Basic Information | |
---|---|
Family ID | F032773 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 179 |
Average Sequence Length | 41 residues |
Representative Sequence | TFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 179 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.56 % |
% of genes near scaffold ends (potentially truncated) | 97.21 % |
% of genes from short scaffolds (< 2000 bps) | 91.06 % |
Associated GOLD sequencing projects | 150 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.207 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.905 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.257 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.659 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 0.00% Coil/Unstructured: 77.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 179 Family Scaffolds |
---|---|---|
PF00327 | Ribosomal_L30 | 50.28 |
PF00828 | Ribosomal_L27A | 35.20 |
PF00344 | SecY | 8.38 |
PF03719 | Ribosomal_S5_C | 2.79 |
PF00406 | ADK | 1.12 |
PF00416 | Ribosomal_S13 | 0.56 |
PF00557 | Peptidase_M24 | 0.56 |
PF03551 | PadR | 0.56 |
PF01176 | eIF-1a | 0.56 |
COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
---|---|---|---|
COG1841 | Ribosomal protein L30/L7E | Translation, ribosomal structure and biogenesis [J] | 50.28 |
COG1727 | Ribosomal protein L18E | Translation, ribosomal structure and biogenesis [J] | 35.20 |
COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 8.38 |
COG0098 | Ribosomal protein S5 | Translation, ribosomal structure and biogenesis [J] | 2.79 |
COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 1.12 |
COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.56 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.56 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.21 % |
Unclassified | root | N/A | 2.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10068105 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
3300001661|JGI12053J15887_10416292 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300002914|JGI25617J43924_10010810 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
3300002914|JGI25617J43924_10056688 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300002917|JGI25616J43925_10062457 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
3300003350|JGI26347J50199_1016052 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300004092|Ga0062389_102988466 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300004471|Ga0068965_1273338 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300004472|Ga0068974_1378334 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300004971|Ga0072324_1264114 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300005332|Ga0066388_101706234 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300005435|Ga0070714_100715156 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300005471|Ga0070698_101925481 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005518|Ga0070699_101480333 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005539|Ga0068853_100730153 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300005557|Ga0066704_10089255 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
3300005558|Ga0066698_11016986 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005587|Ga0066654_10142856 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300005764|Ga0066903_107179651 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300005841|Ga0068863_100001063 | All Organisms → cellular organisms → Bacteria | 27441 | Open in IMG/M |
3300005843|Ga0068860_101583491 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300005995|Ga0066790_10359525 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300006028|Ga0070717_10507842 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300006050|Ga0075028_100372402 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300006050|Ga0075028_100570367 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300006102|Ga0075015_100012376 | All Organisms → cellular organisms → Bacteria | 3633 | Open in IMG/M |
3300006102|Ga0075015_100724580 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300006173|Ga0070716_100384669 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300006176|Ga0070765_100794156 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300006796|Ga0066665_10056409 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
3300006796|Ga0066665_10441382 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300006804|Ga0079221_11315126 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300006804|Ga0079221_11756208 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300006852|Ga0075433_11575624 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300006903|Ga0075426_10329491 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300009012|Ga0066710_101613709 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300009038|Ga0099829_10153741 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
3300009176|Ga0105242_10707149 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300009551|Ga0105238_11997107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300009646|Ga0116132_1005380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6059 | Open in IMG/M |
3300009792|Ga0126374_11007227 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300009792|Ga0126374_11140254 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300010043|Ga0126380_11322578 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300010046|Ga0126384_11412884 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300010048|Ga0126373_11646760 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300010107|Ga0127494_1045610 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300010159|Ga0099796_10312287 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300010358|Ga0126370_11657584 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300010361|Ga0126378_11084160 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300010376|Ga0126381_102198785 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300010376|Ga0126381_102866969 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300010379|Ga0136449_102868929 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300010396|Ga0134126_10461841 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300010398|Ga0126383_10440537 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300010868|Ga0124844_1033606 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300010868|Ga0124844_1172568 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300012096|Ga0137389_10133229 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
3300012169|Ga0153990_1150774 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300012189|Ga0137388_10304270 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
3300012198|Ga0137364_11437253 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300012199|Ga0137383_10331575 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300012203|Ga0137399_10619765 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300012206|Ga0137380_10276900 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300012206|Ga0137380_10568958 | Not Available | 993 | Open in IMG/M |
3300012210|Ga0137378_11678362 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300012211|Ga0137377_11535099 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300012361|Ga0137360_11058746 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012362|Ga0137361_10317341 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300012387|Ga0134030_1069159 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
3300012401|Ga0134055_1242083 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012683|Ga0137398_10344062 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300012918|Ga0137396_10594878 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300012927|Ga0137416_11048121 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300012927|Ga0137416_11475853 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012944|Ga0137410_11975817 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300013296|Ga0157374_11596418 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300014157|Ga0134078_10348408 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300015054|Ga0137420_1013423 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300015245|Ga0137409_10295826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1424 | Open in IMG/M |
3300016270|Ga0182036_11382707 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300016357|Ga0182032_10291116 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300016371|Ga0182034_10403393 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300016445|Ga0182038_12104178 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300017943|Ga0187819_10426537 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300017955|Ga0187817_10026398 | All Organisms → cellular organisms → Bacteria | 3494 | Open in IMG/M |
3300017970|Ga0187783_10221681 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300017974|Ga0187777_10705503 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300017999|Ga0187767_10349965 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300018025|Ga0187885_10052509 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300018431|Ga0066655_10061232 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
3300018433|Ga0066667_10340983 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300018433|Ga0066667_10882219 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300019240|Ga0181510_1155773 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300020170|Ga0179594_10068748 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300020579|Ga0210407_10297177 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300020579|Ga0210407_11445389 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300020580|Ga0210403_10675762 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300020580|Ga0210403_11249311 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300020581|Ga0210399_10768645 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300020582|Ga0210395_10274517 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300020583|Ga0210401_10196966 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
3300020583|Ga0210401_10205719 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
3300020583|Ga0210401_11210765 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300021046|Ga0215015_10167996 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300021046|Ga0215015_10628861 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300021178|Ga0210408_10271472 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300021178|Ga0210408_10279239 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300021178|Ga0210408_11189320 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300021180|Ga0210396_10525207 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300021181|Ga0210388_11285402 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300021401|Ga0210393_11617669 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300021406|Ga0210386_10363408 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300021406|Ga0210386_11501331 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300021406|Ga0210386_11773849 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300021407|Ga0210383_10160822 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
3300021432|Ga0210384_10129740 | All Organisms → cellular organisms → Bacteria | 2262 | Open in IMG/M |
3300021432|Ga0210384_10772907 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300021433|Ga0210391_11116300 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300021475|Ga0210392_10679475 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300021559|Ga0210409_10986912 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300021560|Ga0126371_10872932 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300021855|Ga0213854_1242309 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300022509|Ga0242649_1045658 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300022523|Ga0242663_1001911 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
3300022533|Ga0242662_10309256 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300024227|Ga0228598_1107752 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300024284|Ga0247671_1007035 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
3300024288|Ga0179589_10225119 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300024330|Ga0137417_1175881 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300024330|Ga0137417_1233778 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300025910|Ga0207684_10811599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Pelotomaculum → Pelotomaculum thermopropionicum → Pelotomaculum thermopropionicum SI | 790 | Open in IMG/M |
3300025928|Ga0207700_11846131 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300025938|Ga0207704_11583908 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300026217|Ga0209871_1043724 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300026297|Ga0209237_1212140 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300026319|Ga0209647_1290136 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300026332|Ga0209803_1276096 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300026490|Ga0257153_1103336 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300026515|Ga0257158_1078283 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300026538|Ga0209056_10649144 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300026547|Ga0209156_10023177 | All Organisms → cellular organisms → Bacteria | 3668 | Open in IMG/M |
3300027003|Ga0207722_1034641 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300027109|Ga0208603_1037404 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300027313|Ga0207780_1001506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6285 | Open in IMG/M |
3300027548|Ga0209523_1049691 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300027565|Ga0209219_1111248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300027645|Ga0209117_1052356 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300027651|Ga0209217_1115639 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300027678|Ga0209011_1121752 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300027727|Ga0209328_10191051 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300027812|Ga0209656_10183785 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300027825|Ga0209039_10096992 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300027829|Ga0209773_10194327 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300029636|Ga0222749_10831389 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300031231|Ga0170824_101970700 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300031545|Ga0318541_10067417 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
3300031573|Ga0310915_10593329 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300031715|Ga0307476_10550629 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300031718|Ga0307474_10202385 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
3300031748|Ga0318492_10241769 | Not Available | 931 | Open in IMG/M |
3300031754|Ga0307475_10409378 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300031820|Ga0307473_10113921 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
3300031835|Ga0318517_10453840 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031879|Ga0306919_10969844 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300031890|Ga0306925_10450047 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
3300031946|Ga0310910_10779894 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300031947|Ga0310909_10064575 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
3300031947|Ga0310909_11516601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
3300031962|Ga0307479_11969883 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300032009|Ga0318563_10582217 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300032094|Ga0318540_10329624 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300032205|Ga0307472_100787647 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300032770|Ga0335085_10801066 | Not Available | 1037 | Open in IMG/M |
3300032783|Ga0335079_11954496 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300032805|Ga0335078_10057654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5716 | Open in IMG/M |
3300032892|Ga0335081_11225609 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300033158|Ga0335077_10821998 | Not Available | 944 | Open in IMG/M |
3300033290|Ga0318519_10466021 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300033805|Ga0314864_0097806 | Not Available | 714 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.91% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.15% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.03% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.35% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.35% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.35% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.35% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.79% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.23% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.23% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.12% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.12% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.12% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.68% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.56% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004472 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_100681055 | 3300001593 | Forest Soil | AALLGLKDIAHVAETRSKTVEEISGKPPKEKAATSEGD* |
JGI12053J15887_104162923 | 3300001661 | Forest Soil | KATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAGSEGD* |
JGI25617J43924_100108101 | 3300002914 | Grasslands Soil | AALLSLKDAAQVAETRSKTVDEISGRQPKEQKAAVSEAS* |
JGI25617J43924_100566884 | 3300002914 | Grasslands Soil | HNVVKATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD* |
JGI25616J43925_100624571 | 3300002917 | Grasslands Soil | ATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD* |
JGI26347J50199_10160521 | 3300003350 | Bog Forest Soil | VKATFAALLGLKDAAQVAETRSKTIDEISGRYQKAAGESN* |
Ga0062389_1029884663 | 3300004092 | Bog Forest Soil | VKATFAALLSLKDAGQVAETRSKTVEEISGRPPKVEKQEKAAGE* |
Ga0068965_12733383 | 3300004471 | Peatlands Soil | NVVKATFAALLSLKDAGQVAETRSKTIEEVSGKPPKAEKVEKAAGE* |
Ga0068974_13783341 | 3300004472 | Peatlands Soil | NVVKATFAALLSLKDVGQVAETRSKTIEEVSGKPPKAEKVEKAAGE* |
Ga0072324_12641143 | 3300004971 | Peatlands Soil | VVKATFAALLSLKDVGQVAETRSKTIEEVSGKPPKAEKVEKAAGE* |
Ga0066388_1017062341 | 3300005332 | Tropical Forest Soil | KATFAALLGLKDVAQVAETRSKTVEEISGKPSKEKAEKAAVSESNA* |
Ga0070714_1007151561 | 3300005435 | Agricultural Soil | TFAALLSLKDVAQVAETRSKTVDEIRGRYPKPAAAEGTAS* |
Ga0070698_1019254813 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ATFSALLGLKDAAQVAETRTKTVEEITGREKKSEKAAAGEAQ* |
Ga0070699_1014803333 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KATFAALLSLKDAAHVAETRSKTVDEISGRPPKDQKAAVSEAS* |
Ga0068853_1007301533 | 3300005539 | Corn Rhizosphere | KATFAALLSLKDAAHVAEMRSKTVDEISGRPQRAAAAESTNG* |
Ga0066704_100892551 | 3300005557 | Soil | LGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD* |
Ga0066698_110169861 | 3300005558 | Soil | ALLGLKDAAQVAETRSKTVDEISGRPAKEKAAVSEGNA* |
Ga0066654_101428561 | 3300005587 | Soil | SLKDAAHVAEMRSKTVDEISGRPQKAAVAESTNG* |
Ga0066903_1071796513 | 3300005764 | Tropical Forest Soil | DAAQVAETRSKTVEEISGKPAKEKEKVAATESNG* |
Ga0068863_10000106332 | 3300005841 | Switchgrass Rhizosphere | GLKDAAQVAETRTKTVEEITGREKKTEQAAGEAR* |
Ga0068860_1015834911 | 3300005843 | Switchgrass Rhizosphere | VVKATFAALLGLKDAAQVAETRTKTVEEITGREKKTEQAAGEAR* |
Ga0066790_103595253 | 3300005995 | Soil | KATFAALLSLKDAAQVAETRSMTVEQMSGRPPKGEKSEKAAGE* |
Ga0070717_105078424 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NVVKATFAALLGLKDAAQVAETRSKTVDEISGRPPKDKELKAAGSEAS* |
Ga0075028_1003724021 | 3300006050 | Watersheds | NVVKATFAALLSLKDAAQVAETRSMTVEQMSGKPPKGEKSEKAAGE* |
Ga0075028_1005703671 | 3300006050 | Watersheds | VKATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAATSEGV* |
Ga0075015_1000123766 | 3300006102 | Watersheds | ATFAALLGLKDIAQVAETRSKTVEEVSGKQPKEKAAASESN* |
Ga0075015_1007245803 | 3300006102 | Watersheds | HNVVKATFAALLSPKDVAHVAETRSKTVEEISAKSPRGGEKTEKEKAAGE* |
Ga0070716_1003846691 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LLSLKDANQVAETRSKTLEEISGRPPKAEKLEKAAGE* |
Ga0070765_1007941561 | 3300006176 | Soil | VKATFAALLSLKDIAQVAETRSKTVDEIRGRYPKVAAVESGS* |
Ga0066665_100564091 | 3300006796 | Soil | AAFAALLSLKDASQVAETRSKAVEEIMGRPKAEKVEKGAGEK* |
Ga0066665_104413821 | 3300006796 | Soil | ALLGLKDIAHVAETRSKTVEEISGKPPKEKAATSEGD* |
Ga0079221_113151261 | 3300006804 | Agricultural Soil | VVKATFAALLGLKDVAQVAETRSKTVEEISGKPPKEKAAASEGA* |
Ga0079221_117562081 | 3300006804 | Agricultural Soil | TFAALLSLKDAAHVAETRSKTVEEISGKSPRGGEKAEKEKAAGE* |
Ga0075433_115756241 | 3300006852 | Populus Rhizosphere | NVVKATFAALLGLKDAAQVAETRTKTVEEITGREKKTEQAAGEAR* |
Ga0075426_103294914 | 3300006903 | Populus Rhizosphere | NVVKATFAALLGLKDAAQVAETRSKTVDEISGRPAKEKAAVSESNA* |
Ga0066710_1016137091 | 3300009012 | Grasslands Soil | HNVIKATFSALLGLKDAAQVAETRSKTVDEISGKGPKEKAAGESNA |
Ga0099829_101537411 | 3300009038 | Vadose Zone Soil | NVVKATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD* |
Ga0105242_107071491 | 3300009176 | Miscanthus Rhizosphere | KATFAALLGLKDAAQVAETRTKTVEEITGREKKTEQAAGEAR* |
Ga0105238_119971071 | 3300009551 | Corn Rhizosphere | NVVKATFAALLSLKDVAQVAETRSKTVEEIRGRSPKQNGTAVAGTEGAA* |
Ga0116132_10053801 | 3300009646 | Peatland | KATFAALLSLKDVGQVAETRSKTIEEVSGKPPKAEKVEKAAGE* |
Ga0126374_110072273 | 3300009792 | Tropical Forest Soil | FAALLGLKDAAQVAETRSKTVDEISGKPAKEKAAVSESNA* |
Ga0126374_111402541 | 3300009792 | Tropical Forest Soil | GLKDAKQVAETRSKTVEELSGKPAKAEKTEKVEKAAGE* |
Ga0126380_113225781 | 3300010043 | Tropical Forest Soil | FAALLSLKDASHVAEMRSKTVDEISGRPQKAAAAEGTTNG* |
Ga0126384_114128841 | 3300010046 | Tropical Forest Soil | TFAALLGLKDAAQVAETRTKTVEEITGREKKTEQQAAGEAR* |
Ga0126373_116467601 | 3300010048 | Tropical Forest Soil | KATFAALLGLKDAAQVAETRSKTVEEISGKPAKEKAAVSENNA* |
Ga0127494_10456101 | 3300010107 | Grasslands Soil | ATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGA* |
Ga0099796_103122871 | 3300010159 | Vadose Zone Soil | TFAALLGLKDVAQVAETRSKTVDEISGRPPKDKEQKAAGSEAS* |
Ga0126370_116575843 | 3300010358 | Tropical Forest Soil | LLGLKDVAQVAETRSKTVEEISGKPVKEKAAISESNA* |
Ga0126378_110841601 | 3300010361 | Tropical Forest Soil | NVVKATFAALLGLKDAAQVAETRTKTVEEITGREKKVERAAGEAQ* |
Ga0126381_1021987853 | 3300010376 | Tropical Forest Soil | VKATFAALLGLKDAAQVAETRTKTVEEITGREKKAEQAAGEAR* |
Ga0126381_1028669693 | 3300010376 | Tropical Forest Soil | FAALLGLKDAAQVAETRTKTVEEITGKVKEKAAGEN* |
Ga0136449_1028689293 | 3300010379 | Peatlands Soil | LSLKDAGQVAETRSKTIEEVSGKPPKAEKVEKAAGE* |
Ga0134126_104618414 | 3300010396 | Terrestrial Soil | HNVVKATFAALLGLKDAAQVAETRSKTVDEISGRYQKAAGESD* |
Ga0126383_104405371 | 3300010398 | Tropical Forest Soil | IKATFAALLGLKDVAQVAETRSKTVEEISGKPVKEKAAVGESNA* |
Ga0124844_10336064 | 3300010868 | Tropical Forest Soil | IKATFAALLGLKDAAQVAETRTKTVEEITGREKKAEQAAGEAR* |
Ga0124844_11725681 | 3300010868 | Tropical Forest Soil | LQPFAALLGLKDAAQVAETRTKTVEEITGKAKEKAAGEN* |
Ga0137389_101332294 | 3300012096 | Vadose Zone Soil | FAALLSLKDAAQVAETRSKTVDEISGRPSKEKAAATESN* |
Ga0153990_11507743 | 3300012169 | Attine Ant Fungus Gardens | LLSLKDAAHVAETRSKTVDEISGKQPKEQKAAVAESD* |
Ga0137388_103042704 | 3300012189 | Vadose Zone Soil | VKATFAALLSLKDAAHVAETRSKTVDEISGRQQKAASESV* |
Ga0137364_114372531 | 3300012198 | Vadose Zone Soil | HNVVKATFAALLGLKDIAHVAETRSKTVEEISGKPAKEKAAAGEGA* |
Ga0137383_103315751 | 3300012199 | Vadose Zone Soil | TFAALLSLKDAAQVAETRSKTVDEISGRPSKEKAAATESN* |
Ga0137399_106197651 | 3300012203 | Vadose Zone Soil | TFAALLSLKDVGHVAEMRSKTVDEISGRPPKEKAAASESN* |
Ga0137380_102769004 | 3300012206 | Vadose Zone Soil | GLKDIAHVAETRSKTVEEISGKPPKEKAATSEGA* |
Ga0137380_105689581 | 3300012206 | Vadose Zone Soil | KATFAALLSLKDAAQVAETRSKTVDEISGRPSKEKAAATESN* |
Ga0137378_116783623 | 3300012210 | Vadose Zone Soil | SALLGLKDAPQAAVTLTKTVEETTGREKKAENAAGE* |
Ga0137377_115350993 | 3300012211 | Vadose Zone Soil | VVKATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAVASEGD* |
Ga0137360_110587461 | 3300012361 | Vadose Zone Soil | VKATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAATSEGD* |
Ga0137361_103173414 | 3300012362 | Vadose Zone Soil | ALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGA* |
Ga0134030_10691591 | 3300012387 | Grasslands Soil | TFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD* |
Ga0134055_12420831 | 3300012401 | Grasslands Soil | VLALLGLKDIAHVAETRSKTVEEISGKPPKEKAAVSEGD* |
Ga0137398_103440624 | 3300012683 | Vadose Zone Soil | AALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD* |
Ga0137396_105948783 | 3300012918 | Vadose Zone Soil | VVKATFAALLSLKDVGHVAEMRSKTVDEISGRPPKEKAAASESN* |
Ga0137416_110481213 | 3300012927 | Vadose Zone Soil | KDVAQVAETRSKTVDEISGRPPKDKEQKAAGSEAS* |
Ga0137416_114758531 | 3300012927 | Vadose Zone Soil | FAALLGLKDAAQVAETRTKTVEEITGKSKEKAAGEN* |
Ga0137410_119758171 | 3300012944 | Vadose Zone Soil | NVVKATFAALLGLKDVAQVAETRSKTVDEISGRPPKDQKAAGSEAS* |
Ga0157374_115964181 | 3300013296 | Miscanthus Rhizosphere | LSLKDAAHVAEMRSKTVDEISGRPQKAAVAESTNG* |
Ga0134078_103484081 | 3300014157 | Grasslands Soil | NVIKATFAALLGLKDAAQVAETRSKTVEEISGKPAKEKAAVGESNA* |
Ga0137420_10134231 | 3300015054 | Vadose Zone Soil | DVAQVAETRSKTVDEISGRPPKDKEQKAAGSEAS* |
Ga0137409_102958265 | 3300015245 | Vadose Zone Soil | HNVIKATFAALLSLKDAAHVAETRTKTIEEVTGKSQEKAAGGV* |
Ga0182036_113827073 | 3300016270 | Soil | FAALLGLKDAKQVAETRSKTVEELSGKPAKAEKTEKVEKAAGE |
Ga0182032_102911161 | 3300016357 | Soil | ATFAALLGLKDASQVAETRSKSVEELSGKPPKAEKQEKVEKAAGE |
Ga0182034_104033931 | 3300016371 | Soil | NVIKATFAALLGLKDAAQVAETRTKTVEEITGREKKVEKAAGEAQ |
Ga0182038_121041781 | 3300016445 | Soil | AALLSLKDAGQVAETRSKTVEEISGKSAKPEKNENQKAVGE |
Ga0187819_104265371 | 3300017943 | Freshwater Sediment | ATFAALLGLKDAGQVAETRSKSVDEISGRTPKVEKSEKPEKPEKVEKVEKAAGE |
Ga0187817_100263981 | 3300017955 | Freshwater Sediment | KATFAALLSLKDAGQVAETRSKTLEEVSGRPPKAEKVEKAAGE |
Ga0187783_102216811 | 3300017970 | Tropical Peatland | AQVAETRSKTVEEMTGRAPKGEKTAAAVTTEKAAGE |
Ga0187777_107055033 | 3300017974 | Tropical Peatland | LGLKDAAQVAETRSKTVEEMTGRPPKAPKQQQQPVEKAAGE |
Ga0187767_103499651 | 3300017999 | Tropical Peatland | LLGLKDAAQVAETRSKTVDEISGKPAKEKAAVSESNA |
Ga0187885_100525094 | 3300018025 | Peatland | ALLSLKDVGQVAETRSKTIEEVSGKPPKAEKVEKAAGE |
Ga0066655_100612324 | 3300018431 | Grasslands Soil | VVKATFAALLSLKDIAHVAETRSKTVEEISGKPAKEKAAASEGA |
Ga0066667_103409834 | 3300018433 | Grasslands Soil | LLSLKDAAQVAETRSKTLDEISGRPPKEQKAAVGETS |
Ga0066667_108822193 | 3300018433 | Grasslands Soil | PHNVVKATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD |
Ga0181510_11557733 | 3300019240 | Peatland | LLSLKDIAHVAEIRSKTVDEISGRAPKEKAAVSETV |
Ga0179594_100687481 | 3300020170 | Vadose Zone Soil | TFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAATSEGD |
Ga0210407_102971774 | 3300020579 | Soil | ALLSLKDAGQVAETRSKTIEEISGRPPKVAVAAEKPVEKAAGE |
Ga0210407_114453893 | 3300020579 | Soil | ALLSLKDIAQVAETRSKTVDEIRGRYPKAAVVESGS |
Ga0210403_106757621 | 3300020580 | Soil | TFSALLGLKDAAQVAETRSKTVDEISGRQKEKVAAGESNA |
Ga0210403_112493111 | 3300020580 | Soil | FAALLSLKDIAQVAETRSKTVDEIRGRYPKVAAVESGS |
Ga0210399_107686451 | 3300020581 | Soil | KATFAALLGLKDAAQVAETRSKTVDEISGRYQKAAGESN |
Ga0210395_102745174 | 3300020582 | Soil | AALLSLKDISQVAETRSKTVDEIRGRYPKAAAVESAS |
Ga0210401_101969664 | 3300020583 | Soil | FAALRELKDAAQVAETRSKTLDEISGRYQKVAAGENS |
Ga0210401_102057191 | 3300020583 | Soil | AALLSLKDAGQVAETRSKTIEEISGRPPKVAVAAEKPVEKAAGE |
Ga0210401_112107651 | 3300020583 | Soil | ALLSLKDVAHVAESRSKTVEEVSAKSPRGGEKTEKEKAAGE |
Ga0215015_101679962 | 3300021046 | Soil | VYKRQALLSLKDVAHVAETRSKTVEEISAKSPRGGEKTEKEKAAGE |
Ga0215015_106288613 | 3300021046 | Soil | VKATFAALLSLKDVAQVAETRSKTVDEISGRQPKEQKAAASEAS |
Ga0210408_102714721 | 3300021178 | Soil | TFAALLSLKDVAHVAEMRSKTVDEISGRTPQKVAAGEGA |
Ga0210408_102792394 | 3300021178 | Soil | AALLSLKDIAQVAETRSKTVDEISGRQPKEQKAAVSEAS |
Ga0210408_111893201 | 3300021178 | Soil | FAALLGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGD |
Ga0210396_105252071 | 3300021180 | Soil | VKATFAALLGLKDAAQVAETRSKTVEEMTGRPPKAPVAPKPEPSERAAGE |
Ga0210388_112854021 | 3300021181 | Soil | ALLSLKDAAQVAETRSKTVEEIQGRAPKVESKPEKAAGE |
Ga0210393_116176693 | 3300021401 | Soil | ALLGLKDAAQVAETRSKTLDEISGRYQKAAVGESS |
Ga0210386_103634084 | 3300021406 | Soil | ALLSLKDIAQVAETRSKTVDEIRGRYPKAAAVESGS |
Ga0210386_115013311 | 3300021406 | Soil | AALLGLKDAAQVAETRSKTLDEISGRYQKAAVGESS |
Ga0210386_117738493 | 3300021406 | Soil | LGLKDVAQVAETRSKTVDEISGRPPKDKEQKAAGSEAS |
Ga0210383_101608224 | 3300021407 | Soil | VKATSAALLSLKDVAQVAETRSNTVEEIRGRSPKQNGAAAAAESNT |
Ga0210384_101297404 | 3300021432 | Soil | VKATFAALLSLKDVAHVAEMRSKTVDEISGRTPQKAAVGEGD |
Ga0210384_107729071 | 3300021432 | Soil | KATFAALLGLKDAAQVAETRSKTLDEISGRYQKVAAGENS |
Ga0210391_111163001 | 3300021433 | Soil | AALLSLKDIAQVAETRSKTVDEIRGRYPKVAAVESGS |
Ga0210392_106794751 | 3300021475 | Soil | ATFAALLSLKDVAQVAETRSKTVDEIRGRYPKPGATAEGTAS |
Ga0210409_109869123 | 3300021559 | Soil | TFAALLSLKDAAHVAEMRSKTVDEISGRQSKAATSESD |
Ga0126371_108729324 | 3300021560 | Tropical Forest Soil | LKDASQVAETRSKSVEELSGKPPKAEKQEKVEKAAGE |
Ga0213854_12423092 | 3300021855 | Watersheds | VKATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAATSEGV |
Ga0242649_10456583 | 3300022509 | Soil | VKATFAALLGLKDAAQVAETRSKTIDEISGRYQKAAAGENS |
Ga0242663_10019114 | 3300022523 | Soil | VVKATFAALLGLKDAAQVAETRSKTVDEISGRYQKAAGESS |
Ga0242662_103092563 | 3300022533 | Soil | HNVVKATFAALLGLKDAAQVAETRSKTIDEISGRYQKAAAGENS |
Ga0228598_11077521 | 3300024227 | Rhizosphere | HNVVKATFAALLSLKDIAHVAEIRSKTVDEISGRPPKEKAAVSETV |
Ga0247671_10070354 | 3300024284 | Soil | KATFAALLGLKDAAQVAETRSKTVDEISGRYQKAAGESD |
Ga0179589_102251193 | 3300024288 | Vadose Zone Soil | LSLKDITHVAEIRSKTVDEISGRPPKEKAAVSETV |
Ga0137417_11758813 | 3300024330 | Vadose Zone Soil | AALLGLKDIAHVAETRSKTVEEISGKPPKEKAAGSEGD |
Ga0137417_12337783 | 3300024330 | Vadose Zone Soil | VKATFAALLSLKDAAQVAETRSKTVDEISGRQPKEQKAAVSEAS |
Ga0207684_108115993 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SALLGLKDAAQVAETRTKTVEEITGREKKAEKAAGE |
Ga0207700_118461313 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TFAALLSLKDANQVAETRSKTLEEISGRPPKAEKLEKAAGE |
Ga0207704_115839081 | 3300025938 | Miscanthus Rhizosphere | ALLSLKDAAHVAEMRSKTVDEISGRPQKAAAAESTNG |
Ga0209871_10437243 | 3300026217 | Permafrost Soil | VKATFAALLSLKDIAQVAETRSKTVDEVRGRYPKAAVVESVS |
Ga0209237_12121403 | 3300026297 | Grasslands Soil | TFAALLSLKDIAHVAETRSKTVEEISGKPAKEKAAASEGA |
Ga0209647_12901361 | 3300026319 | Grasslands Soil | SLKDVAQVAETRSKTVDEISGRPPKEQKAAVSEAS |
Ga0209803_12760963 | 3300026332 | Soil | ALLSLKDASQVAETRSKAVEEIMGRPKAEKVEKGAGEK |
Ga0257153_11033361 | 3300026490 | Soil | FSALLGLKDAAQVAETRTKTVEEITGREKKAEKAAGE |
Ga0257158_10782831 | 3300026515 | Soil | VKATFAALLSLKDVAHVAETRSKTVEEISAKSPRGGEKTEKDKDKAAGE |
Ga0209056_106491443 | 3300026538 | Soil | ALLGLKDIAHVAETRSKTVEEISGKPPKEKAATSEGD |
Ga0209156_100231771 | 3300026547 | Soil | LSLKDIAHVAETRSKTVEEISGKPAKEKAAASEGA |
Ga0207722_10346413 | 3300027003 | Tropical Forest Soil | KDAAHVAETRSKTVEEISGKSPRGGEKSEKEKAAGE |
Ga0208603_10374043 | 3300027109 | Forest Soil | LSLKDVAHVAETRSKTVEEISAKSPRGGEKTEKEKAAGE |
Ga0207780_100150612 | 3300027313 | Tropical Forest Soil | KATFAALLSLKDAGQVAETRSKSVEELSGKPPKAEKAEKAESKEKAVAE |
Ga0209523_10496913 | 3300027548 | Forest Soil | LLSLKDVAHVAETRSKTVEEISAKSPRGGEKTEKDKAAGE |
Ga0209219_11112483 | 3300027565 | Forest Soil | VKATFAALLSLKDAAHVAETRSKTLEEISAKSPRGGEKTEKDKAAGE |
Ga0209117_10523561 | 3300027645 | Forest Soil | ALLSLKDIAQVAETRSKTVDEISGRQPKEQKAAVSEAS |
Ga0209217_11156391 | 3300027651 | Forest Soil | ALLSLKDIAQVAETRSKTVDEIRGRYPKPAAGESAS |
Ga0209011_11217521 | 3300027678 | Forest Soil | LSLKDAAQVAETRSKTVDEISGRPPKDQKAAASEAS |
Ga0209328_101910513 | 3300027727 | Forest Soil | KATFAALLSLKDVTHVAEMRSKTVDEISGRSPQKAAGENN |
Ga0209656_101837854 | 3300027812 | Bog Forest Soil | LGLKDAAQVAETRSKTVEEISGRPPKVEKQEKSEKAAGE |
Ga0209039_100969921 | 3300027825 | Bog Forest Soil | TFAALLSLKDIAHVAEIRSKTVDEISGRPPKEKAAVSETV |
Ga0209773_101943271 | 3300027829 | Bog Forest Soil | ALLSLKDIAHVAEIRSKTVDEISGRPPKEKAAVSETV |
Ga0222749_108313892 | 3300029636 | Soil | VKATFAALLSLKDAAQVAETRSKTVDEISGRQKEKAAGSESHS |
Ga0170824_1019707003 | 3300031231 | Forest Soil | FAALLGLKDAAQVAETRTKTVEEITGKTKEKAAGEN |
Ga0318541_100674174 | 3300031545 | Soil | AALLGLKDAKQVAETRSKTVEELSGKPAKAEKAEKVEKAAGE |
Ga0310915_105933291 | 3300031573 | Soil | NVVKATFAALLGLKDAKQVAETRSKTVEELSGKPAKAEKTEKVEKAAGE |
Ga0307476_105506291 | 3300031715 | Hardwood Forest Soil | ATFAALLGLKDAAQVAETRTKTVEEITGREKKVEKAAGEAQ |
Ga0307474_102023854 | 3300031718 | Hardwood Forest Soil | ATFAALLGLKDVAQVAETRSKTVDEISGRPPKEKDQKAAGSEAS |
Ga0318492_102417694 | 3300031748 | Soil | VVKATFAALLGLKDAKQVAETRSKTVEELSGKPAKAEKTEKVEKAAGE |
Ga0307475_104093784 | 3300031754 | Hardwood Forest Soil | LGLKDIAHVAETRSKTVEEISGKPPKEKAAASEGA |
Ga0307473_101139214 | 3300031820 | Hardwood Forest Soil | HNVVKATFAALLGLKDAAQVAETRSKTVDEISGRPAKEKAAVSESNV |
Ga0318517_104538401 | 3300031835 | Soil | GLKDVAQVAETRSKTVEEISGKPAKEKAAVSESNA |
Ga0306919_109698443 | 3300031879 | Soil | KATFAALLGLKDAKQVAETRSKTVEELSGKPAKAEKTEKVEKAAGE |
Ga0306925_104500471 | 3300031890 | Soil | KATFAALLGLKDAAQVAETRTKTVEEITGREKKVEKAAGEAQ |
Ga0310910_107798943 | 3300031946 | Soil | LLGLKDAKQVAETRSKTVEELSGKPAKAEKTEKVEKAAGE |
Ga0310909_100645751 | 3300031947 | Soil | VVKATFAALLGLKDAKQVAETRSKTVEELSGKPAKAEKAEKVEKAAGE |
Ga0310909_115166013 | 3300031947 | Soil | KDAAQVAETRSKTVEEMTGRPAKAPKQEQPTAAGAAGE |
Ga0307479_119698831 | 3300031962 | Hardwood Forest Soil | VKATFAALLGLKDIAHVAETRSKTVEEISGKPPKEKAATSEGA |
Ga0318563_105822173 | 3300032009 | Soil | LKDAKQVAETRSKTVEELSGKAAKAEKTEKVEKAAGE |
Ga0318540_103296242 | 3300032094 | Soil | VVKATFAALLSLKDAGQVAETRSKTIEEISGRPPKAEKLVEKAAGE |
Ga0307472_1007876471 | 3300032205 | Hardwood Forest Soil | LLGLKDAAQVAETRTKTVEEITGREKKTEQAAGEAR |
Ga0335085_108010664 | 3300032770 | Soil | GLKDAAQVAETRSKTVEEMTGRMPKAPKTEQQPVEKAAGE |
Ga0335079_119544961 | 3300032783 | Soil | LGLKDAAQVAETRSKTLEEMTGRPPKAPKQEQQPVEKAAGE |
Ga0335078_100576541 | 3300032805 | Soil | FAALLGLKDAAQVAETRSKTVDEISGRPPKEKAAGSEGVA |
Ga0335081_112256091 | 3300032892 | Soil | LGLKDAAQVAETRSKTVDEISGRPPREKAAATESN |
Ga0335077_108219981 | 3300033158 | Soil | KDAAQVAETRSKTVEEMTGRMPKAPKTEQQPVEKAAGE |
Ga0318519_104660211 | 3300033290 | Soil | ATFAALLGLKDAKQVAETRSKTVEELSGKPAKAEKTEKVEKAAGE |
Ga0314864_0097806_577_714 | 3300033805 | Peatland | VIKATFAALLGLKDAAQVAETRSKTVDEISGKPAKEKAAVSESNA |
⦗Top⦘ |