1289Open in IMG/M
3300012212|Ga0150985_113213806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300012285|Ga0137370_10484914All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300012350|Ga0137372_10484333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300012355|Ga0137369_10442625All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300012357|Ga0137384_11497013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300012481|Ga0157320_1015662All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300012901|Ga0157288_10290575Not Available567Open in IMG/M
3300012918|Ga0137396_10029440All Organisms → cellular organisms → Bacteria3619Open in IMG/M
3300012918|Ga0137396_10165446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1616Open in IMG/M
3300012925|Ga0137419_10131491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1783Open in IMG/M
3300012927|Ga0137416_10602137All Organisms → cellular organisms → Bacteria → Acidobacteria957Open in IMG/M
3300012929|Ga0137404_11514794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300012975|Ga0134110_10434461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300013102|Ga0157371_10979707All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300013296|Ga0157374_10074713All Organisms → cellular organisms → Bacteria → Acidobacteria3201Open in IMG/M
3300013306|Ga0163162_10648289Not Available1180Open in IMG/M
3300013308|Ga0157375_10119864All Organisms → cellular organisms → Bacteria → Acidobacteria2739Open in IMG/M
3300013308|Ga0157375_13376400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300014157|Ga0134078_10613543All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300014200|Ga0181526_10406308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Vulgatibacteraceae → Vulgatibacter → Vulgatibacter incomptus864Open in IMG/M
3300014867|Ga0180076_1082937Not Available590Open in IMG/M
3300014968|Ga0157379_10063357All Organisms → cellular organisms → Bacteria3306Open in IMG/M
3300015052|Ga0137411_1370079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1791Open in IMG/M
3300016294|Ga0182041_11855693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300016445|Ga0182038_11854735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300017947|Ga0187785_10359009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300017961|Ga0187778_10208827All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300017973|Ga0187780_10917332Not Available636Open in IMG/M
3300018469|Ga0190270_12510402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300019362|Ga0173479_10385393All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300019377|Ga0190264_10285036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria987Open in IMG/M
3300021180|Ga0210396_10151029All Organisms → cellular organisms → Bacteria2086Open in IMG/M
3300021180|Ga0210396_10741025All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300021432|Ga0210384_10056260All Organisms → cellular organisms → Bacteria → Acidobacteria3562Open in IMG/M
3300021559|Ga0210409_10009550All Organisms → cellular organisms → Bacteria9814Open in IMG/M
3300021559|Ga0210409_10145383All Organisms → cellular organisms → Bacteria2173Open in IMG/M
3300021560|Ga0126371_13842193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300024179|Ga0247695_1061586All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300024288|Ga0179589_10295971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300025679|Ga0207933_1090789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium975Open in IMG/M
3300025893|Ga0207682_10265506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia801Open in IMG/M
3300025913|Ga0207695_11543864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300025928|Ga0207700_10847026Not Available818Open in IMG/M
3300025936|Ga0207670_11040601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300025938|Ga0207704_10931377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium732Open in IMG/M
3300025986|Ga0207658_11055609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium742Open in IMG/M
3300025986|Ga0207658_11602027All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300026067|Ga0207678_10247771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1526Open in IMG/M
3300026326|Ga0209801_1051357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1874Open in IMG/M
3300026328|Ga0209802_1129514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1097Open in IMG/M
3300026538|Ga0209056_10515892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300026548|Ga0209161_10511587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300027071|Ga0209214_1006878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1301Open in IMG/M
3300027548|Ga0209523_1086027All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300027587|Ga0209220_1151316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300027748|Ga0209689_1130058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1252Open in IMG/M
3300027843|Ga0209798_10356995All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300027894|Ga0209068_10519977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia688Open in IMG/M
3300028536|Ga0137415_11053397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300028558|Ga0265326_10044107All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300028587|Ga0247828_10922507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300028592|Ga0247822_11750432All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300028889|Ga0247827_10778852All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300029943|Ga0311340_10904593Not Available733Open in IMG/M
3300030007|Ga0311338_11388405Not Available654Open in IMG/M
3300030007|Ga0311338_11881176Not Available536Open in IMG/M
3300030336|Ga0247826_11760933All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300030490|Ga0302184_10252547All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300030580|Ga0311355_10629274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1008Open in IMG/M
3300030739|Ga0302311_10499120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter837Open in IMG/M
3300031231|Ga0170824_110541643All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300031576|Ga0247727_10723566All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300031640|Ga0318555_10713444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300031712|Ga0265342_10502993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300031719|Ga0306917_10776003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300031747|Ga0318502_10683052All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031753|Ga0307477_10049129All Organisms → cellular organisms → Bacteria2900Open in IMG/M
3300031754|Ga0307475_10048635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3177Open in IMG/M
3300031770|Ga0318521_11035891All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031782|Ga0318552_10556961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300031890|Ga0306925_11802604All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300031908|Ga0310900_11119311All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300031947|Ga0310909_10792194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300031954|Ga0306926_12963763All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300032001|Ga0306922_12357979All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300032003|Ga0310897_10070014All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300032041|Ga0318549_10540410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300032160|Ga0311301_10480204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1854Open in IMG/M
3300032180|Ga0307471_102805388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300032828|Ga0335080_10662452All Organisms → cellular organisms → Bacteria1092Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.33%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.22%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.67%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.11%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.11%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.11%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.56%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.56%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.56%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.56%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.56%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.56%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014867Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025679Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027071Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_041766302067725004SoilMRHPEPDGLPDRRPIELGEVWENPVTGERGILERPWENDAGRATSEMTALVGARVVGE
prs_067349602070309004Green-Waste CompostMSHPDPHGAPDCTPIEVGEVWENPVTRECATILERPWDNPGKAVRPAELTALVGARV
INPgaii200_080938412228664022SoilMSHPEPHGPPDRTPIEVGEIWENPATRERATILERPWD
ICChiseqgaiiDRAFT_201961913300000033SoilMGRWSHPDPDGPPDRTSIEVGEIWQNPVTRERATILERPWDNPESRAAAELTAL
INPhiseqgaiiFebDRAFT_10048832513300000364SoilMSHPEPHGPPDRTPIEVGEIWENPATRERATILERPWDNPAG
JGI1027J12803_10043300223300000955SoilMSHPDPIGAPDRRPIKVGEVWENPVTEERSVILERPWDNPASS
JGI1027J12803_10684864643300000955SoilNGPPDCRPIKVGEVWENPVTGERSVILERPWDNPASS
JGI10216J12902_10043979133300000956SoilMSHPEPHGPPDRTPIQVGEVWENPVTRERATILERPWD
JGI12635J15846_1001416613300001593Forest SoilSHPDPNGAPDRRPIKVGEVWENPVTGERSVILEGPWDNPASRVTGELTALVARV*
JGI12635J15846_1030117713300001593Forest SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILEGPWDNPASRVTGELTALVARV*
JGI25617J43924_1036692723300002914Grasslands SoilMSHPDPNGPPDRGPIKVGEVWENPVTGERSVILERPWDNPASRVTG
Ga0062389_10121046513300004092Bog Forest SoilVSHPDPFGPPDRTPIEIGEVWENPVTRERATILELPYQNT
Ga0062590_10089206123300004157SoilMRHPDPHGPPDHTPIEVGEVWVNPVTRERATILERTWDNP
Ga0066683_1022655813300005172SoilMSHPDPHGPPDLTPIQIGEVWENPVNRERLTILELPWQNPEGRAVDE
Ga0066679_1024809923300005176SoilMSHPDPNGAPDRRLIKVGEVWENPVTGERSVILERPWDNPASRVTGELTALVG
Ga0066690_1011973313300005177SoilMSHPDPNGPPDRRPIKVGEVWENPVTGERLVILERPWDNPA
Ga0066678_1024996223300005181SoilMSHPDPSGPPNRRPIKVGEVWENPVTGERLVILERPWDNPASRAKSGTWM*
Ga0066678_1044076913300005181SoilMSHSDPNGAPDRRPIRVGEVWENPVTGERSVILERPWDNPAS
Ga0065715_1017162713300005293Miscanthus RhizosphereMRHPDPHGPPDRTPIEVGEVWVNPVTRERATILERTWDNPAGRATAE
Ga0065705_1055223613300005294Switchgrass RhizosphereMSHPDPDGPPHRTPITVGEVWENPVTRERATILERPWDNPAGR
Ga0070670_10027218923300005331Switchgrass RhizosphereMSHPDPHGPEDRTPIQVGEVWENPVTRERARILELPNKNREGR
Ga0070691_1061579323300005341Corn, Switchgrass And Miscanthus RhizosphereMSHPDPHEPPDRTPIQIGEVWENPITQERATILELPDQNPERRVVGELLALAGAHV
Ga0070667_10104610513300005367Switchgrass RhizosphereMVVRVSHPDPNGLADVTPIEVGEVWENPVSGERATILELPQANRDGRCV
Ga0070713_10190606413300005436Corn, Switchgrass And Miscanthus RhizosphereMSHPDPNGPPDLTPIEAGEVLENPITRERATVLELPWTNPEGRAVAEMTA
Ga0070710_1030198723300005437Corn, Switchgrass And Miscanthus RhizosphereMSHPDPNGPPDRRPIKVGEVWEYPVTGERSVILERPWDNPAGRVTGELTALVGAR
Ga0066689_1050021023300005447SoilMSHPDPHGPPDRSPIQVGEIWENPVTRERATILELPYKNPEGRA
Ga0070698_10042822123300005471Corn, Switchgrass And Miscanthus RhizosphereMSHPDPHGPPDRTPIQVGEIWEPERATILELPYKNQEGRATAEPTALVAAM
Ga0070697_10130566623300005536Corn, Switchgrass And Miscanthus RhizosphereMSHPDPHGPPDRTPIQVGEIWEPERATILELPYKNQEGRATAELTALV
Ga0066670_1008358913300005560SoilMRHPDPHGAPDRTPIEVGEVWVNPVTHERATILERTWDNPEGRATAELTALVGA
Ga0070664_10182090713300005564Corn RhizosphereMTHPDPNAPPDRTPIQIGEVWENPMTGERATILELPQQNPERRVVAELLA
Ga0068854_10057110313300005578Corn RhizosphereMAHPDPKGLPDPTPIRVGEVWENPVTRERAVILERPWDNPAGRGV
Ga0066903_10476509833300005764Tropical Forest SoilMSHPDPNGPPDRTPIQVGEVWENPITGERATILELPTRT
Ga0066903_10844184413300005764Tropical Forest SoilMSHPDPHAPPDRTPIQIGEVWENPITRERATILELPDQNPERRVV
Ga0066903_10908557813300005764Tropical Forest SoilMSHPDPHGVPDLRPIEIGEVWENPITRECATILELPHQSPDRRAVAELVAR
Ga0066651_1017605223300006031SoilMLHPDPNGAPDRRPIKVGEVWENPVRGERSVILERPWDNLASRVTGELTALVG
Ga0066696_1015956613300006032SoilMRHPDPHGPPDRTPIEVGEVWVNPVTRERATILERTWDNPEGRATAELTALVGA
Ga0066696_1043422213300006032SoilVSHPDPNGAPDLTPIQVGEVWENPRTGERAKILEL
Ga0066652_10199550823300006046SoilLSHPDPHGPPDLTPIEIGEVWENPVNRERLTILELPWQNPEGRAV
Ga0075417_1055232713300006049Populus RhizosphereMSHPDPNAKPDLTPIQVGEVWEHPVTGERATILELPWTNPEGRVVAEL
Ga0075018_1065988013300006172WatershedsMRHPAPDGPQDRTPIEIGEVWENPVTRERATILERTWDNPAGRVTAELTALV
Ga0070712_10050093413300006175Corn, Switchgrass And Miscanthus RhizosphereMTHPDPNAPPDRTPIQIGEVWENPMTGERATILELP
Ga0097621_10172642923300006237Miscanthus RhizosphereMRDLGANAHPDPIGAPDRRPIKVGEVSENPVTEERSVILERPWDNPASRVTGELTALV
Ga0075021_1003115113300006354WatershedsMSHPDPHVLPDRTAIQIGEVWENPVPRERATIFELPHQNPERRAVAEL
Ga0066653_1055282713300006791SoilMSHPDPHGPPDLTPIQVGEIWENPVTRERATILELPYKNQEGA*
Ga0066665_1026763713300006796SoilMVRMSHPDPHGPPDVTPIQVGEVWENPVTGERATI
Ga0066665_1049193023300006796SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDSPASPRDRRADGTRWRV*
Ga0066659_1032219333300006797SoilMAHPDPNGPPDRRPIKVGEVWENPVTGERLVILERPWDNPA
Ga0075421_10233309613300006845Populus RhizosphereMSHPDPNAKPDLTPIQVGEVWEHPVTGERATILELPWTNPEGRVVA
Ga0075430_10018444433300006846Populus RhizosphereMSMSHSEPHGPPDRTPIRVAGVWENPFMERATILERPWDNAAGRGTAEL
Ga0075434_10133568413300006871Populus RhizosphereMSHPDSRAPPDHTPIQIGEVWENPITRERATILELPHQNPER
Ga0075424_10173671323300006904Populus RhizosphereMSHPDPRAPPDHTPIQIGEVWENPITRERATILELPHQNPE
Ga0079216_1134166513300006918Agricultural SoilVSANKGEILTIARMSHPEPNGPPDRTPVQVGEVWENPITGERATIMERPWDNPAGRGTAELTALVGARVM
Ga0099793_1002207813300007258Vadose Zone SoilMSHSDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDN
Ga0105245_1075896513300009098Miscanthus RhizosphereMRHPDPHGPADRTPIEVGEVWVNPVTCERATILERTWDNPEGRATAELTALVGA
Ga0105243_1202089013300009148Miscanthus RhizosphereMSHPDPNGPPDLTPIRIGEIWENPASREQVRIVELSHSNPERR
Ga0111538_1176405523300009156Populus RhizosphereMSHPDPNGPPDLTPIQVGEVWENPVTRERATILELPFENREGRVTSS*
Ga0075423_1116366323300009162Populus RhizosphereVSHPDPHGPPDLTPIRFGEVLENPVTGERATILELPFTNPEGRA
Ga0116214_136875713300009520Peatlands SoilMSHPDPRGPPDRTPIQVGEVWENPVTRERATILELPYKSHEGRATAELTALV
Ga0105249_1067723713300009553Switchgrass RhizosphereMSHPDPDAAPDLTPIRLGEVWENPYTGERATIRELPFTNPEGRASAELLALFG
Ga0105075_101791113300009799Groundwater SandMSHPDPNGPADLTPIQTGEVWENPVTGERATILEFPHTNPAGRAVAE
Ga0126305_1086385213300010036Serpentine SoilMSHPDPHAPPDRTPIQIGEVWENPITRERSTLLELPQQNPESRLVGELLALVGARLVGEHRHPRI
Ga0126304_1086424523300010037Serpentine SoilMSHPDPHAPPDRTPIQIGEVWENPVTGERSTILEL
Ga0126311_1047395423300010045Serpentine SoilMSHPDPHGPPDLTPIKVGEVWENPVTGERATILELPW
Ga0126370_1254445323300010358Tropical Forest SoilMSHPDPRGAPDLRPIEIGEVWENPITRERAIILELPHQN
Ga0126372_1038834213300010360Tropical Forest SoilMSHPDPYGSEDRTPIQIGEILENPVTGERAKILELPWKNPE
Ga0126372_1223568213300010360Tropical Forest SoilMSHPDPNAAPDLTPIRLGEVWENPVTGERATVRELPFTNPEGRATAELLALY
Ga0126378_1116399623300010361Tropical Forest SoilMSHPNPQAPPDRRPIEIGEVWENPITRERVTILERPWDNE
Ga0126378_1203124833300010361Tropical Forest SoilMSAVRYSVRMSHPNPQAPPDRRPIEIGEVWENPITRERVTILERPWDNE
Ga0126378_1215678213300010361Tropical Forest SoilMRDLGAMSHPDPNGPADRTPIETGEVWDNPVTGER
Ga0126379_1001435613300010366Tropical Forest SoilMSHPDPHGEPDRTPIEVGEVWENPVTRERARLVELPWDNPDGRAAA
Ga0126379_1381726313300010366Tropical Forest SoilMPHPDPHGPPDRTPIKVGEVWENPVTGERATILERPWDNPEGRATAE
Ga0134125_1181482913300010371Terrestrial SoilMSHPDPNGLPDLTPIQAGEVLENPVTRERATVLELPWTNPEGRAVAEMTALVGAR
Ga0136449_10250390813300010379Peatlands SoilMPHPDPDGPPDLTPVHVGEVLENPVTGERATILELPNENPEGRATAEL
Ga0126383_1186987823300010398Tropical Forest SoilMNEDSARVVRMSHPDPNGPPDRTPIRVGEVWENPVNRERITILERCWDNPEGRATAELTALV*
Ga0105246_1090645013300011119Miscanthus RhizosphereMTHPDPNAPPDRTPIQIGEVWENPMTGERATILELPQQNPERR
Ga0137432_121453413300011439SoilMSHPDPNGPPDLKPIQVGELWENPVTRERATILELPFKNPEGRVTAELTALA
Ga0137382_1001048813300012200Vadose Zone SoilNVAPDPNGAPDRRPIKVGEVWVNPVTGERSVILERPWDN*
Ga0137382_1016921213300012200Vadose Zone SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELTALVGA
Ga0137363_1110556513300012202Vadose Zone SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERLVILERLWDNPASRVTGELTALVGAR
Ga0137399_1003811023300012203Vadose Zone SoilMPHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWNN
Ga0137399_1016440613300012203Vadose Zone SoilMSHPDPSGPPNRRPIKVGEVWENPVTGERLVILERPWDNPASRVTGELTALVG
Ga0137399_1024969713300012203Vadose Zone SoilMSHSDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRV
Ga0137399_1026590123300012203Vadose Zone SoilMSHPDPNGPPDRRPIKVGEVWENPVTGERSVILERPWDNPA
Ga0137380_1010675043300012206Vadose Zone SoilWRECRTPTPNGPPDRRPIKLGEVWENPVTGERLVILERPWDNPASRVTGELKHSLARV*
Ga0137380_1135133923300012206Vadose Zone SoilMSHPDPNGQPDLTPIQIGEVWENPVNRERLTILELPWQNPEGRAVDELT
Ga0137376_1021657113300012208Vadose Zone SoilMSHPDPNGAPDRGPIKVGEVWENPVTGERSVILERPWDNPASRVTG*
Ga0137376_1046032513300012208Vadose Zone SoilMSHPDPNGPPERRPIKVGEVWENPVTGERLVILERP
Ga0137376_1054236613300012208Vadose Zone SoilMSHPDPNGPPDRRPIKVGEVWENPVTGERLVILERPRDNPA
Ga0137378_1089397323300012210Vadose Zone SoilMSHPDPHGPPDLTPIQIGEVWENPVNRERLTILELPWQNPEGR
Ga0137377_1041193313300012211Vadose Zone SoilVSHPDPHGPPDLTPIEIGEVWENRVNRERLTILELPWQNPEGRAVDELTAL
Ga0150985_11321380613300012212Avena Fatua RhizosphereMRHPDPHGPADRTPIEVGEVWANPVTRERATILERTWDNPEGRATAELTALV
Ga0137370_1048491423300012285Vadose Zone SoilMSHPDPNGPPDRRPIKVGEVWENPVTGERLVILERPWDNPASRV
Ga0137372_1048433323300012350Vadose Zone SoilMSHPDPHGPPDLTPIEIGEVWENPVNRERLTILELPWQNPEGRAVNEMT
Ga0137369_1044262513300012355Vadose Zone SoilMSHPDPNGQPDFTPIQIGEVWENPVNRERLTILELPWQNP
Ga0137384_1149701323300012357Vadose Zone SoilMSHPDPHGPPDFTPIQIGEIWENRTTGERSTILELPWKNPEGRATAELT
Ga0157320_101566223300012481Arabidopsis RhizosphereVSHPDPNGPPDLRPVRFGEVWENPVTGERATILELPYT
Ga0157288_1029057513300012901SoilMSHPEPLGPADRTPISVGEVWENPISRERATILERP
Ga0137396_1002944073300012918Vadose Zone SoilMSHPDPSGPPNRRPIKVGEVWENPVTGERLVILERPWDNPASRVTGELTAL
Ga0137396_1016544613300012918Vadose Zone SoilNGAPDRRPIKVGEVWENPVTGERLVILERPWDNPASRVKSGTWM*
Ga0137419_1013149133300012925Vadose Zone SoilMSHPDQNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELTALVGA
Ga0137416_1060213713300012927Vadose Zone SoilMSHPDPNGAPDRGPIKVGEVWENPVTGERSVILERPWDNPASRVTG
Ga0137404_1151479413300012929Vadose Zone SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELTALVG
Ga0134110_1043446123300012975Grasslands SoilMSHPDASGPANLTPIQVGEVWENRATGERATILELPHTNPEGRAIAELTAL
Ga0157371_1097970713300013102Corn RhizosphereMGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATILERPWDNPEGRATAEL
Ga0157374_1007471363300013296Miscanthus RhizosphereMRHPDPHGPPDRTPIEVGEVWVNPVTCERATILERTWDNPEGR
Ga0163162_1064828913300013306Switchgrass RhizosphereMNHPDPYGPPDLTPIEIGEVWENPVTRERATILERSWDNPA
Ga0157375_1011986433300013308Miscanthus RhizosphereMRHPDPHGPPDRTPIEVGEVWVNPVTCERATILER
Ga0157375_1337640023300013308Miscanthus RhizosphereVSHPDPDAPPDLTPIRVGEVWENPVTRERATILELPAQN
Ga0134078_1061354323300014157Grasslands SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWD
Ga0181526_1040630823300014200BogVRVSHPDPNGPADLTPIRVGEAFENPATRERAIVLELPHMNAQG
Ga0180076_108293713300014867SoilMAHPDPNAPPDLRPIQAGEVWENPVNRERAIVLEV
Ga0157379_1006335713300014968Switchgrass RhizosphereMGRLSHPDPHGPPDRTPIEVGEVWENPVTKERATILE
Ga0137411_137007933300015052Vadose Zone SoilMSHPDPNGAPDRNHKKVGEVWENHVTGERSVILDVLGQPASRVTGG*
Ga0182041_1185569323300016294SoilMSHPDAHAPPDRTPIQIGEVWENPITRERATILELPDQNPERRVVGELLALAGARVVEHR
Ga0182038_1185473523300016445SoilMSHPAPDGPPDRTPIKVGEVWVNPVNRERFTILERFWDNPQGRATAELTALVGARVVG
Ga0187785_1035900913300017947Tropical PeatlandMSHPDPNAPPDTTPIQAGEVWENPITRERATLLELPNHNPE
Ga0187778_1020882713300017961Tropical PeatlandVRHPEPNGPSDRRPIKVGEVWENPVTRERATILEL
Ga0187780_1091733213300017973Tropical PeatlandMSHPNPQAPPDRRPIEIGEVWENPITRERVTILERPWDNEA
Ga0190270_1251040213300018469SoilVSHPDPSAPADRRAIEPGEVWENPVTGERAVIVELP
Ga0173479_1038539313300019362SoilMSHPEPLGPADRTPISVGEVWENPISRERATFLERPWDN
Ga0190264_1028503633300019377SoilMLHPDPHAPPDRTPIQIGEVWENPITREQATVLELPHHNPERRVVAELLARA
Ga0210396_1015102913300021180SoilMSHPDPNGPPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGEL
Ga0210396_1074102523300021180SoilMWHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNP
Ga0210384_1005626023300021432SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELSTRWRAARV
Ga0210409_1000955013300021559SoilMSYPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNP
Ga0210409_1014538313300021559SoilMSHPDPNGPPDRRPIKVGEVWENPVTGERSVILERPWDNPASLRDRRAD
Ga0126371_1384219313300021560Tropical Forest SoilMSHPDPHGPADRSPIQVGEIWENPVTRERARILELPYRNPEGRATAELT
Ga0247695_106158613300024179SoilMKMAQTSHPEPDGAPDRTPVEVGELWENPVTRERVTILERPWDNPVGRAT
Ga0179589_1029597113300024288Vadose Zone SoilMSHPDANGAPDRRPIKVGEVWENPVTGERSVILERPWD
Ga0207933_109078933300025679Arctic Peat SoilMSHPDPNAPPDLNPIRVGEIFENPVTRERATILELPHTNPESRATAELT
Ga0207682_1026550613300025893Miscanthus RhizosphereMRHPDPHGPPDRTPIEVGEVWVNPVTRERATILERTWDNPAGR
Ga0207695_1154386413300025913Corn RhizosphereMSHPDPHKPPDRTPIQIGEVWENPITRERATILEL
Ga0207700_1084702623300025928Corn, Switchgrass And Miscanthus RhizosphereMSHPDPNGPPDLTPIEAGEVLENPITRERATVLELPWTNPEGRAVAEMTAL
Ga0207670_1104060113300025936Switchgrass RhizosphereMSHPDPDAAPDLTPIRLGEVWENPVTGERATIRELPF
Ga0207704_1093137713300025938Miscanthus RhizosphereMVVRVSHPDPNGLADVTPIEVGEVWENPVSGERATILELPQANRDGRCVVELTA
Ga0207658_1105560913300025986Switchgrass RhizosphereMVVRVSHPDPNGLADVTPIEVGEVWENPVSGERATILELPQANRDGRCVVEL
Ga0207658_1160202713300025986Switchgrass RhizosphereMGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATI
Ga0207678_1024777123300026067Corn RhizosphereMRHPDPHGPPDRTPIEVGEIWVNPVTRERATILERTWDNPAGRATAELTALV
Ga0209801_105135723300026326SoilMSHSDPNGAPDRRPIRVGEVWENPVTGERSVILERPWDNPASRVTGE
Ga0209802_112951423300026328SoilMSHPDPNGSPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTG
Ga0209056_1051589223300026538SoilMSHSDPNGAPDRRPIRVGEVWENPVTGERSVILERPWDNPASRVTGELKCFSSV
Ga0209161_1051158713300026548SoilMSHPDPHGPPDFTPIQIGEIWENPATGERATILELP
Ga0209214_100687813300027071Forest SoilMSHPDPNGAPDRRPIKVGEVWEDPVTGERSVILERPWDNAAS
Ga0209523_108602723300027548Forest SoilMNTVRNSHPDPDAPVDRTPVQVGELWENPITKERVTILERP
Ga0209220_115131613300027587Forest SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILEGPWDNPASRVTGELTALVARV
Ga0209689_113005823300027748SoilMSHPDPNGSPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELTA
Ga0209798_1035699533300027843Wetland SedimentMSHPDPHGQPDRTPIAVGEIWENPVTRERARILERPG
Ga0209068_1051997723300027894WatershedsMRHPDPHGPPDRTPIEVGEVWVNPVTRERATILERTW
Ga0137415_1105339723300028536Vadose Zone SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPAS
Ga0265326_1004410713300028558RhizosphereVSHPDPNGPPDLRPIEAGEIWENPATGERATILEAPWHN
Ga0247828_1092250713300028587SoilMSHPDPNGPADTRPITAGEVWENPVSGEHAILVELPYAHLD
Ga0247822_1175043213300028592SoilMGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATILERPW
Ga0247827_1077885223300028889SoilMGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATILERPWDNPEGRAP
Ga0311340_1090459323300029943PalsaVSHPDPNGPPDLTPIQVGDMLEHPVTGERATTLELPW
Ga0311338_1138840523300030007PalsaVSHPDPNGPPDLTPIQVGDMLEHPVTGERATTLELPWKNPEGRASAELTALVG
Ga0311338_1188117623300030007PalsaMICRMSHPDPNGPPDLTPIHEGEIFENPLTRERATILELPTSNPEERAV
Ga0247826_1176093333300030336SoilMSHPDPNGPADTRPITAGEVWENPVSGEHAILVELPYAHLDGHCV
Ga0302184_1025254713300030490PalsaMSHPDPNAPPDLTPIQPGEVWTNPVTRERAVLLEFPTENADGR
Ga0311355_1062927433300030580PalsaVAHPDPNGPADLTPLQIGEVWENPVTRERATLLEFPNKNPEGRASAELTALV
Ga0302311_1049912033300030739PalsaVAHPDPNGPADLTPLQIGEVWENPVTRERATLLEFPNKNPEGRASAEL
Ga0170824_11054164343300031231Forest SoilMSHPDPNGAPDRRPIKVGEVWENPITGERSVILERPWDNPASRVTGGTEEGTP
Ga0247727_1072356633300031576BiofilmMSHPDPNGPADLTSIQIGEVWENPVTRERATILELPYTNPAGSV
Ga0318555_1071344423300031640SoilMSHPDPDGPPDLTPIRAGEVWENPVTGERGTILELPTEN
Ga0265342_1050299323300031712RhizosphereVSHPDPNGPPDLRPIEAGEIWENPATGERATILEAPWHNPEERGV
Ga0306917_1077600313300031719SoilMSHPAPDGPPDRTPIKVGEVWVNPVNRERFTILERFWDNPQGRATAELTALVGARVVGE
Ga0318502_1068305213300031747SoilMSHPDPNGAPDLRPIHVGEVWENPVTRERATVLELPY
Ga0307477_1004912913300031753Hardwood Forest SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILEG
Ga0307475_1004863513300031754Hardwood Forest SoilMSHPDPNGAPDRRPIKVGEVWENPVTGERSVILERPWDNPASRVTGELT
Ga0318521_1103589123300031770SoilMSHPDPHGPSDRTPIDVGEIWENPVTGERATILERPWD
Ga0318552_1055696113300031782SoilMSHPDPSGPPDLTPIRRGEVWENPVTGERGTILELPTDN
Ga0306925_1180260413300031890SoilMSHPDPHGSPDRTPIKVGEVWENPVTRERATILERPWDNPAGRATAELT
Ga0310900_1111931123300031908SoilMSHPEPLVAADRTPIAAGEVWENPITKERATIVERPWDNPE
Ga0310909_1079219413300031947SoilMSHPAPDGPPDRTPIKVGEVWVNPVNRERFTILERFWDNPQGRATAELTALVGARV
Ga0306926_1296376313300031954SoilMSHPDAYAPPDRTPIQIGEVWENPMTGERATILELPHQNPERRV
Ga0306922_1235797913300032001SoilMQESGRMPRPDPNGPADRRPIKVGEVWENPATGER
Ga0310897_1007001413300032003SoilMGRLSHPDPHGPPDRTPIEVGEVWENPVTRERATILERPWDNPEGR
Ga0318549_1054041013300032041SoilMRHPEPQGPPDRRTIEVGEVWENPVTGERASILERPWDNPASRVTAE
Ga0311301_1048020413300032160Peatlands SoilMSHPDPRGPPDRTPIQVGEVWENPVTRERATILELPYKNHEGRATAEL
Ga0307471_10280538813300032180Hardwood Forest SoilMSHPDPNGPPDRTPRKVGEVWENPVTGERATILERPWDNPAGRA
Ga0335080_1066245213300032828SoilMRNDRMSHPDPDAPLDRTPLQVGELWENPITKERVTILERPWDN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.