Basic Information | |
---|---|
Family ID | F032797 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 179 |
Average Sequence Length | 43 residues |
Representative Sequence | AEVLQNAYAVRPFPAWDLANLALWTAAGAVFAAWRFRWHS |
Number of Associated Samples | 149 |
Number of Associated Scaffolds | 179 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.12 % |
% of genes near scaffold ends (potentially truncated) | 96.09 % |
% of genes from short scaffolds (< 2000 bps) | 93.30 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.123 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.961 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.140 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.458 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 179 Family Scaffolds |
---|---|---|
PF02566 | OsmC | 60.89 |
PF04072 | LCM | 9.50 |
PF03861 | ANTAR | 2.23 |
PF00254 | FKBP_C | 1.12 |
PF13561 | adh_short_C2 | 1.12 |
PF00248 | Aldo_ket_red | 0.56 |
PF00106 | adh_short | 0.56 |
PF01061 | ABC2_membrane | 0.56 |
PF01847 | VHL | 0.56 |
PF09339 | HTH_IclR | 0.56 |
PF04226 | Transgly_assoc | 0.56 |
PF02589 | LUD_dom | 0.56 |
PF04075 | F420H2_quin_red | 0.56 |
PF12680 | SnoaL_2 | 0.56 |
PF16124 | RecQ_Zn_bind | 0.56 |
PF00926 | DHBP_synthase | 0.56 |
COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
---|---|---|---|
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 60.89 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 60.89 |
COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 9.50 |
COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 2.23 |
COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.56 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.12 % |
Unclassified | root | N/A | 17.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573000|GPBTN7E01C43QV | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300003352|JGI26345J50200_1044818 | Not Available | 504 | Open in IMG/M |
3300004082|Ga0062384_101242679 | Not Available | 543 | Open in IMG/M |
3300004092|Ga0062389_100717978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1174 | Open in IMG/M |
3300005334|Ga0068869_100267008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1372 | Open in IMG/M |
3300005434|Ga0070709_10679381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 799 | Open in IMG/M |
3300005456|Ga0070678_101563877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 619 | Open in IMG/M |
3300005467|Ga0070706_100803612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
3300005541|Ga0070733_10775758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300005549|Ga0070704_101487819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
3300005591|Ga0070761_10501450 | Not Available | 749 | Open in IMG/M |
3300005764|Ga0066903_103199530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 886 | Open in IMG/M |
3300005843|Ga0068860_102291287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
3300005921|Ga0070766_11030488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 567 | Open in IMG/M |
3300006028|Ga0070717_10740449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 894 | Open in IMG/M |
3300006028|Ga0070717_12145269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300006052|Ga0075029_100172790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1338 | Open in IMG/M |
3300006057|Ga0075026_100597122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
3300006059|Ga0075017_101194406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
3300006172|Ga0075018_10218655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 911 | Open in IMG/M |
3300006175|Ga0070712_101826591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. TF02-7 | 532 | Open in IMG/M |
3300006176|Ga0070765_101196685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
3300006237|Ga0097621_101569106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
3300006755|Ga0079222_10379581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
3300006755|Ga0079222_10649629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
3300006804|Ga0079221_10193913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
3300006804|Ga0079221_10990137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
3300006806|Ga0079220_11392345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 594 | Open in IMG/M |
3300006871|Ga0075434_101041919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
3300006954|Ga0079219_12444059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300007076|Ga0075435_101067537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
3300007258|Ga0099793_10184279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
3300009092|Ga0105250_10256981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
3300009520|Ga0116214_1439017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300009521|Ga0116222_1023501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2773 | Open in IMG/M |
3300009525|Ga0116220_10282239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
3300009698|Ga0116216_10388053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
3300010343|Ga0074044_10308169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
3300010379|Ga0136449_103185848 | Not Available | 634 | Open in IMG/M |
3300010379|Ga0136449_103576009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300010379|Ga0136449_104095083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300010401|Ga0134121_10602310 | Not Available | 1028 | Open in IMG/M |
3300010876|Ga0126361_10340111 | Not Available | 663 | Open in IMG/M |
3300012096|Ga0137389_10901788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
3300012207|Ga0137381_10406507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1188 | Open in IMG/M |
3300012210|Ga0137378_10671871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
3300012356|Ga0137371_10482037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
3300012357|Ga0137384_10584946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 912 | Open in IMG/M |
3300012361|Ga0137360_10657057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
3300012476|Ga0157344_1005892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
3300012491|Ga0157329_1030792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300012514|Ga0157330_1012561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
3300012951|Ga0164300_10144899 | Not Available | 1105 | Open in IMG/M |
3300012960|Ga0164301_11914084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300012985|Ga0164308_10794271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
3300012989|Ga0164305_11063769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
3300013102|Ga0157371_10927110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
3300013104|Ga0157370_11739665 | Not Available | 560 | Open in IMG/M |
3300013307|Ga0157372_13479723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300014969|Ga0157376_10711370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
3300015200|Ga0173480_11107993 | Not Available | 529 | Open in IMG/M |
3300017822|Ga0187802_10179833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Natronosporangium → Natronosporangium hydrolyticum | 811 | Open in IMG/M |
3300017822|Ga0187802_10221141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella aerolata | 730 | Open in IMG/M |
3300017823|Ga0187818_10112303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1180 | Open in IMG/M |
3300017924|Ga0187820_1130038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
3300017926|Ga0187807_1099421 | Not Available | 914 | Open in IMG/M |
3300017932|Ga0187814_10006203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4804 | Open in IMG/M |
3300017932|Ga0187814_10010096 | All Organisms → cellular organisms → Bacteria | 3691 | Open in IMG/M |
3300017947|Ga0187785_10284816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300017970|Ga0187783_10771646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300017970|Ga0187783_11318808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300017973|Ga0187780_11331471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300017975|Ga0187782_10030728 | All Organisms → cellular organisms → Bacteria | 3902 | Open in IMG/M |
3300017975|Ga0187782_10294015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1225 | Open in IMG/M |
3300018012|Ga0187810_10078360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
3300018037|Ga0187883_10398240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
3300018038|Ga0187855_10361412 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300018085|Ga0187772_10299878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
3300018085|Ga0187772_11374745 | Not Available | 524 | Open in IMG/M |
3300018086|Ga0187769_10145301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1734 | Open in IMG/M |
3300018090|Ga0187770_10566521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
3300018433|Ga0066667_10895199 | Not Available | 763 | Open in IMG/M |
3300020581|Ga0210399_10470853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
3300020582|Ga0210395_10443747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 976 | Open in IMG/M |
3300020583|Ga0210401_10935383 | Not Available | 725 | Open in IMG/M |
3300021171|Ga0210405_10098682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2304 | Open in IMG/M |
3300021178|Ga0210408_10127340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2010 | Open in IMG/M |
3300021180|Ga0210396_10267521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1517 | Open in IMG/M |
3300021180|Ga0210396_11191316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300021404|Ga0210389_10175048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1669 | Open in IMG/M |
3300021404|Ga0210389_11244041 | Not Available | 572 | Open in IMG/M |
3300021407|Ga0210383_11081760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
3300021477|Ga0210398_10853194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
3300021477|Ga0210398_11409783 | Not Available | 544 | Open in IMG/M |
3300021560|Ga0126371_11761377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 742 | Open in IMG/M |
3300022528|Ga0242669_1086496 | Not Available | 589 | Open in IMG/M |
3300025527|Ga0208714_1065912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 757 | Open in IMG/M |
3300025898|Ga0207692_10387807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
3300025915|Ga0207693_11126440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. TF02-7 | 595 | Open in IMG/M |
3300025916|Ga0207663_10008277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5431 | Open in IMG/M |
3300025927|Ga0207687_10749688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300025929|Ga0207664_10390900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1236 | Open in IMG/M |
3300027024|Ga0207819_1043429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella aerolata | 544 | Open in IMG/M |
3300027110|Ga0208488_1038390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
3300027604|Ga0208324_1159994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300027725|Ga0209178_1266736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
3300027795|Ga0209139_10076739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1172 | Open in IMG/M |
3300027795|Ga0209139_10301514 | Not Available | 563 | Open in IMG/M |
3300027855|Ga0209693_10342713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella aerolata | 725 | Open in IMG/M |
3300027867|Ga0209167_10369326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
3300027869|Ga0209579_10216334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1027 | Open in IMG/M |
3300027879|Ga0209169_10062203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1932 | Open in IMG/M |
3300028381|Ga0268264_10997814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
3300028879|Ga0302229_10039612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2410 | Open in IMG/M |
3300028906|Ga0308309_10532658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
3300029943|Ga0311340_10455327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
3300030503|Ga0311370_11344930 | Not Available | 760 | Open in IMG/M |
3300030524|Ga0311357_10820139 | Not Available | 834 | Open in IMG/M |
3300030598|Ga0210287_1216057 | Not Available | 534 | Open in IMG/M |
3300030741|Ga0265459_10625264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1003 | Open in IMG/M |
3300030741|Ga0265459_13791339 | Not Available | 530 | Open in IMG/M |
3300030743|Ga0265461_13435836 | Not Available | 536 | Open in IMG/M |
3300030848|Ga0075388_11168365 | Not Available | 543 | Open in IMG/M |
3300031525|Ga0302326_10214454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3190 | Open in IMG/M |
3300031564|Ga0318573_10070384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1747 | Open in IMG/M |
3300031564|Ga0318573_10517485 | Not Available | 643 | Open in IMG/M |
3300031640|Ga0318555_10237676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 984 | Open in IMG/M |
3300031679|Ga0318561_10314478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
3300031680|Ga0318574_10606991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
3300031681|Ga0318572_10303787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300031681|Ga0318572_10325483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 910 | Open in IMG/M |
3300031681|Ga0318572_10571937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
3300031682|Ga0318560_10267215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
3300031708|Ga0310686_107492086 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
3300031718|Ga0307474_10653572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
3300031723|Ga0318493_10199014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1056 | Open in IMG/M |
3300031736|Ga0318501_10111851 | Not Available | 1373 | Open in IMG/M |
3300031736|Ga0318501_10269920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
3300031744|Ga0306918_11278293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
3300031751|Ga0318494_10687185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
3300031754|Ga0307475_11532114 | Not Available | 511 | Open in IMG/M |
3300031768|Ga0318509_10596750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300031769|Ga0318526_10149402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
3300031779|Ga0318566_10587843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
3300031781|Ga0318547_10537316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
3300031781|Ga0318547_10857329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300031781|Ga0318547_11044868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300031782|Ga0318552_10104483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1400 | Open in IMG/M |
3300031819|Ga0318568_10245928 | Not Available | 1107 | Open in IMG/M |
3300031831|Ga0318564_10490403 | Not Available | 534 | Open in IMG/M |
3300031832|Ga0318499_10129485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
3300031845|Ga0318511_10060590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1542 | Open in IMG/M |
3300031845|Ga0318511_10069053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1456 | Open in IMG/M |
3300031845|Ga0318511_10256544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
3300031846|Ga0318512_10195984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
3300031860|Ga0318495_10134010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1116 | Open in IMG/M |
3300031890|Ga0306925_11296525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300031890|Ga0306925_11937595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300031893|Ga0318536_10468418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
3300031897|Ga0318520_11014580 | Not Available | 524 | Open in IMG/M |
3300031942|Ga0310916_10201465 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300032039|Ga0318559_10201122 | Not Available | 916 | Open in IMG/M |
3300032039|Ga0318559_10299503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300032055|Ga0318575_10359236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300032067|Ga0318524_10201899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
3300032067|Ga0318524_10219630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
3300032067|Ga0318524_10314008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 811 | Open in IMG/M |
3300032067|Ga0318524_10779344 | Not Available | 505 | Open in IMG/M |
3300032068|Ga0318553_10690034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300032076|Ga0306924_10365736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1653 | Open in IMG/M |
3300032089|Ga0318525_10205636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
3300032090|Ga0318518_10475466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300032160|Ga0311301_11007363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1100 | Open in IMG/M |
3300032180|Ga0307471_102749950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
3300032205|Ga0307472_100573559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
3300032770|Ga0335085_12588924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 501 | Open in IMG/M |
3300032896|Ga0335075_10008377 | All Organisms → cellular organisms → Bacteria | 15843 | Open in IMG/M |
3300032896|Ga0335075_11085191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.59% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.91% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.91% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.35% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.35% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.79% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.23% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.23% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.12% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.12% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.12% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.12% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.68% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.56% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.56% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N55_01265690 | 2189573000 | Grass Soil | VDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWRAT |
JGI26345J50200_10448182 | 3300003352 | Bog Forest Soil | FPVKALAQLMQGGYAVRPFPAWDLVNLGLWTAIGAGFVAWRFRWHT* |
Ga0062384_1012426791 | 3300004082 | Bog Forest Soil | QLMQGAYTARPFPAWDLANLGLWTAAGMGFVVWRFRWNT* |
Ga0062389_1007179783 | 3300004092 | Bog Forest Soil | LSRLVAAFPVKALAQLMQGAYTARPFPAWDLANLGLWTAAGMGFVVWRFRWNT* |
Ga0062389_1025986641 | 3300004092 | Bog Forest Soil | GLPNWLSHLVAAFPVKPLAQVLENAYAARPFSALDLLNLGLWAAAGAGFAAWRFRWHS* |
Ga0068869_1002670082 | 3300005334 | Miscanthus Rhizosphere | VKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT* |
Ga0070709_106793813 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | KALAEVLQNTYAVRPFPAWDLLNLALWTVAGAAVAVWRFRWHS* |
Ga0070678_1015638771 | 3300005456 | Miscanthus Rhizosphere | RLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT* |
Ga0070706_1008036121 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAS* |
Ga0070733_107757582 | 3300005541 | Surface Soil | VKALAQVLQNAYAVRPFPAWDLLNLALWTAAGAAFTTWRFRWDS* |
Ga0070704_1014878192 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | SRLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT* |
Ga0070761_105014501 | 3300005591 | Soil | KALAEVLQNAYAVRPFPPWALANLALWTAAGAVFALWRFRWHS* |
Ga0066903_1031995301 | 3300005764 | Tropical Forest Soil | LVAAFPVKALAEVLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHT* |
Ga0068860_1022912871 | 3300005843 | Switchgrass Rhizosphere | LQNAYAVRPLPPWNLANLGLWTAAGAVFAVWRFRWHAT* |
Ga0070766_110304882 | 3300005921 | Soil | LAQLMQGAYTVRPFPAWDLVNLGAWTAAGAGFVAWRFRWHS* |
Ga0070717_107404492 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FPVKALAEVLQNAYAVRPFPAWNLANLALWTAAGAVFAVWRFRWHAT* |
Ga0070717_121452692 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LVDTFPVKALAEVLQNAYAVRPFPAWELVNLGLWTAAGAVFAVWRFRWHTT* |
Ga0075029_1001727901 | 3300006052 | Watersheds | NAYAVRPFPAWDLANLALWTAAGATFAAWRFRWHS* |
Ga0075026_1005971223 | 3300006057 | Watersheds | AYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS* |
Ga0075017_1011944061 | 3300006059 | Watersheds | VLENAYAVRPFPAWDLANLALWTAAGATFAVWRFRWHS* |
Ga0075018_102186551 | 3300006172 | Watersheds | VKALAEVLQNAYAVRPFPAWELANLGLWTAAGAVFAVWRFRWHAT* |
Ga0070712_1018265911 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVATFPVKALAEVLQNAYAVRPFPALNLVNLALWTAAGAVFTVWRFRWHS* |
Ga0070765_1011966853 | 3300006176 | Soil | PVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHVS* |
Ga0097621_1015691062 | 3300006237 | Miscanthus Rhizosphere | YAVRPFPPWNLANLGLWTAAGAVFAVWRFRWHAT* |
Ga0079222_103795814 | 3300006755 | Agricultural Soil | VDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFVTWRFRWHAK* |
Ga0079222_106496291 | 3300006755 | Agricultural Soil | FPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS* |
Ga0079221_101939133 | 3300006804 | Agricultural Soil | YAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS* |
Ga0079221_109901372 | 3300006804 | Agricultural Soil | LVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT* |
Ga0079220_113923452 | 3300006806 | Agricultural Soil | VDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS* |
Ga0075434_1010419192 | 3300006871 | Populus Rhizosphere | NAYAVRPFPAWNLANLGLWTAAGAVFVIWRFRWHAK* |
Ga0079219_124440592 | 3300006954 | Agricultural Soil | LQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAM* |
Ga0075435_1010675372 | 3300007076 | Populus Rhizosphere | AEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT* |
Ga0099793_101842792 | 3300007258 | Vadose Zone Soil | MFPVKALAEVLQNAYAVRPFPAWELANLGLWTAAGAVFAVWRFRWHG* |
Ga0105250_102569812 | 3300009092 | Switchgrass Rhizosphere | NAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT* |
Ga0116214_14390172 | 3300009520 | Peatlands Soil | NAYAVRPFPAWDLLNLALWTAAGAAFTAWRFRWHT* |
Ga0116222_10235012 | 3300009521 | Peatlands Soil | MVAAFPVKALAQLMQGAYTARPFPAWDLANLGLWTAAGVGFVAWRFRWHT* |
Ga0116220_102822391 | 3300009525 | Peatlands Soil | TFPVKALAEVLQNAYAVRPFPAWDLANLALWTAAGAVFAAWRFRWHS* |
Ga0116216_103880533 | 3300009698 | Peatlands Soil | AQVLQNAYAVRPFPAWDLLNLALWTAAGAAFTAWRFRWHT* |
Ga0074044_103081691 | 3300010343 | Bog Forest Soil | LAQVLENAYAARPFSALDLVNLGLWTAAGAGFAAWRFRWHS* |
Ga0136449_1031858481 | 3300010379 | Peatlands Soil | AEVLQNAYAVRPFPAWDLANLALWTAAGAVFAAWRFRWHS* |
Ga0136449_1035760092 | 3300010379 | Peatlands Soil | KALAEVLQNAYAVRPFPAWDLANLALWTAAGATFAAWRFRWHS* |
Ga0136449_1040950832 | 3300010379 | Peatlands Soil | FPVKALAEVLENAYAVRPFPAWDLANLALWTAAGATFAAWRFRWHS* |
Ga0134121_106023102 | 3300010401 | Terrestrial Soil | EVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT* |
Ga0126361_103401111 | 3300010876 | Boreal Forest Soil | LVAAFPVKALAQLMQGAYTVRPFPAWDLANLALWTALGAAFVTWRFRWQT* |
Ga0137389_109017882 | 3300012096 | Vadose Zone Soil | QVLQNAYAVRPFPAWDLANLGLWTAAGAGIAVWRFRWHS* |
Ga0137381_104065073 | 3300012207 | Vadose Zone Soil | VKALADVLQNAYAVRPFPAWDLVNLALWTAGGAAFAVWRFRWHS* |
Ga0137378_106718713 | 3300012210 | Vadose Zone Soil | PVKALAEVLQNAYAVRPFPAWDLANLALWTAAGAVFAVWRFRWHS* |
Ga0137371_104820372 | 3300012356 | Vadose Zone Soil | PVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS* |
Ga0137384_105849461 | 3300012357 | Vadose Zone Soil | FPVKALAEVLQNAYAVRPFPAWDLVNLGLWMAAGAAFAAWRFRWHG* |
Ga0137360_106570573 | 3300012361 | Vadose Zone Soil | PVKALAEVLQNAYAVRPLPAWDLANLCLWTAAGAVFAVWRFRWHAS* |
Ga0157344_10058921 | 3300012476 | Arabidopsis Rhizosphere | HLVALFPVKALAEVLQNTYAVRPYPAWDLASLALWTAVGAGFAAWRFRWHAK* |
Ga0157329_10307922 | 3300012491 | Arabidopsis Rhizosphere | VDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT* |
Ga0157330_10125611 | 3300012514 | Soil | PDWLSRLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT* |
Ga0164300_101448991 | 3300012951 | Soil | AEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT* |
Ga0164301_119140842 | 3300012960 | Soil | MFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS* |
Ga0164308_107942711 | 3300012985 | Soil | MFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT* |
Ga0164305_110637692 | 3300012989 | Soil | RLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT* |
Ga0157371_109271102 | 3300013102 | Corn Rhizosphere | KALAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT* |
Ga0157370_117396652 | 3300013104 | Corn Rhizosphere | VLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT* |
Ga0157372_134797232 | 3300013307 | Corn Rhizosphere | VLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT* |
Ga0157376_107113701 | 3300014969 | Miscanthus Rhizosphere | MFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAA* |
Ga0173480_111079931 | 3300015200 | Soil | EVLQNAYAVRPFPAWNLANLGLWTAAGAFFAIWRFRWHAT* |
Ga0187802_101798331 | 3300017822 | Freshwater Sediment | ALAQLLQGAYTARPFPAWDLANLALWTAAGVGFVAWRFRWHT |
Ga0187802_102211411 | 3300017822 | Freshwater Sediment | MVAAFPVKALAQLMQGAYTARPFPAWDLANLGLWTAAGVGFVAWRFRWHT |
Ga0187818_101123033 | 3300017823 | Freshwater Sediment | FPVKALAEVLENAYAARPFPAWDLANLALWTAAGATFAAWRFRWHS |
Ga0187820_11300381 | 3300017924 | Freshwater Sediment | VLQNAYAVRPFPAWDLLNLALWTAAGAAFTAWRFRWHT |
Ga0187807_10994211 | 3300017926 | Freshwater Sediment | LMQGAYTVRPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0187814_100062031 | 3300017932 | Freshwater Sediment | LMQGASTARPFPAWGLANLALWTAAGAGFVAWRFRWHT |
Ga0187814_100100961 | 3300017932 | Freshwater Sediment | FPVKALAQLMQGAYTVRPFPAWDLANLALWTAAGVGFVAWRFRWHT |
Ga0187785_102848163 | 3300017947 | Tropical Peatland | PVKALAEVLQNTYAVRPYPAWDLASLALWAAVGAGFAAWRFRWHS |
Ga0187783_107716462 | 3300017970 | Tropical Peatland | VAAFPVKSLAQVLQNAYAVRPFPAWDLANLALWTAAGAGFTAWRFRWHT |
Ga0187783_113188082 | 3300017970 | Tropical Peatland | FPVKSLAEVLQNAYAVRPFPAWDLLNLALWTAAGAAFAAWRFRWHN |
Ga0187780_113314712 | 3300017973 | Tropical Peatland | ALAQLLEGAYTVRPFPAWDLVNLGVWTAAAAGFVAWRFRWHG |
Ga0187782_100307285 | 3300017975 | Tropical Peatland | LAQLLQGAYTARPFPGWDLVNLGLWTAAGAGFVAWRFRWHS |
Ga0187782_102940152 | 3300017975 | Tropical Peatland | MVDAFPVKSLAQVLEGAYTMRPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0187810_100783601 | 3300018012 | Freshwater Sediment | QLMQGAYTARPFPAWDLANLGLWTAAGVGFVAWRFRWHT |
Ga0187883_103982401 | 3300018037 | Peatland | QNAYAVRPFPAWDLANLALWTAAGATFAVWRFRWHS |
Ga0187855_103614121 | 3300018038 | Peatland | QVLQNAYAVRPFPAWDLVNLGLWTAAGASFAVWRFRWHS |
Ga0187772_102998781 | 3300018085 | Tropical Peatland | KALAQLLQGAYTARPFPGWDLVNLGLWTAAGAGFVAWRFRWHS |
Ga0187772_113747452 | 3300018085 | Tropical Peatland | FPVKALAQLLQGAYTVRPFPAWDLMNLGLWTAAGAGFVAWRFRWHN |
Ga0187769_101453011 | 3300018086 | Tropical Peatland | QLMQGAYTVRPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0187770_105665211 | 3300018090 | Tropical Peatland | FPVKALAQLMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0066667_108951991 | 3300018433 | Grasslands Soil | NAYAVRPFPAWNLANLALWTAGGAAVAVWRFRWHS |
Ga0210399_104708533 | 3300020581 | Soil | LVAAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT |
Ga0210395_104437471 | 3300020582 | Soil | AAFPVKALAEVLQNAYAVRPFPPWALANLALWTAAGAVFALWRFRWQS |
Ga0210401_109353833 | 3300020583 | Soil | QVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT |
Ga0210405_100986824 | 3300021171 | Soil | KLMQGGYTVRPFPAWDLVNLALWTAAGAGFVAWRFRWHS |
Ga0210408_101273403 | 3300021178 | Soil | AEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS |
Ga0210396_102675211 | 3300021180 | Soil | MQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT |
Ga0210396_111913162 | 3300021180 | Soil | NAYAVRPFPPWNLANLGLWTAAGAVFAVWRFRWHAT |
Ga0210389_101750484 | 3300021404 | Soil | AQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT |
Ga0210389_112440411 | 3300021404 | Soil | PVKALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVAWRFRWHT |
Ga0210383_110817602 | 3300021407 | Soil | GAYTARPFPAWDLANLGLWTAAGAALAVWRFRWHS |
Ga0210398_108531943 | 3300021477 | Soil | QGAYTVRPFPAWDLANLALWTTLGVGFVAWRFRWHT |
Ga0210398_114097831 | 3300021477 | Soil | VLQNAYAVRPFPPWALANLALWTAAGAVFALWRFRWQS |
Ga0126371_117613771 | 3300021560 | Tropical Forest Soil | RLVAAFPIKALAEILQNTYAVRPFPAWDLLNLALWTLAGAAFATWRFRWHT |
Ga0242669_10864962 | 3300022528 | Soil | VAAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVAWRFRWHT |
Ga0208714_10659122 | 3300025527 | Arctic Peat Soil | LAEVLQNTYAVRPFPAWDLANLALWTAAGAAFAAWRFRWHS |
Ga0207692_103878071 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS |
Ga0207693_111264402 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVATFPVKALAEVLQNAYAVRPFPALNLVNLALWTAAGAVFTVWRFRWHS |
Ga0207663_100082777 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGKALAEVLQNTYAVRPFPAWDLLNLALWTVAGAAVAVWRFRWHS |
Ga0207687_107496882 | 3300025927 | Miscanthus Rhizosphere | ALAEVLQNAYAVRPLPPWNLANLGLWTAAGAVFAVWRFRWHAT |
Ga0207664_103909001 | 3300025929 | Agricultural Soil | PVRALAQVLRSAYTTTTFPAWDLLNLALWTVAGACFVAWRFRWHT |
Ga0207819_10434292 | 3300027024 | Tropical Forest Soil | LVQAFPVKALAQLLQGAYTVRPFPAWDLVNLGLWTAAGAGFVAWRFRWHG |
Ga0208488_10383901 | 3300027110 | Forest Soil | NAYAVRPFTAWDLASLGLWTAAGACFAIWRFRWQN |
Ga0208324_11599941 | 3300027604 | Peatlands Soil | FPVKALAEVLENAYAVRPFPAWDLANLALWTAAGATFAVWRFRWHS |
Ga0209178_12667362 | 3300027725 | Agricultural Soil | KALAEVLQNTYAVRPFPAWDLLNLALWTVAGAAVAVWRFRWHS |
Ga0209139_100767393 | 3300027795 | Bog Forest Soil | LSRLVAAFPIHALAQVLQNAYAARPFSAWDLANLGLWTAAGAALAVWRFRWHS |
Ga0209139_103015142 | 3300027795 | Bog Forest Soil | KALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVAWRFRWHT |
Ga0209693_103427133 | 3300027855 | Soil | ALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVVWRFRWHT |
Ga0209167_103693261 | 3300027867 | Surface Soil | PVKALAQVLQNAYAVRPFPAWDLLNLALWTAAGAAFTTWRFRWDS |
Ga0209579_102163341 | 3300027869 | Surface Soil | QVLQNAYAVRPFPAWDLLNLVLWTAAGAAFTAWRFRWHT |
Ga0209169_100622034 | 3300027879 | Soil | LAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT |
Ga0268264_109978141 | 3300028381 | Switchgrass Rhizosphere | EVLQNAYAVRPLPPWNLANLGLWTAAGAVFAVWRFRWHAT |
Ga0302229_100396121 | 3300028879 | Palsa | VLQGAYTARPFPAWDLVNLGLWTAAGAAVAVWRFRWHS |
Ga0308309_105326583 | 3300028906 | Soil | ERLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT |
Ga0311340_104553273 | 3300029943 | Palsa | FPVKSLAQILQNAYAVRPFSPWDLANLGLWTVAGASFTAWRFRWHS |
Ga0311370_113449302 | 3300030503 | Palsa | AQLMQGGYTVRPFPAWDLANLALWTAIGAGLVAWRFRWHT |
Ga0311357_108201393 | 3300030524 | Palsa | AFPVKALAQLMQGAYTARPFPTWDLANLALWTAAGVGFVAWRFRWDT |
Ga0210287_12160571 | 3300030598 | Soil | AQLLQGGYAVRPFPAWDLANLGLWTVIGAGFVAWRFRWHT |
Ga0265459_106252641 | 3300030741 | Soil | MQGAYTVRPFPAWDLANLALWTAIGAGLVAWRFRWHT |
Ga0265459_137913392 | 3300030741 | Soil | LMQGGYAVRPFPAWDLANLGLWTALGAGFVAWRFRWHT |
Ga0265461_134358361 | 3300030743 | Soil | QLLQGAYTARPFPAWDLANLALWTAVGVCFVAWRFRWNT |
Ga0075388_111683652 | 3300030848 | Soil | AFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT |
Ga0302326_102144547 | 3300031525 | Palsa | LAQVLQGAYTARPFPAWDLVNLGLWTAAGAAVAVWRFRWHS |
Ga0318573_100703841 | 3300031564 | Soil | LMQGAYTARPFPAWDLANLALWTAAGVGFVTWRFRWHT |
Ga0318573_105174851 | 3300031564 | Soil | FPVKALTELMQGAYTARPFPAWDLANLALWTAAGVGFVAWRFRWHT |
Ga0318555_102376761 | 3300031640 | Soil | ALFPVKALAEVLQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS |
Ga0318561_103144781 | 3300031679 | Soil | VLQNAYAVRPFPAWDVVNLALWTAAGAAFAAWRFRWHN |
Ga0318574_106069911 | 3300031680 | Soil | LLQGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG |
Ga0318572_103037873 | 3300031681 | Soil | VKALAEILQNTYAVRPFPAWDLANLALWTAGGAAVAAWRFRWHS |
Ga0318572_103254833 | 3300031681 | Soil | AELLQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0318572_105719371 | 3300031681 | Soil | RLVAAFPVKALAEVLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHT |
Ga0318560_102672153 | 3300031682 | Soil | EILQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS |
Ga0310686_1074920864 | 3300031708 | Soil | MQGAYTVRPFPAWDLVNLAAWTAAGASFVAWRFRWHS |
Ga0307474_106535723 | 3300031718 | Hardwood Forest Soil | VTAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVAWRFRWHT |
Ga0318493_101990141 | 3300031723 | Soil | QNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS |
Ga0318501_101118514 | 3300031736 | Soil | VKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0318501_102699201 | 3300031736 | Soil | VAAFPVKALAEILQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS |
Ga0306918_112782931 | 3300031744 | Soil | QGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0318494_106871851 | 3300031751 | Soil | QNTYAVRPYPAWDLASLALWTAVGVGFAAWRFRWHS |
Ga0307475_115321142 | 3300031754 | Hardwood Forest Soil | DRLVTAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT |
Ga0318509_105967501 | 3300031768 | Soil | LAQLLQGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG |
Ga0318526_101494023 | 3300031769 | Soil | VLQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS |
Ga0318566_105878431 | 3300031779 | Soil | AQLLQGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG |
Ga0318547_105373161 | 3300031781 | Soil | RMVAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0318547_108573291 | 3300031781 | Soil | AEILQNTYAVRPFPAWDLANLALWTAGGAAVAAWRFRWHS |
Ga0318547_110448682 | 3300031781 | Soil | LLQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0318552_101044831 | 3300031782 | Soil | AAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0318568_102459283 | 3300031819 | Soil | ALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0318564_104904031 | 3300031831 | Soil | QGAYTARPFPAWDLANLALWTAAGACFVAWRFRWHT |
Ga0318499_101294852 | 3300031832 | Soil | VKALAQLLQGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG |
Ga0318511_100605903 | 3300031845 | Soil | LQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS |
Ga0318511_100690531 | 3300031845 | Soil | VAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGVGFVTWRFRWHT |
Ga0318511_102565441 | 3300031845 | Soil | VAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0318512_101959841 | 3300031846 | Soil | VLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHT |
Ga0318495_101340103 | 3300031860 | Soil | ALAEVLQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS |
Ga0306925_112965251 | 3300031890 | Soil | AELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0306925_119375951 | 3300031890 | Soil | NAYAIRPFPAWDLVNLGLWTAAGAAFAVWRFRWHS |
Ga0318536_104684181 | 3300031893 | Soil | GAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG |
Ga0318520_110145802 | 3300031897 | Soil | GAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0310916_102014651 | 3300031942 | Soil | VLQNTYAVRPYPAWDLASLALWTAVGVGFAAWRFRWHS |
Ga0318559_102011223 | 3300032039 | Soil | SRMVAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0318559_102995033 | 3300032039 | Soil | LQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS |
Ga0318575_103592362 | 3300032055 | Soil | LVAAFPVKALAEVLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS |
Ga0318524_102018991 | 3300032067 | Soil | ELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0318524_102196301 | 3300032067 | Soil | SGMVAAFPVKALAQLMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT |
Ga0318524_103140081 | 3300032067 | Soil | NTYAVRPYPAWDLASLALWTAVGVGFAAWRFRWHS |
Ga0318524_107793442 | 3300032067 | Soil | RMVAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHN |
Ga0318553_106900341 | 3300032068 | Soil | AELMQGAYAARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0306924_103657361 | 3300032076 | Soil | MQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0318525_102056363 | 3300032089 | Soil | LMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS |
Ga0318518_104754661 | 3300032090 | Soil | NAYAVRPFPAWDLVNLGLWTAAGAAFAVWRFRWHS |
Ga0311301_110073633 | 3300032160 | Peatlands Soil | EVLENAYAVRPFPAWDLANLALWTAAGATFAVWRFRWHS |
Ga0307471_1027499502 | 3300032180 | Hardwood Forest Soil | VKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT |
Ga0307472_1005735593 | 3300032205 | Hardwood Forest Soil | ALAEVLQNTYVVRPYPAWDLASLALWTAVGAGFAAWRFRWHS |
Ga0335085_125889242 | 3300032770 | Soil | AAFPVKALAEILQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS |
Ga0335075_1000837714 | 3300032896 | Soil | VKALAQLLQGAYTVRPFPGWDLANLGLWTAAGVGFVAWRFRWHT |
Ga0335075_110851911 | 3300032896 | Soil | QNTYAVRPFPAWDVVNLGLWTVAGTAFVLWRFRWNS |
⦗Top⦘ |