Metagenome Family F032488

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F032488
Family Type	Metagenome
Number of Sequences	180
Average Sequence Length	39 residues
Representative Sequence	GMGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP
Number of Associated Samples	72
Number of Associated Scaffolds	180

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	34.44 %
% of genes near scaffold ends (potentially truncated)	68.33 %
% of genes from short scaffolds (< 2000 bps)	78.33 %
Associated GOLD sequencing projects	64
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (75.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (28.889 % of family members)
Environment Ontology (ENVO)	Unclassified (30.556 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (37.778 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 180 Family Scaffolds
PF01979	Amidohydro_1	2.22
PF07075	DUF1343	2.22
PF02737	3HCDH_N	2.22
PF02771	Acyl-CoA_dh_N	1.67
PF06071	YchF-GTPase_C	1.67
PF00005	ABC_tran	1.67
PF01668	SmpB	1.67
PF01713	Smr	1.67
PF12706	Lactamase_B_2	1.67
PF01926	MMR_HSR1	1.67
PF01380	SIS	1.67
PF02662	FlpD	1.67
PF00202	Aminotran_3	1.67
PF00970	FAD_binding_6	1.11
PF09339	HTH_IclR	1.11
PF13193	AMP-binding_C	1.11
PF04055	Radical_SAM	1.11
PF09936	Methyltrn_RNA_4	1.11
PF04187	Cofac_haem_bdg	1.11
PF03547	Mem_trans	1.11
PF00465	Fe-ADH	1.11
PF13742	tRNA_anti_2	1.11
PF07883	Cupin_2	1.11
PF08240	ADH_N	1.11
PF01464	SLT	1.11
PF05524	PEP-utilisers_N	1.11
PF04879	Molybdop_Fe4S4	1.11
PF00266	Aminotran_5	1.11
PF01261	AP_endonuc_2	1.11
PF00701	DHDPS	1.11
PF13421	Band_7_1	0.56
PF14691	Fer4_20	0.56
PF02545	Maf	0.56
PF00380	Ribosomal_S9	0.56
PF12390	Se-cys_synth_N	0.56
PF03054	tRNA_Me_trans	0.56
PF06808	DctM	0.56
PF01850	PIN	0.56
PF04008	Adenosine_kin	0.56
PF06792	UPF0261	0.56
PF01161	PBP	0.56
PF09723	Zn-ribbon_8	0.56
PF12646	DUF3783	0.56
PF01245	Ribosomal_L19	0.56
PF00572	Ribosomal_L13	0.56
PF00291	PALP	0.56
PF10050	DUF2284	0.56
PF00171	Aldedh	0.56
PF00085	Thioredoxin	0.56
PF03358	FMN_red	0.56
PF01121	CoaE	0.56
PF06245	DUF1015	0.56
PF13336	AcetylCoA_hyd_C	0.56
PF13183	Fer4_8	0.56
PF01746	tRNA_m1G_MT	0.56
PF01451	LMWPc	0.56
PF13549	ATP-grasp_5	0.56
PF07238	PilZ	0.56
PF08349	DUF1722	0.56
PF03446	NAD_binding_2	0.56
PF01653	DNA_ligase_aden	0.56
PF09861	Lar_N	0.56
PF00384	Molybdopterin	0.56
PF02353	CMAS	0.56
PF01855	POR_N	0.56
PF02769	AIRS_C	0.56
PF13237	Fer4_10	0.56
PF00300	His_Phos_1	0.56
PF00459	Inositol_P	0.56
PF00226	DnaJ	0.56
PF00072	Response_reg	0.56
PF16697	Yop-YscD_cpl	0.56
PF01882	DUF58	0.56
PF00365	PFK	0.56
PF01963	TraB_PrgY_gumN	0.56
PF02954	HTH_8	0.56
PF00528	BPD_transp_1	0.56
PF13361	UvrD_C	0.56
PF13304	AAA_21	0.56
PF13607	Succ_CoA_lig	0.56
PF12849	PBP_like_2	0.56
PF00753	Lactamase_B	0.56
PF04073	tRNA_edit	0.56
PF07690	MFS_1	0.56
PF00106	adh_short	0.56
PF05402	PqqD	0.56
PF03449	GreA_GreB_N	0.56
PF02538	Hydantoinase_B	0.56
PF01042	Ribonuc_L-PSP	0.56
PF00892	EamA	0.56
PF01609	DDE_Tnp_1	0.56
PF04191	PEMT	0.56
PF00589	Phage_integrase	0.56
PF06271	RDD	0.56
PF05167	DUF711	0.56
PF04015	DUF362	0.56
PF00482	T2SSF	0.56
PF10282	Lactonase	0.56
PF02881	SRP54_N	0.56
PF00069	Pkinase	0.56
PF05973	Gp49	0.56
PF02913	FAD-oxidase_C	0.56
PF00278	Orn_DAP_Arg_deC	0.56

COG ID	Name	Functional Category	% Frequency in 180 Family Scaffolds
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	2.22
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	2.22
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	2.22
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.22
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	2.22
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	2.22
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	2.22
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	2.22
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	2.22
COG3876	Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family	Cell wall/membrane/envelope biogenesis [M]	2.22
COG0012	Ribosome-binding ATPase YchF, GTP1/OBG family	Translation, ribosomal structure and biogenesis [J]	1.67
COG0691	tmRNA-binding protein	Posttranslational modification, protein turnover, chaperones [O]	1.67
COG1908	Coenzyme F420-reducing hydrogenase, delta subunit	Energy production and conversion [C]	1.67
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	1.67
COG0146	N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit	Amino acid transport and metabolism [E]	1.11
COG0337	3-dehydroquinate synthetase	Amino acid transport and metabolism [E]	1.11
COG0371	Glycerol dehydrogenase or related enzyme, iron-containing ADH family	Energy production and conversion [C]	1.11
COG0679	Predicted permease, AEC (auxin efflux carrier) family	General function prediction only [R]	1.11
COG1454	Alcohol dehydrogenase, class IV	Energy production and conversion [C]	1.11
COG1979	Alcohol dehydrogenase YqhD, Fe-dependent ADH family	Energy production and conversion [C]	1.11
COG3016	Putative heme-binding protein PhuW	General function prediction only [R]	1.11
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.56
COG0019	Diaminopimelate decarboxylase	Amino acid transport and metabolism [E]	0.56
COG0102	Ribosomal protein L13	Translation, ribosomal structure and biogenesis [J]	0.56
COG0103	Ribosomal protein S9	Translation, ribosomal structure and biogenesis [J]	0.56
COG0205	6-phosphofructokinase	Carbohydrate transport and metabolism [G]	0.56
COG0237	Dephospho-CoA kinase	Coenzyme transport and metabolism [H]	0.56
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.56
COG0272	NAD-dependent DNA ligase	Replication, recombination and repair [L]	0.56
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.56
COG0335	Ribosomal protein L19	Translation, ribosomal structure and biogenesis [J]	0.56
COG0424	7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.56
COG0482	tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain	Translation, ribosomal structure and biogenesis [J]	0.56
COG0674	Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.56
COG0782	Transcription elongation factor, GreA/GreB family	Transcription [K]	0.56
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.56
COG1166	Arginine decarboxylase (spermidine biosynthesis)	Amino acid transport and metabolism [E]	0.56
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	0.56
COG1721	Uncharacterized conserved protein, DUF58 family, contains vWF domain	Function unknown [S]	0.56
COG1839	Adenosine/AMP kinase	Nucleotide transport and metabolism [F]	0.56
COG1881	Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family	General function prediction only [R]	0.56
COG1916	Pheromone shutdown protein TraB, contains GTxH motif (function unknown)	Function unknown [S]	0.56
COG2006	Uncharacterized conserved protein, DUF362 family	Function unknown [S]	0.56
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.56
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	0.56
COG2230	Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases	Lipid transport and metabolism [I]	0.56
COG2848	Uncharacterized conserved protein, UPF0210 family	Cell cycle control, cell division, chromosome partitioning [D]	0.56
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.56
COG3272	Uncharacterized conserved protein YbgA, DUF1722 family	Function unknown [S]	0.56
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.56
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.56
COG3657	Putative component of the toxin-antitoxin plasmid stabilization module	Defense mechanisms [V]	0.56
COG4198	Uncharacterized conserved protein, DUF1015 family	Function unknown [S]	0.56
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.56
COG4231	TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.56
COG4679	Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system	Defense mechanisms [V]	0.56
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.56
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.56
COG5441	ATP-binding helicase-inhibiting domain, Tm-1/UPF0261 family	Defense mechanisms [V]	0.56
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.56

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	75.00 %
Unclassified	root	N/A	25.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	75.00 %
Unclassified	root	N/A	25.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	75.00 %
Unclassified	root	N/A	25.00 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	49.44 %
Unclassified	root	N/A	25.00 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.56 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.56 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.56 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	42.78 %
Unclassified	root	N/A	25.00 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.56 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.56 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.56 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.56 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	42.78 %
Unclassified	root	N/A	25.00 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.56 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.56 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.56 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.00 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	16.67 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	4.44 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	1.11 %
unclassified candidate division NC10	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10	0.56 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.56 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.56 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.00 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	10.56 %
unclassified Desulfobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales	3.89 %
delta proteobacterium NaphS2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	2.22 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.11 %
Deltaproteobacteria bacterium SG8_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	0.56 %
Deltaproteobacteria bacterium ADurb.BinA179	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.BinA179	0.56 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	0.56 %
unclassified Nitrospiraceae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae	0.56 %
candidate division NC10 bacterium RBG_16_65_8	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium RBG_16_65_8	0.56 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.56 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.00 %
unclassified Desulfobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae	3.33 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	3.89 %
Desulfatiglans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans	2.22 %
Desulfosarcina	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina	2.22 %
delta proteobacterium NaphS2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	2.22 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.11 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.56 %
Desulfomonile	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile	0.56 %
Deltaproteobacteria bacterium SG8_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	0.56 %
Deltaproteobacteria bacterium ADurb.BinA179	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.BinA179	0.56 %
candidate division NC10 bacterium RBG_16_65_8	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium RBG_16_65_8	0.56 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.56 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.00 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	3.33 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	3.89 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	2.22 %
delta proteobacterium NaphS2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	2.22 %
Desulfosarcina variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis	1.67 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.11 %
Desulfosarcina ovata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata	0.56 %
Desulfomonile tiedjei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei	0.56 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.56 %
Deltaproteobacteria bacterium SG8_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	0.56 %
Deltaproteobacteria bacterium ADurb.BinA179	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.BinA179	0.56 %
candidate division NC10 bacterium RBG_16_65_8	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium RBG_16_65_8	0.56 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.56 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.00 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	3.33 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	3.89 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	2.22 %
delta proteobacterium NaphS2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	2.22 %
Desulfosarcina variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis	1.67 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.11 %
Desulfomonile tiedjei DSM 6799	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei → Desulfomonile tiedjei DSM 6799	0.56 %
Desulfosarcina ovata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata	0.56 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.56 %
Deltaproteobacteria bacterium SG8_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	0.56 %
Deltaproteobacteria bacterium ADurb.BinA179	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.BinA179	0.56 %
candidate division NC10 bacterium RBG_16_65_8	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium RBG_16_65_8	0.56 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.56 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000231\|TB_LI09_4DRAFT_10002197	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	9432	Open in IMG/M
3300000231\|TB_LI09_4DRAFT_10002996	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	8217	Open in IMG/M
3300000231\|TB_LI09_4DRAFT_10007664	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	5140	Open in IMG/M
3300000231\|TB_LI09_4DRAFT_10009472	All Organisms → cellular organisms → Bacteria	4595	Open in IMG/M
3300000231\|TB_LI09_4DRAFT_10105267	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	1022	Open in IMG/M
3300000231\|TB_LI09_4DRAFT_10163771	Not Available	743	Open in IMG/M
3300001213\|JGIcombinedJ13530_108233766	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	558	Open in IMG/M
3300001371\|BBDRAFT_10418547	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300001371\|BBDRAFT_10444401	Not Available	571	Open in IMG/M
3300003541\|JGI20214J51650_11090757	Not Available	556	Open in IMG/M
3300003858\|Ga0031656_10011972	All Organisms → cellular organisms → Bacteria	3631	Open in IMG/M
3300003858\|Ga0031656_10068995	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	1350	Open in IMG/M
3300003858\|Ga0031656_10206451	All Organisms → cellular organisms → Bacteria → Proteobacteria	673	Open in IMG/M
3300003859\|Ga0031653_10078929	All Organisms → cellular organisms → Bacteria → Proteobacteria	869	Open in IMG/M
3300004048\|Ga0055494_10161208	All Organisms → cellular organisms → Bacteria → Proteobacteria	523	Open in IMG/M
3300004072\|Ga0055512_10158643	All Organisms → cellular organisms → Bacteria → Proteobacteria	500	Open in IMG/M
3300004146\|Ga0055495_10010388	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	1434	Open in IMG/M
3300005254\|Ga0068714_10131690	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1162	Open in IMG/M
3300005832\|Ga0074469_10047728	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	4652	Open in IMG/M
3300005832\|Ga0074469_10185021	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	85293	Open in IMG/M
3300005832\|Ga0074469_10283077	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	59595	Open in IMG/M
3300005832\|Ga0074469_10554715	All Organisms → cellular organisms → Bacteria	1998	Open in IMG/M
3300005832\|Ga0074469_10878184	All Organisms → cellular organisms → Bacteria	2517	Open in IMG/M
3300005832\|Ga0074469_11101413	All Organisms → cellular organisms → Bacteria → Proteobacteria	5963	Open in IMG/M
3300005832\|Ga0074469_11160845	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	5649	Open in IMG/M
3300006224\|Ga0079037_100000789	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	15338	Open in IMG/M
3300006224\|Ga0079037_100009606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6196	Open in IMG/M
3300006224\|Ga0079037_100031117	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis	3947	Open in IMG/M
3300006224\|Ga0079037_100056614	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	3098	Open in IMG/M
3300006224\|Ga0079037_100191038	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1830	Open in IMG/M
3300006224\|Ga0079037_100303934	All Organisms → cellular organisms → Bacteria	1480	Open in IMG/M
3300006224\|Ga0079037_100410119	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	1284	Open in IMG/M
3300006224\|Ga0079037_100545866	All Organisms → cellular organisms → Bacteria	1118	Open in IMG/M
3300006224\|Ga0079037_100618905	Not Available	1051	Open in IMG/M
3300006224\|Ga0079037_100637291	All Organisms → cellular organisms → Bacteria	1036	Open in IMG/M
3300006224\|Ga0079037_100704133	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	986	Open in IMG/M
3300006224\|Ga0079037_100759059	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	950	Open in IMG/M
3300006224\|Ga0079037_100843342	All Organisms → cellular organisms → Bacteria	901	Open in IMG/M
3300006224\|Ga0079037_100898259	All Organisms → cellular organisms → Bacteria	873	Open in IMG/M
3300006224\|Ga0079037_100974384	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300006224\|Ga0079037_101027027	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	816	Open in IMG/M
3300006224\|Ga0079037_101219022	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300006224\|Ga0079037_101295067	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	725	Open in IMG/M
3300006224\|Ga0079037_101371313	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	704	Open in IMG/M
3300006224\|Ga0079037_101390191	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	699	Open in IMG/M
3300006224\|Ga0079037_101398295	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300006224\|Ga0079037_101434694	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300006224\|Ga0079037_101615273	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	647	Open in IMG/M
3300006224\|Ga0079037_101630092	Not Available	644	Open in IMG/M
3300006224\|Ga0079037_101813199	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	609	Open in IMG/M
3300006224\|Ga0079037_101854604	Not Available	602	Open in IMG/M
3300006224\|Ga0079037_101915290	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300006224\|Ga0079037_101926910	Not Available	591	Open in IMG/M
3300006224\|Ga0079037_102203420	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	550	Open in IMG/M
3300006224\|Ga0079037_102372289	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	529	Open in IMG/M
3300006224\|Ga0079037_102398489	Not Available	526	Open in IMG/M
3300006224\|Ga0079037_102441236	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	521	Open in IMG/M
3300006224\|Ga0079037_102476331	Not Available	517	Open in IMG/M
3300006930\|Ga0079303_10010117	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2807	Open in IMG/M
3300006930\|Ga0079303_10024748	All Organisms → cellular organisms → Bacteria	1967	Open in IMG/M
3300006930\|Ga0079303_10038775	All Organisms → cellular organisms → Bacteria	1639	Open in IMG/M
3300006930\|Ga0079303_10087714	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1158	Open in IMG/M
3300006930\|Ga0079303_10159278	Not Available	886	Open in IMG/M
3300006930\|Ga0079303_10348774	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	620	Open in IMG/M
3300006930\|Ga0079303_10358773	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	612	Open in IMG/M
3300006930\|Ga0079303_10398747	Not Available	583	Open in IMG/M
3300007072\|Ga0073932_1002810	All Organisms → cellular organisms → Bacteria → Proteobacteria	25496	Open in IMG/M
3300007072\|Ga0073932_1004518	All Organisms → cellular organisms → Bacteria	16375	Open in IMG/M
3300009078\|Ga0105106_10027625	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4191	Open in IMG/M
3300009078\|Ga0105106_10775172	Not Available	684	Open in IMG/M
3300009082\|Ga0105099_10215113	Not Available	1104	Open in IMG/M
3300009091\|Ga0102851_10496259	Not Available	1254	Open in IMG/M
3300009091\|Ga0102851_12451767	Not Available	596	Open in IMG/M
3300009111\|Ga0115026_10048886	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2324	Open in IMG/M
3300009111\|Ga0115026_10368816	Not Available	1030	Open in IMG/M
3300009131\|Ga0115027_10254544	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1154	Open in IMG/M
3300009131\|Ga0115027_10714742	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	753	Open in IMG/M
3300009153\|Ga0105094_10106677	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1583	Open in IMG/M
3300009166\|Ga0105100_10045237	All Organisms → cellular organisms → Bacteria	2554	Open in IMG/M
3300009166\|Ga0105100_10494206	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata	745	Open in IMG/M
3300009166\|Ga0105100_10494250	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	745	Open in IMG/M
3300009167\|Ga0113563_10038769	All Organisms → cellular organisms → Bacteria	3898	Open in IMG/M
3300009167\|Ga0113563_11081259	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	928	Open in IMG/M
3300009179\|Ga0115028_10034920	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	2384	Open in IMG/M
3300009179\|Ga0115028_10076061	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	1811	Open in IMG/M
3300009179\|Ga0115028_10080059	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1778	Open in IMG/M
3300009179\|Ga0115028_11156201	Not Available	634	Open in IMG/M
3300010413\|Ga0136851_10469620	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	1258	Open in IMG/M
3300011340\|Ga0151652_12040042	All Organisms → cellular organisms → Bacteria	1072	Open in IMG/M
3300014313\|Ga0075347_1028829	All Organisms → cellular organisms → Bacteria	1072	Open in IMG/M
3300014315\|Ga0075350_1029111	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1098	Open in IMG/M
3300014319\|Ga0075348_1082189	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	788	Open in IMG/M
3300018068\|Ga0184636_1118380	Not Available	917	Open in IMG/M
3300018070\|Ga0184631_10150354	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300025950\|Ga0210134_1004150	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	2157	Open in IMG/M
3300025950\|Ga0210134_1015905	Not Available	1059	Open in IMG/M
3300025958\|Ga0210069_1011954	All Organisms → cellular organisms → Bacteria	1159	Open in IMG/M
3300025968\|Ga0210103_1010501	All Organisms → cellular organisms → Bacteria → Proteobacteria	1646	Open in IMG/M
3300026477\|Ga0256807_1061680	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	638	Open in IMG/M
3300026501\|Ga0256806_1000321	All Organisms → cellular organisms → Bacteria	4954	Open in IMG/M
3300026501\|Ga0256806_1001553	All Organisms → cellular organisms → Bacteria	2970	Open in IMG/M
3300027715\|Ga0208665_10112905	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300027721\|Ga0209492_1155671	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	796	Open in IMG/M
3300027811\|Ga0256868_10069709	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	1591	Open in IMG/M
3300027871\|Ga0209397_10111833	All Organisms → cellular organisms → Bacteria	1162	Open in IMG/M
3300027871\|Ga0209397_10335175	Not Available	730	Open in IMG/M
3300027877\|Ga0209293_10079977	All Organisms → cellular organisms → Bacteria	1431	Open in IMG/M
3300027877\|Ga0209293_10252047	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	884	Open in IMG/M
3300027890\|Ga0209496_10551478	Not Available	618	Open in IMG/M
3300027899\|Ga0209668_10478964	Not Available	823	Open in IMG/M
3300027900\|Ga0209253_10091558	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2497	Open in IMG/M
3300027900\|Ga0209253_10228713	All Organisms → cellular organisms → Bacteria → Proteobacteria	1472	Open in IMG/M
3300030613\|Ga0299915_10164609	Not Available	1584	Open in IMG/M
3300031834\|Ga0315290_10802307	Not Available	805	Open in IMG/M
3300031873\|Ga0315297_11601800	Not Available	523	Open in IMG/M
3300032143\|Ga0315292_10414289	Not Available	1132	Open in IMG/M
3300032143\|Ga0315292_11608580	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300032156\|Ga0315295_10500404	Not Available	1235	Open in IMG/M
3300032163\|Ga0315281_11382972	Not Available	694	Open in IMG/M
3300032164\|Ga0315283_12482252	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	502	Open in IMG/M
3300032177\|Ga0315276_10385462	All Organisms → cellular organisms → Bacteria	1499	Open in IMG/M
3300032177\|Ga0315276_10834101	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	985	Open in IMG/M
3300032177\|Ga0315276_11603781	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	674	Open in IMG/M
3300032342\|Ga0315286_11171777	All Organisms → cellular organisms → Bacteria	753	Open in IMG/M
3300032397\|Ga0315287_12172298	Not Available	606	Open in IMG/M
3300032516\|Ga0315273_10173594	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	2953	Open in IMG/M
3300032516\|Ga0315273_10719815	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1309	Open in IMG/M
3300033406\|Ga0316604_10056629	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis	2016	Open in IMG/M
3300033406\|Ga0316604_10153243	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1233	Open in IMG/M
3300033406\|Ga0316604_10167597	All Organisms → cellular organisms → Bacteria	1178	Open in IMG/M
3300033406\|Ga0316604_10697281	Not Available	558	Open in IMG/M
3300033408\|Ga0316605_10051511	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2920	Open in IMG/M
3300033408\|Ga0316605_10172949	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1784	Open in IMG/M
3300033408\|Ga0316605_10536553	All Organisms → cellular organisms → Bacteria	1083	Open in IMG/M
3300033408\|Ga0316605_11137172	All Organisms → cellular organisms → Bacteria → Proteobacteria	753	Open in IMG/M
3300033413\|Ga0316603_10248425	All Organisms → cellular organisms → Bacteria → Proteobacteria	1544	Open in IMG/M
3300033413\|Ga0316603_10463410	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	1157	Open in IMG/M
3300033413\|Ga0316603_10641432	Not Available	988	Open in IMG/M
3300033413\|Ga0316603_11698066	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300033413\|Ga0316603_12339616	All Organisms → cellular organisms → Bacteria → Proteobacteria	503	Open in IMG/M
3300033414\|Ga0316619_10158645	All Organisms → cellular organisms → Bacteria	1568	Open in IMG/M
3300033414\|Ga0316619_10306801	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	1213	Open in IMG/M
3300033414\|Ga0316619_10537798	Not Available	959	Open in IMG/M
3300033414\|Ga0316619_11383891	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	627	Open in IMG/M
3300033416\|Ga0316622_101249328	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300033416\|Ga0316622_101321940	Not Available	843	Open in IMG/M
3300033418\|Ga0316625_101877607	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	584	Open in IMG/M
3300033419\|Ga0316601_100000517	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	16761	Open in IMG/M
3300033419\|Ga0316601_100662989	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1020	Open in IMG/M
3300033419\|Ga0316601_101060548	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	810	Open in IMG/M
3300033419\|Ga0316601_101245884	Not Available	746	Open in IMG/M
3300033433\|Ga0326726_12269171	Not Available	527	Open in IMG/M
3300033434\|Ga0316613_10099788	All Organisms → cellular organisms → Bacteria	1767	Open in IMG/M
3300033480\|Ga0316620_10039077	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3118	Open in IMG/M
3300033480\|Ga0316620_10902553	Not Available	854	Open in IMG/M
3300033480\|Ga0316620_10950230	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	833	Open in IMG/M
3300033481\|Ga0316600_11006239	Not Available	590	Open in IMG/M
3300033483\|Ga0316629_10011849	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis	3338	Open in IMG/M
3300033485\|Ga0316626_10570579	All Organisms → cellular organisms → Bacteria	972	Open in IMG/M
3300033487\|Ga0316630_10023447	All Organisms → cellular organisms → Bacteria	3408	Open in IMG/M
3300033487\|Ga0316630_10116206	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1826	Open in IMG/M
3300033487\|Ga0316630_10171473	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	1561	Open in IMG/M
3300033487\|Ga0316630_10363281	Not Available	1141	Open in IMG/M
3300033487\|Ga0316630_10919860	Not Available	759	Open in IMG/M
3300033493\|Ga0316631_10073146	All Organisms → cellular organisms → Bacteria	1161	Open in IMG/M
3300033493\|Ga0316631_10181247	Not Available	800	Open in IMG/M
3300033493\|Ga0316631_10206752	Not Available	756	Open in IMG/M
3300033513\|Ga0316628_100138457	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2824	Open in IMG/M
3300033513\|Ga0316628_100199134	All Organisms → cellular organisms → Bacteria	2404	Open in IMG/M
3300033513\|Ga0316628_102328916	Not Available	709	Open in IMG/M
3300033513\|Ga0316628_102425123	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei → Desulfomonile tiedjei DSM 6799	693	Open in IMG/M
3300033513\|Ga0316628_103907466	Not Available	533	Open in IMG/M
3300033521\|Ga0316616_100033675	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3714	Open in IMG/M
3300033521\|Ga0316616_100155765	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2176	Open in IMG/M
3300033521\|Ga0316616_101052445	All Organisms → cellular organisms → Bacteria	1020	Open in IMG/M
3300033521\|Ga0316616_101541447	Not Available	863	Open in IMG/M
3300033521\|Ga0316616_102848864	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium RBG_16_65_8	651	Open in IMG/M
3300033557\|Ga0316617_100105119	Not Available	2006	Open in IMG/M
3300033557\|Ga0316617_101178126	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	759	Open in IMG/M
3300033557\|Ga0316617_102026384	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.BinA179	591	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.44%
Engineered	Engineered	0.56%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	62.22%
Terrestrial	Environmental → Terrestrial	37.22%
Lab Enrichment	Engineered → Lab Enrichment	0.56%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	49.44%
Soil	Environmental → Terrestrial → Soil	31.67%
Marine	Environmental → Aquatic → Marine	6.11%
Sediment	Environmental → Aquatic → Sediment	5.56%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	5.00%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.11%
Peat	Environmental → Terrestrial → Peat	0.56%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.56%

Habitat	Taxonomy	Distribution
Wetlands	Environmental → Terrestrial → Soil → Wetlands	30.56%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	22.78%
Sediment	Environmental → Aquatic → Freshwater → Sediment	11.67%
Lake	Environmental → Aquatic → Freshwater → Lake	7.78%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.56%
Wetlands	Environmental → Aquatic → Marine → Wetlands	5.00%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	5.00%
Lentic	Environmental → Aquatic → Freshwater → Lentic	3.89%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	3.33%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.11%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	1.11%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.11%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.56%
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	30.56%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	20.56%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	11.67%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	7.78%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.56%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	5.00%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	3.89%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	3.89%
Cave Water	Environmental → Aquatic → Freshwater → Groundwater → Cave Water	3.33%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	2.22%
Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Sediment	1.11%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	1.11%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	1.11%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.11%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.56%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	0.56%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	28.89%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	20.56%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	7.78%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	7.22%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	5.00%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	4.44%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	3.89%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	3.89%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	3.89%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater	3.33%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	1.67%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.67%
Marine Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine	1.11%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	1.11%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	1.11%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.11%
Wetland	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland	0.56%
Mangrove Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment	0.56%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.56%
Enrichment Culture	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture	0.56%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000231	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001371	Baker-B-sed	Environmental	Open in IMG/M
3300003541	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental	Open in IMG/M
3300003858	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI	Environmental	Open in IMG/M
3300003859	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR	Environmental	Open in IMG/M
3300004048	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2	Environmental	Open in IMG/M
3300004072	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2	Environmental	Open in IMG/M
3300004146	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2	Environmental	Open in IMG/M
3300005254	Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG	Engineered	Open in IMG/M
3300005832	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006930	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC	Environmental	Open in IMG/M
3300007072	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300010413	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9	Environmental	Open in IMG/M
3300011340	Combined Assembly of Wetland Metatranscriptomes	Environmental	Open in IMG/M
3300014313	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1	Environmental	Open in IMG/M
3300014315	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1	Environmental	Open in IMG/M
3300014319	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1	Environmental	Open in IMG/M
3300018068	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2	Environmental	Open in IMG/M
3300018070	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1	Environmental	Open in IMG/M
3300025950	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025958	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025968	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026477	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR5	Environmental	Open in IMG/M
3300026501	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4	Environmental	Open in IMG/M
3300027715	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027811	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq	Environmental	Open in IMG/M
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300030613	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033406	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033434	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033481	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT	Environmental	Open in IMG/M
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental	Open in IMG/M
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental	Open in IMG/M
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental	Open in IMG/M
3300033493	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
TB_LI09_4DRAFT_1000219710	3300000231	Groundwater	MGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP*
TB_LI09_4DRAFT_100029967	3300000231	Groundwater	MGDLMAPSGCEGNSEGGGSARRIASREAKRAGITRP*
TB_LI09_4DRAFT_100076645	3300000231	Groundwater	MGDPMAPSEREGNSEGGGSARRIASREAKRAGITRS*
TB_LI09_4DRAFT_100094722	3300000231	Groundwater	MGDSMAPSEREGNSEGGGSARRIASREAKRAGITRQ*
TB_LI09_4DRAFT_101052672	3300000231	Groundwater	MGDPMAPSEREGNSEGGGSARRIASRKAKRAGITRP*
TB_LI09_4DRAFT_101637711	3300000231	Groundwater	MGDPMAPSEGEGNSEGGGSARRTASREAKRAGITRP*
JGIcombinedJ13530_1082337662	3300001213	Wetland	MGDLMAPSAREGKSEEGGGARRIASRQAKRAGITR
BBDRAFT_104185472	3300001371	Marine Estuarine	MGDPMAPSDSEGNSEGGSRARWVASLEAKRAGITRP*
BBDRAFT_104444011	3300001371	Marine Estuarine	MGDPMAPSECAGNSEGGGPARRVASRQAKRAGITRP*
JGI20214J51650_110907571	3300003541	Wetland	FLISWSYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP*
Ga0031656_100119721	3300003858	Freshwater Lake Sediment	FLISWSYGMGDPMAPSEREGNSEGGGCARRIASRQAKRAGITRP*
Ga0031656_100689953	3300003858	Freshwater Lake Sediment	FLISWSYGMGDPMAPSEGEGNSEGGGSARRIASCEAKRAGITRP*
Ga0031656_102064511	3300003858	Freshwater Lake Sediment	SWSYGMGDPMAPSEREGNREGGGSARRIASRKAKRAGITRP*
Ga0031653_100789292	3300003859	Freshwater Lake Sediment	ISWSYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP*
Ga0055494_101612082	3300004048	Natural And Restored Wetlands	AFLISWSYGMGDPMAPSESEGNSEGGGCARRIASRQAKRAGITRP*
Ga0055512_101586432	3300004072	Natural And Restored Wetlands	WSYGMGDPMAPSEREGNSEGGGTARRFASREATRAGVTRP*
Ga0055495_100103881	3300004146	Natural And Restored Wetlands	LISWSYGMGDPMAPSEREGNSEGGGRARRIASRQVKRAGITRP*
Ga0068714_101316901	3300005254	Enrichment Culture	WSYGMGDPMAPSEREGNSEGGGTARRFASREAKRAGITRP*
Ga0074469_100477285	3300005832	Sediment (Intertidal)	MGDPMAPSDSEGNSEGGGRARWFASREAKRAGITRP*
Ga0074469_1018502112	3300005832	Sediment (Intertidal)	MGDPMVPSEREGNSEGGGRARRIASREAKRAGITRP*
Ga0074469_1028307743	3300005832	Sediment (Intertidal)	MEGPMAPSDSEGNSEGGGRARWVASREAKRAGITRP*
Ga0074469_105547153	3300005832	Sediment (Intertidal)	SWSYGMGDPMAPSDSEGNSEGKGRARWFASRQAKRAGITRP*
Ga0074469_108781841	3300005832	Sediment (Intertidal)	LISSSYGMGDPMAPSDSEGNSEGGGRARRIASRQAKRAGITRA*
Ga0074469_111014134	3300005832	Sediment (Intertidal)	MGDPMAPSGSEGNSEGGGRARWFASRKAKRAGITRL*
Ga0074469_111608459	3300005832	Sediment (Intertidal)	REAFLISWSYGMGDPMAPSDSEGGGRARRVASREAKRAGITRP*
Ga0079037_1000007893	3300006224	Freshwater Wetlands	MGNPMAPSGGEGNSEGGGRARRFASRQAKRAGITRP*
Ga0079037_1000096066	3300006224	Freshwater Wetlands	MGDPMAPSGSEGNSEGGGSARRIASLLARRAGLTRP*
Ga0079037_1000311176	3300006224	Freshwater Wetlands	FLISWSYGMGDPMAPSEGEGNSEGGGSARRIASREATRAGITRP*
Ga0079037_1000566145	3300006224	Freshwater Wetlands	MGDPMALSEGEGNSEGGGSARRIASRQAKRAGLTRP*
Ga0079037_1001910381	3300006224	Freshwater Wetlands	GMGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP*
Ga0079037_1003039341	3300006224	Freshwater Wetlands	AFLISWSYGMGDPMAPSEREGNSEGGGSACRIVSRQAKRAGITRP*
Ga0079037_1004101192	3300006224	Freshwater Wetlands	MGDPMALSGSEGNSEGGGSARWFASRKAKRAGITRA*
Ga0079037_1005458662	3300006224	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGSARRFASREAKRAGITRP*
Ga0079037_1006189051	3300006224	Freshwater Wetlands	MGDPMAPSEREGNSEGGGSARRIASRQAKRAGLTRP*
Ga0079037_1006372911	3300006224	Freshwater Wetlands	MGDPMAPSEGEGHSEGGGSARRIASLLAKRAGLTRP*
Ga0079037_1007041332	3300006224	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGIAREVASRKAKRAGITRP*
Ga0079037_1007590592	3300006224	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGSARRFASLEAKRAGTTRP*
Ga0079037_1008433422	3300006224	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGGARWFASREAKRAGITRP*
Ga0079037_1008982592	3300006224	Freshwater Wetlands	MGDPMAPSEREGNSEGGGTARRFASHQAKRAGITRP*
Ga0079037_1009743841	3300006224	Freshwater Wetlands	MGDPMAPSDSEGNSEGGGTARWFASREAKRAGITRS*
Ga0079037_1010270272	3300006224	Freshwater Wetlands	MGDPMAPSDREGNSEGGGTARWFASRKAKRAGITRP*
Ga0079037_1012190222	3300006224	Freshwater Wetlands	FLISWSYGMGDPMAPSVSEGNSEGGGTARWFASREAKRAGITRP*
Ga0079037_1012950672	3300006224	Freshwater Wetlands	MGDPMAPSDSEGNSEGGGSARRFASRKARRAGITRP*
Ga0079037_1013713132	3300006224	Freshwater Wetlands	MGDPMAPSASEGNSEGGGTARRIASRQAKQAGITRP*
Ga0079037_1013901912	3300006224	Freshwater Wetlands	MGDPMAPSEDEGNSEGGGSARWFASREAKRAGITRR*
Ga0079037_1013982952	3300006224	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGSARWFASRQAKRAGITRP*
Ga0079037_1014346942	3300006224	Freshwater Wetlands	MGDPMAPSDSEGNSEGGGTARRFASRQAKRAGITRP*
Ga0079037_1016152732	3300006224	Freshwater Wetlands	YGMGDPMAPSEGEGNSEGGGTARRFASHKAKRAGITRP*
Ga0079037_1016300923	3300006224	Freshwater Wetlands	MGDPMAPSVSEGNSEGGGSARWVASREVKRAGITRP*
Ga0079037_1018131991	3300006224	Freshwater Wetlands	SWSYGMGDPMAPSGSEGNSEGGGTARQMANRKAKQAGITRS*
Ga0079037_1018546042	3300006224	Freshwater Wetlands	MGDPMAPSEREGNSEGGGSARRREPRGEAAGITRP*
Ga0079037_1019152902	3300006224	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGAARRFASRPAKRAGITRP*
Ga0079037_1019269101	3300006224	Freshwater Wetlands	LISWSYGMGDPMAPSEGEGNSEGGGVPAAASRQAKRAGITRP*
Ga0079037_1022034201	3300006224	Freshwater Wetlands	WSYGMGDPMAPSEGEGNSEGGGSARRIASREAKRAGLTRP*
Ga0079037_1023722892	3300006224	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGSARRIASRAAKRAGITRP*
Ga0079037_1023984892	3300006224	Freshwater Wetlands	MGDPMAPSDSEGNSEGGGSARWFASREAKRAGITRP*
Ga0079037_1024412362	3300006224	Freshwater Wetlands	MGDPMAPSEREGNSEGGGTARRIASREAKRAGITRP*
Ga0079037_1024763312	3300006224	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGSARRIASLLAKRAGITRP*
Ga0079303_100101172	3300006930	Deep Subsurface	MGDPMAPSDSEGNSEGGGTARWFASREATRAGITRP*
Ga0079303_100247484	3300006930	Deep Subsurface	GDPMAPSEGEGNSEGGGTARRIASREAKRAGITRP*
Ga0079303_100387753	3300006930	Deep Subsurface	MGDPMAPSEREGNSEGGALPAEVASRNATRAGITRP*
Ga0079303_100877141	3300006930	Deep Subsurface	LISWSYGMGDPMAPSEGEGNSEGGGTARRFASHKAKRAGITRP*
Ga0079303_101592782	3300006930	Deep Subsurface	MGDPMAPSDGEGNSEGGGTARWFASREAERAGITRS*
Ga0079303_103487741	3300006930	Deep Subsurface	SYGMGDPMAPSEGEGNSEGGGGARWFASREAKRAGITRP*
Ga0079303_103587731	3300006930	Deep Subsurface	RSYGMGDPMAPSEREGNSEGGGTARRIASRQAKRAGITRP*
Ga0079303_103987472	3300006930	Deep Subsurface	MGDPMAPSVSEGNSEGGGTARWFASREAKRAGITRP*
Ga0073932_100281015	3300007072	Hot Spring Sediment	MGDPMAPSEREGNSEGGGTARRSREPAGEAAGITRP*
Ga0073932_100451810	3300007072	Hot Spring Sediment	MGDPMAPSEREGNSEGGGRARRFASREAKRAGITRS*
Ga0105106_100276252	3300009078	Freshwater Sediment	MGDPMAPSEGEGNSEGGGTARRIASHLAKRAGITRP*
Ga0105106_107751721	3300009078	Freshwater Sediment	GDPRAPSEGEGNSEGGGSARRIASREAKRAGITPP*
Ga0105099_102151131	3300009082	Freshwater Sediment	FLISWSYGMGDPMAPSGSEGNSEGGGTARRFASREARRAGITRL*
Ga0102851_104962591	3300009091	Freshwater Wetlands	LISWSYGMGDPMAPSGSEGNSERGGTARRFASREARRAGITRL*
Ga0102851_124517671	3300009091	Freshwater Wetlands	AFLISGSYGMGDPMAPSEREGNSEGEGTARWFASRQAKRAGITRP*
Ga0115026_100488861	3300009111	Wetland	MGDPMAPSESEGNSEGGGTARWFASRQAKRAGITRP*
Ga0115026_103688161	3300009111	Wetland	SYGMGDPMAPSGSEGNSEGGGTARRFASREARRAGITRL*
Ga0115027_102545442	3300009131	Wetland	SYGMGDPMAPSEGEGNSEGGGRARWFASREAKRAGITRP*
Ga0115027_107147421	3300009131	Wetland	YGMGDPMAPSEREGNSEGGGAARRIASRHAKRAGITRP*
Ga0105094_101066771	3300009153	Freshwater Sediment	GMGDPMALSEREGNSEGGGSARRIASLLAKRAGITRP*
Ga0105100_100452371	3300009166	Freshwater Sediment	LISWSYGMGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP*
Ga0105100_104942061	3300009166	Freshwater Sediment	FLISWSYGMGDPMAPSEREGNSEGGGSARRIASRQAKRAGITRP*
Ga0105100_104942502	3300009166	Freshwater Sediment	GMGDPMAPSEREGNSEGGGSARRIASRQAKRAGITRP*
Ga0113563_100387691	3300009167	Freshwater Wetlands	MGDPMAPSEGEGNSEGGGSARRIASRLAKRAGLTRP*
Ga0113563_110812591	3300009167	Freshwater Wetlands	ISWSYGMGDPMAPSGSEGNSEGGGTARQMANRKAKQAGITRS*
Ga0115028_100349201	3300009179	Wetland	AFLISWSYGMGDPMAPSEGEGNSEGGGSARWFASRQAKRAGITRP*
Ga0115028_100760613	3300009179	Wetland	SWSYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP*
Ga0115028_100800593	3300009179	Wetland	AFLISWSYGMGDPMAPSEREGNSEGGGAARQIASRQAKRAGITRP*
Ga0115028_111562012	3300009179	Wetland	GDPMAPSEGEGNSEGGGRARRFASRQAKRAGITRP*
Ga0136851_104696201	3300010413	Mangrove Sediment	SWSYGMGDPMAPGASEGNSEGGGRARRVASREAKRAGITRP*
Ga0151652_120400422	3300011340	Wetland	MGDPMAPSESEGNSEGGGTARPIASREAKRAGITRP*
Ga0075347_10288292	3300014313	Natural And Restored Wetlands	MGDPMAPSEREGNSEGGGRARWFASREAKRAGITRP*
Ga0075350_10291112	3300014315	Natural And Restored Wetlands	FLISWSYGMGDPMAPSDSEGNSQGGGRARRFASRQAKRAGITRP*
Ga0075348_10821892	3300014319	Natural And Restored Wetlands	WSYGMGDSIAPSVSEGNSEGGGRARRLASRQVKRAGITRL*
Ga0184636_11183802	3300018068	Groundwater Sediment	GDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP
Ga0184631_101503541	3300018070	Groundwater Sediment	GMGDPMAPSEGEGNSEGGGSARRIANLQAKRAGITRP
Ga0210134_10041501	3300025950	Natural And Restored Wetlands	FLISRGYGMGDPMATSGSEGNSEGGGSARWFASREAKRAGITRP
Ga0210134_10159051	3300025950	Natural And Restored Wetlands	MGDPMAPSVSEGNSEGGGRARRLASRQVKRAGITR
Ga0210069_10119541	3300025958	Natural And Restored Wetlands	MGDPMAPSESEGNSEGGGRARRIASREAKRAGITRP
Ga0210103_10105013	3300025968	Natural And Restored Wetlands	LISWSYGMGDPMAPSDSEGNSEGGGRARWVASLEAKRAGITRP
Ga0256807_10616802	3300026477	Sediment	YGMGDPMAPSEREGNSEVGGTARRFASRKAKRAGITRP
Ga0256806_10003213	3300026501	Sediment	MGDPMAPSEGEGNSEGGGTARRIASRQTKRAGITRP
Ga0256806_10015533	3300026501	Sediment	MGDPMAPSEREGNSEGGGSARRFASRQAKRAGLTRP
Ga0208665_101129052	3300027715	Deep Subsurface	LISWSYGMGDPMAPSECEGNSEGGGSARRIASRKAKRAGITRP
Ga0209492_11556711	3300027721	Freshwater Sediment	MGDPMAPSEGEGNSEGGGTARRIASHLAKRAGITR
Ga0256868_100697093	3300027811	Soil	MGDPMAPSEREGNSEGGGSARRIASLLAKRAGITRP
Ga0209397_101118331	3300027871	Wetland	ISWSYGMGDPMAPSEGEGNSEGGGSARRIASREATRAGITRP
Ga0209397_103351752	3300027871	Wetland	MGDPMAPSEGEGNSEGGGSARRIASREAKQAGITRP
Ga0209293_100799772	3300027877	Wetland	SYGMGDPMAPSECEGNSEGGGSARRIASRKAKGAGITRP
Ga0209293_102520472	3300027877	Wetland	MGDPMAPSVSEGNSEGGGRARGIASPQAKRAGITRPQLLEMSR
Ga0209496_105514781	3300027890	Wetland	GDPMAPSEGEGNSEGGGRARRFASRQAKRAGITRP
Ga0209668_104789642	3300027899	Freshwater Lake Sediment	LISWSYGMGDPMAPSVCEGNSEGGGSARRIASREAKQAGITRP
Ga0209253_100915581	3300027900	Freshwater Lake Sediment	SYGMGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP
Ga0209253_102287132	3300027900	Freshwater Lake Sediment	AFLISWSYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP
Ga0299915_101646091	3300030613	Soil	SYGMGDPMAPSEGEGNSEGGGSARRTASREAQRAGITRP
Ga0315290_108023072	3300031834	Sediment	YGMGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP
Ga0315297_116018001	3300031873	Sediment	MGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP
Ga0315292_104142892	3300032143	Sediment	LISWSYGMGDPMAPSEREGNSEGGGSARRIASCEAKRAGITRP
Ga0315292_116085801	3300032143	Sediment	LISWSYGMGDPMAPSEREGNSEGGGSARRIASRKAKRAGITRP
Ga0315295_105004042	3300032156	Sediment	MGDPMAPSEREGNSEGGGSARRIASRQAKRAGITRP
Ga0315281_113829721	3300032163	Sediment	MGDPMAPSEREGNSEGGGSARRIASREAKRAGITRPY
Ga0315283_124822522	3300032164	Sediment	YGMGDPMAPSEREGNSEGGGSARRIASRKAKRAGITRP
Ga0315276_103854621	3300032177	Sediment	MGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP
Ga0315276_108341011	3300032177	Sediment	MGDPMAPSEREGNSEGEGSARRIASRQAKRAGITRP
Ga0315276_116037811	3300032177	Sediment	YGMGDPMAPSEREGNSEGGGSARRIASRQAKRAGITRP
Ga0315286_111717771	3300032342	Sediment	SYGMGDPRAPSEGEGNSEGGGSARRIASRKAKRAGITRP
Ga0315287_121722981	3300032397	Sediment	MGDPMAPSGREGNSEGGGSARRFASREAKRAGITRP
Ga0315273_101735944	3300032516	Sediment	WSYGMGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP
Ga0315273_107198153	3300032516	Sediment	WSYGMGDPMAPSEGEGNSEGGDSARRIASREAKRAGITRP
Ga0316604_100566294	3300033406	Soil	MGDPMAPSEGEGNSEGGGSARRIASREATRAGITRP
Ga0316604_101532431	3300033406	Soil	LISWSYGMGDPMAPSEAEGNSEGGGTARRIASRQARRAGITRP
Ga0316604_101675971	3300033406	Soil	TGDPMAPSECEGNSEGGGTARRIASRKAKRAGITRP
Ga0316604_106972812	3300033406	Soil	EMGDPMAPSECEGNSEGGGSARRIASRQATRAGITRP
Ga0316605_100515112	3300033408	Soil	MGDPMAPSEGEGNSEGGGTARRIASLQAKRAGITRP
Ga0316605_101729492	3300033408	Soil	MGDPMAPSEGEGNSEGGGSARWFASRQAKRAGITRP
Ga0316605_105365531	3300033408	Soil	MGDPMAPSEGEGNSEGGGTARRFASRDAKRAGITRP
Ga0316605_111371721	3300033408	Soil	MGDPMAPSEGEGNSEGGGYARRIAGRQAKRAGITRPQLLEM
Ga0316603_102484252	3300033413	Soil	ISGRYGMGDPMAPSECEGNSEGGGTARRIASRKAKRAGITRP
Ga0316603_104634102	3300033413	Soil	MGDPMAPSDSEGNSEGGGTARRIASLQAKRAGITR
Ga0316603_106414321	3300033413	Soil	SSYGMEDPMAPSEGEGNSEGGGAARRIASREAKRAGITRP
Ga0316603_116980662	3300033413	Soil	WSYGMGDPMAPSGGEGNSEGGGSARRIASREAKRAGITRP
Ga0316603_123396162	3300033413	Soil	MGDPMAPSEGEGNSEGGGGARWFASREAKRAGITRP
Ga0316619_101586452	3300033414	Soil	SFQWSYGMGDPMAPSEGEGNSEGGGSARRIASREAKRAGLTRP
Ga0316619_103068011	3300033414	Soil	YGMGDPMAPSEGEGNSEGGGSARRIASRKAKRAGLTRP
Ga0316619_105377982	3300033414	Soil	LISWSYGMGDPMAPSEGEGNSEGGGTARRFASREAKRAGITRP
Ga0316619_113838911	3300033414	Soil	QWSYGMGDPMAPSEREGNSEGGGRARWFASRQAKRAGITRP
Ga0316622_1012493281	3300033416	Soil	SWSYGTGDPMAPSEGEGNSEGGGTARRIASREAKRAGITRP
Ga0316622_1013219401	3300033416	Soil	SYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP
Ga0316625_1018776071	3300033418	Soil	MGDPMAPSEGEGNSEGGGTARRFASHKAKRAGITRP
Ga0316601_1000005171	3300033419	Soil	YGMGDPMAASEREGNSEGGGTARRIASCQAKRAGITRP
Ga0316601_1006629891	3300033419	Soil	SYGMGDPMAPSEGEGNSEGGGSARRIASREAKRAGLTRP
Ga0316601_1010605481	3300033419	Soil	WSYGMGDPMAPSESEGNSEGGGTARWFASRQAKRAGITRP
Ga0316601_1012458842	3300033419	Soil	WSYGMGDPMAPSEGEGNSEGGGTARRFASHKAKRAGITRP
Ga0326726_122691712	3300033433	Peat Soil	SYGMGDPMAPSESEGGGRARRIASRKAKRAGITRP
Ga0316613_100997883	3300033434	Soil	GMGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP
Ga0316620_100390776	3300033480	Soil	MGDPMAPSDSEGNSEGGGSARRIASRKAKRAGITRP
Ga0316620_109025532	3300033480	Soil	SYGTGDPMAPSECEGNREGGGTARRIASRKAKRAGITRP
Ga0316620_109502303	3300033480	Soil	MGDPMAPSGSEGNSEGGGTARRIASRQAKRAGITR
Ga0316600_110062391	3300033481	Soil	AFLISWSYGMGDPMAPSEREGNSEGGGRARRIASREAKRAGITRP
Ga0316629_100118491	3300033483	Soil	GMGDPMAPSEGEGNSEGGGSARRIASREATRAGITRP
Ga0316626_105705791	3300033485	Soil	LISWSYGMGDPMAPSGSEGNSEGGGTARRFASRKATRVGITRP
Ga0316630_100234474	3300033487	Soil	SYGMGDPMAASEREGNSEGGGTARRIASCQAKRAGITRP
Ga0316630_101162062	3300033487	Soil	MGDPMAPSEGEGNSEGGGRARWFASREAKRAGITRP
Ga0316630_101714732	3300033487	Soil	SWSYGMGDPMAPSEREGNSEGGGTARWFASRQAKRAGITRP
Ga0316630_103632812	3300033487	Soil	LISWSYGMGDPMAPSDSEGNSEGGGRARRIASREAKRAGITRP
Ga0316630_109198602	3300033487	Soil	SYGMGDPMAPSEGEGNSEGGGSARRIASRKAKRAGITRP
Ga0316631_100731462	3300033493	Soil	GMGDPMAPSEGEGNSEGGGSARRTASRKAKRAGITRP
Ga0316631_101812472	3300033493	Soil	MGDPMAPSVSEGNSEGGGSARWVASREAKRAGITRPQLLEM
Ga0316631_102067521	3300033493	Soil	LISGSYGMGDPMAPSEREGNSEGGGRARRIASREAKRAGITRP
Ga0316628_1001384572	3300033513	Soil	MGDPMAPSEGEGNSEGGGSARRFASLEAKRAGTTRP
Ga0316628_1001991341	3300033513	Soil	MGDPMAPSECEGNSEGGGTARRIASRQAKWAGITR
Ga0316628_1023289162	3300033513	Soil	YGMGDPMAPSACEGNSEGGGTARRFASREAKRAGITRP
Ga0316628_1024251232	3300033513	Soil	SWSYGVGDPMAPSDSEGNSEGGGSARRIASRAAKRAGLTRP
Ga0316628_1039074662	3300033513	Soil	YGMGDPMAPSEGEGNSEGGGSARWFASRKAKRAGITRA
Ga0316616_1000336754	3300033521	Soil	MGDPMAPSECEGNSEGGGSARRIASREAKRAGITRP
Ga0316616_1001557652	3300033521	Soil	MGDPMALSGSEGNSEGGGRARWFASREAKRAGITRP
Ga0316616_1010524451	3300033521	Soil	MGDPMAPSVSEGNSEGGGSARRIASRKAKRAGITR
Ga0316616_1015414472	3300033521	Soil	LISWSYGVGDPMAPSEREGNSEGGGTARRMASRQAKRAGITRP
Ga0316616_1028488642	3300033521	Soil	LISWSYGMGDPMAPSEREGNSEGGGTAGRIASRKAKRARITRP
Ga0316617_1001051191	3300033557	Soil	MGDPMASSEREGNSEGGGSACRIVSRQAKRAGITGP
Ga0316617_1011781262	3300033557	Soil	LISWSYGMGDPMAPSEGEGNSEGGGSARWFASRKAKRAGITRP
Ga0316617_1020263842	3300033557	Soil	GDPMAPSEGEGNSEGGGTARRIASREAKRAGITRP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F032488

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences