NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032797

Metagenome / Metatranscriptome Family F032797

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032797
Family Type Metagenome / Metatranscriptome
Number of Sequences 179
Average Sequence Length 43 residues
Representative Sequence AEVLQNAYAVRPFPAWDLANLALWTAAGAVFAAWRFRWHS
Number of Associated Samples 149
Number of Associated Scaffolds 179

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.12 %
% of genes near scaffold ends (potentially truncated) 96.09 %
% of genes from short scaffolds (< 2000 bps) 93.30 %
Associated GOLD sequencing projects 141
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.123 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.961 % of family members)
Environment Ontology (ENVO) Unclassified
(25.140 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.458 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.12%    β-sheet: 0.00%    Coil/Unstructured: 55.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 179 Family Scaffolds
PF02566OsmC 60.89
PF04072LCM 9.50
PF03861ANTAR 2.23
PF00254FKBP_C 1.12
PF13561adh_short_C2 1.12
PF00248Aldo_ket_red 0.56
PF00106adh_short 0.56
PF01061ABC2_membrane 0.56
PF01847VHL 0.56
PF09339HTH_IclR 0.56
PF04226Transgly_assoc 0.56
PF02589LUD_dom 0.56
PF04075F420H2_quin_red 0.56
PF12680SnoaL_2 0.56
PF16124RecQ_Zn_bind 0.56
PF00926DHBP_synthase 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 179 Family Scaffolds
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 60.89
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 60.89
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 9.50
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 2.23
COG01083,4-dihydroxy-2-butanone 4-phosphate synthaseCoenzyme transport and metabolism [H] 0.56
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.12 %
UnclassifiedrootN/A17.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E01C43QVAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300003352|JGI26345J50200_1044818Not Available504Open in IMG/M
3300004082|Ga0062384_101242679Not Available543Open in IMG/M
3300004092|Ga0062389_100717978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1174Open in IMG/M
3300005334|Ga0068869_100267008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1372Open in IMG/M
3300005434|Ga0070709_10679381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales799Open in IMG/M
3300005456|Ga0070678_101563877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium619Open in IMG/M
3300005467|Ga0070706_100803612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300005541|Ga0070733_10775758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300005549|Ga0070704_101487819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300005591|Ga0070761_10501450Not Available749Open in IMG/M
3300005764|Ga0066903_103199530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces886Open in IMG/M
3300005843|Ga0068860_102291287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300005921|Ga0070766_11030488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae567Open in IMG/M
3300006028|Ga0070717_10740449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales894Open in IMG/M
3300006028|Ga0070717_12145269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300006052|Ga0075029_100172790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1338Open in IMG/M
3300006057|Ga0075026_100597122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300006059|Ga0075017_101194406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300006172|Ga0075018_10218655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales911Open in IMG/M
3300006175|Ga0070712_101826591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. TF02-7532Open in IMG/M
3300006176|Ga0070765_101196685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria718Open in IMG/M
3300006237|Ga0097621_101569106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300006755|Ga0079222_10379581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300006755|Ga0079222_10649629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300006804|Ga0079221_10193913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1107Open in IMG/M
3300006804|Ga0079221_10990137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300006806|Ga0079220_11392345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales594Open in IMG/M
3300006871|Ga0075434_101041919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
3300006954|Ga0079219_12444059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300007076|Ga0075435_101067537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300007258|Ga0099793_10184279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300009092|Ga0105250_10256981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300009520|Ga0116214_1439017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300009521|Ga0116222_1023501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2773Open in IMG/M
3300009525|Ga0116220_10282239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300009698|Ga0116216_10388053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300010343|Ga0074044_10308169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300010379|Ga0136449_103185848Not Available634Open in IMG/M
3300010379|Ga0136449_103576009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300010379|Ga0136449_104095083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300010401|Ga0134121_10602310Not Available1028Open in IMG/M
3300010876|Ga0126361_10340111Not Available663Open in IMG/M
3300012096|Ga0137389_10901788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300012207|Ga0137381_10406507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1188Open in IMG/M
3300012210|Ga0137378_10671871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300012356|Ga0137371_10482037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300012357|Ga0137384_10584946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300012361|Ga0137360_10657057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria899Open in IMG/M
3300012476|Ga0157344_1005892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300012491|Ga0157329_1030792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300012514|Ga0157330_1012561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria858Open in IMG/M
3300012951|Ga0164300_10144899Not Available1105Open in IMG/M
3300012960|Ga0164301_11914084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300012985|Ga0164308_10794271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300012989|Ga0164305_11063769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300013102|Ga0157371_10927110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300013104|Ga0157370_11739665Not Available560Open in IMG/M
3300013307|Ga0157372_13479723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300014969|Ga0157376_10711370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1010Open in IMG/M
3300015200|Ga0173480_11107993Not Available529Open in IMG/M
3300017822|Ga0187802_10179833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Natronosporangium → Natronosporangium hydrolyticum811Open in IMG/M
3300017822|Ga0187802_10221141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella aerolata730Open in IMG/M
3300017823|Ga0187818_10112303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1180Open in IMG/M
3300017924|Ga0187820_1130038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300017926|Ga0187807_1099421Not Available914Open in IMG/M
3300017932|Ga0187814_10006203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4804Open in IMG/M
3300017932|Ga0187814_10010096All Organisms → cellular organisms → Bacteria3691Open in IMG/M
3300017947|Ga0187785_10284816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300017970|Ga0187783_10771646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300017970|Ga0187783_11318808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300017973|Ga0187780_11331471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300017975|Ga0187782_10030728All Organisms → cellular organisms → Bacteria3902Open in IMG/M
3300017975|Ga0187782_10294015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1225Open in IMG/M
3300018012|Ga0187810_10078360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1277Open in IMG/M
3300018037|Ga0187883_10398240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300018038|Ga0187855_10361412All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300018085|Ga0187772_10299878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1101Open in IMG/M
3300018085|Ga0187772_11374745Not Available524Open in IMG/M
3300018086|Ga0187769_10145301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1734Open in IMG/M
3300018090|Ga0187770_10566521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria901Open in IMG/M
3300018433|Ga0066667_10895199Not Available763Open in IMG/M
3300020581|Ga0210399_10470853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300020582|Ga0210395_10443747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria976Open in IMG/M
3300020583|Ga0210401_10935383Not Available725Open in IMG/M
3300021171|Ga0210405_10098682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2304Open in IMG/M
3300021178|Ga0210408_10127340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2010Open in IMG/M
3300021180|Ga0210396_10267521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1517Open in IMG/M
3300021180|Ga0210396_11191316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300021404|Ga0210389_10175048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1669Open in IMG/M
3300021404|Ga0210389_11244041Not Available572Open in IMG/M
3300021407|Ga0210383_11081760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia678Open in IMG/M
3300021477|Ga0210398_10853194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300021477|Ga0210398_11409783Not Available544Open in IMG/M
3300021560|Ga0126371_11761377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium742Open in IMG/M
3300022528|Ga0242669_1086496Not Available589Open in IMG/M
3300025527|Ga0208714_1065912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii757Open in IMG/M
3300025898|Ga0207692_10387807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300025915|Ga0207693_11126440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. TF02-7595Open in IMG/M
3300025916|Ga0207663_10008277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5431Open in IMG/M
3300025927|Ga0207687_10749688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300025929|Ga0207664_10390900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1236Open in IMG/M
3300027024|Ga0207819_1043429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella aerolata544Open in IMG/M
3300027110|Ga0208488_1038390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300027604|Ga0208324_1159994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300027725|Ga0209178_1266736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300027795|Ga0209139_10076739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1172Open in IMG/M
3300027795|Ga0209139_10301514Not Available563Open in IMG/M
3300027855|Ga0209693_10342713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella aerolata725Open in IMG/M
3300027867|Ga0209167_10369326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300027869|Ga0209579_10216334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1027Open in IMG/M
3300027879|Ga0209169_10062203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1932Open in IMG/M
3300028381|Ga0268264_10997814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300028879|Ga0302229_10039612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2410Open in IMG/M
3300028906|Ga0308309_10532658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1017Open in IMG/M
3300029943|Ga0311340_10455327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1157Open in IMG/M
3300030503|Ga0311370_11344930Not Available760Open in IMG/M
3300030524|Ga0311357_10820139Not Available834Open in IMG/M
3300030598|Ga0210287_1216057Not Available534Open in IMG/M
3300030741|Ga0265459_10625264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1003Open in IMG/M
3300030741|Ga0265459_13791339Not Available530Open in IMG/M
3300030743|Ga0265461_13435836Not Available536Open in IMG/M
3300030848|Ga0075388_11168365Not Available543Open in IMG/M
3300031525|Ga0302326_10214454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3190Open in IMG/M
3300031564|Ga0318573_10070384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1747Open in IMG/M
3300031564|Ga0318573_10517485Not Available643Open in IMG/M
3300031640|Ga0318555_10237676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia984Open in IMG/M
3300031679|Ga0318561_10314478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia857Open in IMG/M
3300031680|Ga0318574_10606991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300031681|Ga0318572_10303787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300031681|Ga0318572_10325483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium910Open in IMG/M
3300031681|Ga0318572_10571937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300031682|Ga0318560_10267215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria920Open in IMG/M
3300031708|Ga0310686_107492086All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300031718|Ga0307474_10653572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300031723|Ga0318493_10199014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1056Open in IMG/M
3300031736|Ga0318501_10111851Not Available1373Open in IMG/M
3300031736|Ga0318501_10269920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300031744|Ga0306918_11278293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300031751|Ga0318494_10687185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300031754|Ga0307475_11532114Not Available511Open in IMG/M
3300031768|Ga0318509_10596750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300031769|Ga0318526_10149402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia949Open in IMG/M
3300031779|Ga0318566_10587843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300031781|Ga0318547_10537316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300031781|Ga0318547_10857329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300031781|Ga0318547_11044868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300031782|Ga0318552_10104483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1400Open in IMG/M
3300031819|Ga0318568_10245928Not Available1107Open in IMG/M
3300031831|Ga0318564_10490403Not Available534Open in IMG/M
3300031832|Ga0318499_10129485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M
3300031845|Ga0318511_10060590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1542Open in IMG/M
3300031845|Ga0318511_10069053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1456Open in IMG/M
3300031845|Ga0318511_10256544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300031846|Ga0318512_10195984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300031860|Ga0318495_10134010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1116Open in IMG/M
3300031890|Ga0306925_11296525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300031890|Ga0306925_11937595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300031893|Ga0318536_10468418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300031897|Ga0318520_11014580Not Available524Open in IMG/M
3300031942|Ga0310916_10201465All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300032039|Ga0318559_10201122Not Available916Open in IMG/M
3300032039|Ga0318559_10299503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300032055|Ga0318575_10359236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300032067|Ga0318524_10201899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1016Open in IMG/M
3300032067|Ga0318524_10219630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300032067|Ga0318524_10314008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium811Open in IMG/M
3300032067|Ga0318524_10779344Not Available505Open in IMG/M
3300032068|Ga0318553_10690034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300032076|Ga0306924_10365736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1653Open in IMG/M
3300032089|Ga0318525_10205636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1012Open in IMG/M
3300032090|Ga0318518_10475466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300032160|Ga0311301_11007363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1100Open in IMG/M
3300032180|Ga0307471_102749950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300032205|Ga0307472_100573559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria990Open in IMG/M
3300032770|Ga0335085_12588924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium501Open in IMG/M
3300032896|Ga0335075_10008377All Organisms → cellular organisms → Bacteria15843Open in IMG/M
3300032896|Ga0335075_11085191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.03%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.91%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.35%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.79%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.23%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.12%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.12%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.12%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.56%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.56%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.56%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300003352Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_012656902189573000Grass SoilVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWRAT
JGI26345J50200_104481823300003352Bog Forest SoilFPVKALAQLMQGGYAVRPFPAWDLVNLGLWTAIGAGFVAWRFRWHT*
Ga0062384_10124267913300004082Bog Forest SoilQLMQGAYTARPFPAWDLANLGLWTAAGMGFVVWRFRWNT*
Ga0062389_10071797833300004092Bog Forest SoilLSRLVAAFPVKALAQLMQGAYTARPFPAWDLANLGLWTAAGMGFVVWRFRWNT*
Ga0062389_10259866413300004092Bog Forest SoilGLPNWLSHLVAAFPVKPLAQVLENAYAARPFSALDLLNLGLWAAAGAGFAAWRFRWHS*
Ga0068869_10026700823300005334Miscanthus RhizosphereVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT*
Ga0070709_1067938133300005434Corn, Switchgrass And Miscanthus RhizosphereKALAEVLQNTYAVRPFPAWDLLNLALWTVAGAAVAVWRFRWHS*
Ga0070678_10156387713300005456Miscanthus RhizosphereRLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT*
Ga0070706_10080361213300005467Corn, Switchgrass And Miscanthus RhizosphereVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAS*
Ga0070733_1077575823300005541Surface SoilVKALAQVLQNAYAVRPFPAWDLLNLALWTAAGAAFTTWRFRWDS*
Ga0070704_10148781923300005549Corn, Switchgrass And Miscanthus RhizosphereSRLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT*
Ga0070761_1050145013300005591SoilKALAEVLQNAYAVRPFPPWALANLALWTAAGAVFALWRFRWHS*
Ga0066903_10319953013300005764Tropical Forest SoilLVAAFPVKALAEVLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHT*
Ga0068860_10229128713300005843Switchgrass RhizosphereLQNAYAVRPLPPWNLANLGLWTAAGAVFAVWRFRWHAT*
Ga0070766_1103048823300005921SoilLAQLMQGAYTVRPFPAWDLVNLGAWTAAGAGFVAWRFRWHS*
Ga0070717_1074044923300006028Corn, Switchgrass And Miscanthus RhizosphereFPVKALAEVLQNAYAVRPFPAWNLANLALWTAAGAVFAVWRFRWHAT*
Ga0070717_1214526923300006028Corn, Switchgrass And Miscanthus RhizosphereLVDTFPVKALAEVLQNAYAVRPFPAWELVNLGLWTAAGAVFAVWRFRWHTT*
Ga0075029_10017279013300006052WatershedsNAYAVRPFPAWDLANLALWTAAGATFAAWRFRWHS*
Ga0075026_10059712233300006057WatershedsAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS*
Ga0075017_10119440613300006059WatershedsVLENAYAVRPFPAWDLANLALWTAAGATFAVWRFRWHS*
Ga0075018_1021865513300006172WatershedsVKALAEVLQNAYAVRPFPAWELANLGLWTAAGAVFAVWRFRWHAT*
Ga0070712_10182659113300006175Corn, Switchgrass And Miscanthus RhizosphereRLVATFPVKALAEVLQNAYAVRPFPALNLVNLALWTAAGAVFTVWRFRWHS*
Ga0070765_10119668533300006176SoilPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHVS*
Ga0097621_10156910623300006237Miscanthus RhizosphereYAVRPFPPWNLANLGLWTAAGAVFAVWRFRWHAT*
Ga0079222_1037958143300006755Agricultural SoilVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFVTWRFRWHAK*
Ga0079222_1064962913300006755Agricultural SoilFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS*
Ga0079221_1019391333300006804Agricultural SoilYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS*
Ga0079221_1099013723300006804Agricultural SoilLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT*
Ga0079220_1139234523300006806Agricultural SoilVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS*
Ga0075434_10104191923300006871Populus RhizosphereNAYAVRPFPAWNLANLGLWTAAGAVFVIWRFRWHAK*
Ga0079219_1244405923300006954Agricultural SoilLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAM*
Ga0075435_10106753723300007076Populus RhizosphereAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT*
Ga0099793_1018427923300007258Vadose Zone SoilMFPVKALAEVLQNAYAVRPFPAWELANLGLWTAAGAVFAVWRFRWHG*
Ga0105250_1025698123300009092Switchgrass RhizosphereNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT*
Ga0116214_143901723300009520Peatlands SoilNAYAVRPFPAWDLLNLALWTAAGAAFTAWRFRWHT*
Ga0116222_102350123300009521Peatlands SoilMVAAFPVKALAQLMQGAYTARPFPAWDLANLGLWTAAGVGFVAWRFRWHT*
Ga0116220_1028223913300009525Peatlands SoilTFPVKALAEVLQNAYAVRPFPAWDLANLALWTAAGAVFAAWRFRWHS*
Ga0116216_1038805333300009698Peatlands SoilAQVLQNAYAVRPFPAWDLLNLALWTAAGAAFTAWRFRWHT*
Ga0074044_1030816913300010343Bog Forest SoilLAQVLENAYAARPFSALDLVNLGLWTAAGAGFAAWRFRWHS*
Ga0136449_10318584813300010379Peatlands SoilAEVLQNAYAVRPFPAWDLANLALWTAAGAVFAAWRFRWHS*
Ga0136449_10357600923300010379Peatlands SoilKALAEVLQNAYAVRPFPAWDLANLALWTAAGATFAAWRFRWHS*
Ga0136449_10409508323300010379Peatlands SoilFPVKALAEVLENAYAVRPFPAWDLANLALWTAAGATFAAWRFRWHS*
Ga0134121_1060231023300010401Terrestrial SoilEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT*
Ga0126361_1034011113300010876Boreal Forest SoilLVAAFPVKALAQLMQGAYTVRPFPAWDLANLALWTALGAAFVTWRFRWQT*
Ga0137389_1090178823300012096Vadose Zone SoilQVLQNAYAVRPFPAWDLANLGLWTAAGAGIAVWRFRWHS*
Ga0137381_1040650733300012207Vadose Zone SoilVKALADVLQNAYAVRPFPAWDLVNLALWTAGGAAFAVWRFRWHS*
Ga0137378_1067187133300012210Vadose Zone SoilPVKALAEVLQNAYAVRPFPAWDLANLALWTAAGAVFAVWRFRWHS*
Ga0137371_1048203723300012356Vadose Zone SoilPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS*
Ga0137384_1058494613300012357Vadose Zone SoilFPVKALAEVLQNAYAVRPFPAWDLVNLGLWMAAGAAFAAWRFRWHG*
Ga0137360_1065705733300012361Vadose Zone SoilPVKALAEVLQNAYAVRPLPAWDLANLCLWTAAGAVFAVWRFRWHAS*
Ga0157344_100589213300012476Arabidopsis RhizosphereHLVALFPVKALAEVLQNTYAVRPYPAWDLASLALWTAVGAGFAAWRFRWHAK*
Ga0157329_103079223300012491Arabidopsis RhizosphereVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT*
Ga0157330_101256113300012514SoilPDWLSRLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT*
Ga0164300_1014489913300012951SoilAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT*
Ga0164301_1191408423300012960SoilMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS*
Ga0164308_1079427113300012985SoilMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT*
Ga0164305_1106376923300012989SoilRLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT*
Ga0157371_1092711023300013102Corn RhizosphereKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT*
Ga0157370_1173966523300013104Corn RhizosphereVLQNAYAVRPFPAWNLANLGLWTAAGAAFVIWRFRWHAT*
Ga0157372_1347972323300013307Corn RhizosphereVLQNAYAVRPFPAWNLANLGLWTAAGAVFAIWRFRWHAT*
Ga0157376_1071137013300014969Miscanthus RhizosphereMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAA*
Ga0173480_1110799313300015200SoilEVLQNAYAVRPFPAWNLANLGLWTAAGAFFAIWRFRWHAT*
Ga0187802_1017983313300017822Freshwater SedimentALAQLLQGAYTARPFPAWDLANLALWTAAGVGFVAWRFRWHT
Ga0187802_1022114113300017822Freshwater SedimentMVAAFPVKALAQLMQGAYTARPFPAWDLANLGLWTAAGVGFVAWRFRWHT
Ga0187818_1011230333300017823Freshwater SedimentFPVKALAEVLENAYAARPFPAWDLANLALWTAAGATFAAWRFRWHS
Ga0187820_113003813300017924Freshwater SedimentVLQNAYAVRPFPAWDLLNLALWTAAGAAFTAWRFRWHT
Ga0187807_109942113300017926Freshwater SedimentLMQGAYTVRPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0187814_1000620313300017932Freshwater SedimentLMQGASTARPFPAWGLANLALWTAAGAGFVAWRFRWHT
Ga0187814_1001009613300017932Freshwater SedimentFPVKALAQLMQGAYTVRPFPAWDLANLALWTAAGVGFVAWRFRWHT
Ga0187785_1028481633300017947Tropical PeatlandPVKALAEVLQNTYAVRPYPAWDLASLALWAAVGAGFAAWRFRWHS
Ga0187783_1077164623300017970Tropical PeatlandVAAFPVKSLAQVLQNAYAVRPFPAWDLANLALWTAAGAGFTAWRFRWHT
Ga0187783_1131880823300017970Tropical PeatlandFPVKSLAEVLQNAYAVRPFPAWDLLNLALWTAAGAAFAAWRFRWHN
Ga0187780_1133147123300017973Tropical PeatlandALAQLLEGAYTVRPFPAWDLVNLGVWTAAAAGFVAWRFRWHG
Ga0187782_1003072853300017975Tropical PeatlandLAQLLQGAYTARPFPGWDLVNLGLWTAAGAGFVAWRFRWHS
Ga0187782_1029401523300017975Tropical PeatlandMVDAFPVKSLAQVLEGAYTMRPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0187810_1007836013300018012Freshwater SedimentQLMQGAYTARPFPAWDLANLGLWTAAGVGFVAWRFRWHT
Ga0187883_1039824013300018037PeatlandQNAYAVRPFPAWDLANLALWTAAGATFAVWRFRWHS
Ga0187855_1036141213300018038PeatlandQVLQNAYAVRPFPAWDLVNLGLWTAAGASFAVWRFRWHS
Ga0187772_1029987813300018085Tropical PeatlandKALAQLLQGAYTARPFPGWDLVNLGLWTAAGAGFVAWRFRWHS
Ga0187772_1137474523300018085Tropical PeatlandFPVKALAQLLQGAYTVRPFPAWDLMNLGLWTAAGAGFVAWRFRWHN
Ga0187769_1014530113300018086Tropical PeatlandQLMQGAYTVRPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0187770_1056652113300018090Tropical PeatlandFPVKALAQLMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0066667_1089519913300018433Grasslands SoilNAYAVRPFPAWNLANLALWTAGGAAVAVWRFRWHS
Ga0210399_1047085333300020581SoilLVAAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT
Ga0210395_1044374713300020582SoilAAFPVKALAEVLQNAYAVRPFPPWALANLALWTAAGAVFALWRFRWQS
Ga0210401_1093538333300020583SoilQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT
Ga0210405_1009868243300021171SoilKLMQGGYTVRPFPAWDLVNLALWTAAGAGFVAWRFRWHS
Ga0210408_1012734033300021178SoilAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS
Ga0210396_1026752113300021180SoilMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT
Ga0210396_1119131623300021180SoilNAYAVRPFPPWNLANLGLWTAAGAVFAVWRFRWHAT
Ga0210389_1017504843300021404SoilAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT
Ga0210389_1124404113300021404SoilPVKALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVAWRFRWHT
Ga0210383_1108176023300021407SoilGAYTARPFPAWDLANLGLWTAAGAALAVWRFRWHS
Ga0210398_1085319433300021477SoilQGAYTVRPFPAWDLANLALWTTLGVGFVAWRFRWHT
Ga0210398_1140978313300021477SoilVLQNAYAVRPFPPWALANLALWTAAGAVFALWRFRWQS
Ga0126371_1176137713300021560Tropical Forest SoilRLVAAFPIKALAEILQNTYAVRPFPAWDLLNLALWTLAGAAFATWRFRWHT
Ga0242669_108649623300022528SoilVAAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVAWRFRWHT
Ga0208714_106591223300025527Arctic Peat SoilLAEVLQNTYAVRPFPAWDLANLALWTAAGAAFAAWRFRWHS
Ga0207692_1038780713300025898Corn, Switchgrass And Miscanthus RhizosphereMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAS
Ga0207693_1112644023300025915Corn, Switchgrass And Miscanthus RhizosphereRLVATFPVKALAEVLQNAYAVRPFPALNLVNLALWTAAGAVFTVWRFRWHS
Ga0207663_1000827773300025916Corn, Switchgrass And Miscanthus RhizosphereVPGKALAEVLQNTYAVRPFPAWDLLNLALWTVAGAAVAVWRFRWHS
Ga0207687_1074968823300025927Miscanthus RhizosphereALAEVLQNAYAVRPLPPWNLANLGLWTAAGAVFAVWRFRWHAT
Ga0207664_1039090013300025929Agricultural SoilPVRALAQVLRSAYTTTTFPAWDLLNLALWTVAGACFVAWRFRWHT
Ga0207819_104342923300027024Tropical Forest SoilLVQAFPVKALAQLLQGAYTVRPFPAWDLVNLGLWTAAGAGFVAWRFRWHG
Ga0208488_103839013300027110Forest SoilNAYAVRPFTAWDLASLGLWTAAGACFAIWRFRWQN
Ga0208324_115999413300027604Peatlands SoilFPVKALAEVLENAYAVRPFPAWDLANLALWTAAGATFAVWRFRWHS
Ga0209178_126673623300027725Agricultural SoilKALAEVLQNTYAVRPFPAWDLLNLALWTVAGAAVAVWRFRWHS
Ga0209139_1007673933300027795Bog Forest SoilLSRLVAAFPIHALAQVLQNAYAARPFSAWDLANLGLWTAAGAALAVWRFRWHS
Ga0209139_1030151423300027795Bog Forest SoilKALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVAWRFRWHT
Ga0209693_1034271333300027855SoilALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVVWRFRWHT
Ga0209167_1036932613300027867Surface SoilPVKALAQVLQNAYAVRPFPAWDLLNLALWTAAGAAFTTWRFRWDS
Ga0209579_1021633413300027869Surface SoilQVLQNAYAVRPFPAWDLLNLVLWTAAGAAFTAWRFRWHT
Ga0209169_1006220343300027879SoilLAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT
Ga0268264_1099781413300028381Switchgrass RhizosphereEVLQNAYAVRPLPPWNLANLGLWTAAGAVFAVWRFRWHAT
Ga0302229_1003961213300028879PalsaVLQGAYTARPFPAWDLVNLGLWTAAGAAVAVWRFRWHS
Ga0308309_1053265833300028906SoilERLVDMFPVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT
Ga0311340_1045532733300029943PalsaFPVKSLAQILQNAYAVRPFSPWDLANLGLWTVAGASFTAWRFRWHS
Ga0311370_1134493023300030503PalsaAQLMQGGYTVRPFPAWDLANLALWTAIGAGLVAWRFRWHT
Ga0311357_1082013933300030524PalsaAFPVKALAQLMQGAYTARPFPTWDLANLALWTAAGVGFVAWRFRWDT
Ga0210287_121605713300030598SoilAQLLQGGYAVRPFPAWDLANLGLWTVIGAGFVAWRFRWHT
Ga0265459_1062526413300030741SoilMQGAYTVRPFPAWDLANLALWTAIGAGLVAWRFRWHT
Ga0265459_1379133923300030741SoilLMQGGYAVRPFPAWDLANLGLWTALGAGFVAWRFRWHT
Ga0265461_1343583613300030743SoilQLLQGAYTARPFPAWDLANLALWTAVGVCFVAWRFRWNT
Ga0075388_1116836523300030848SoilAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT
Ga0302326_1021445473300031525PalsaLAQVLQGAYTARPFPAWDLVNLGLWTAAGAAVAVWRFRWHS
Ga0318573_1007038413300031564SoilLMQGAYTARPFPAWDLANLALWTAAGVGFVTWRFRWHT
Ga0318573_1051748513300031564SoilFPVKALTELMQGAYTARPFPAWDLANLALWTAAGVGFVAWRFRWHT
Ga0318555_1023767613300031640SoilALFPVKALAEVLQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS
Ga0318561_1031447813300031679SoilVLQNAYAVRPFPAWDVVNLALWTAAGAAFAAWRFRWHN
Ga0318574_1060699113300031680SoilLLQGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG
Ga0318572_1030378733300031681SoilVKALAEILQNTYAVRPFPAWDLANLALWTAGGAAVAAWRFRWHS
Ga0318572_1032548333300031681SoilAELLQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0318572_1057193713300031681SoilRLVAAFPVKALAEVLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHT
Ga0318560_1026721533300031682SoilEILQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS
Ga0310686_10749208643300031708SoilMQGAYTVRPFPAWDLVNLAAWTAAGASFVAWRFRWHS
Ga0307474_1065357233300031718Hardwood Forest SoilVTAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGAGFVAWRFRWHT
Ga0318493_1019901413300031723SoilQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS
Ga0318501_1011185143300031736SoilVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0318501_1026992013300031736SoilVAAFPVKALAEILQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS
Ga0306918_1127829313300031744SoilQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0318494_1068718513300031751SoilQNTYAVRPYPAWDLASLALWTAVGVGFAAWRFRWHS
Ga0307475_1153211423300031754Hardwood Forest SoilDRLVTAFPVKALAQVMQGAYTVRPFPAWDLANLALWTALGVGFVAWRFRWHT
Ga0318509_1059675013300031768SoilLAQLLQGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG
Ga0318526_1014940233300031769SoilVLQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS
Ga0318566_1058784313300031779SoilAQLLQGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG
Ga0318547_1053731613300031781SoilRMVAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0318547_1085732913300031781SoilAEILQNTYAVRPFPAWDLANLALWTAGGAAVAAWRFRWHS
Ga0318547_1104486823300031781SoilLLQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0318552_1010448313300031782SoilAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0318568_1024592833300031819SoilALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0318564_1049040313300031831SoilQGAYTARPFPAWDLANLALWTAAGACFVAWRFRWHT
Ga0318499_1012948523300031832SoilVKALAQLLQGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG
Ga0318511_1006059033300031845SoilLQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS
Ga0318511_1006905313300031845SoilVAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGVGFVTWRFRWHT
Ga0318511_1025654413300031845SoilVAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0318512_1019598413300031846SoilVLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHT
Ga0318495_1013401033300031860SoilALAEVLQNTYAVRPYPTWDLASLALWTAVGVGFAAWRFRWHS
Ga0306925_1129652513300031890SoilAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0306925_1193759513300031890SoilNAYAIRPFPAWDLVNLGLWTAAGAAFAVWRFRWHS
Ga0318536_1046841813300031893SoilGAYTVRPFPGWDLVNLGLWTAAGAGFVVWRFRWHG
Ga0318520_1101458023300031897SoilGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0310916_1020146513300031942SoilVLQNTYAVRPYPAWDLASLALWTAVGVGFAAWRFRWHS
Ga0318559_1020112233300032039SoilSRMVAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0318559_1029950333300032039SoilLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS
Ga0318575_1035923623300032055SoilLVAAFPVKALAEVLQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS
Ga0318524_1020189913300032067SoilELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0318524_1021963013300032067SoilSGMVAAFPVKALAQLMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHT
Ga0318524_1031400813300032067SoilNTYAVRPYPAWDLASLALWTAVGVGFAAWRFRWHS
Ga0318524_1077934423300032067SoilRMVAAFPVKALAELMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHN
Ga0318553_1069003413300032068SoilAELMQGAYAARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0306924_1036573613300032076SoilMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0318525_1020563633300032089SoilLMQGAYTARPFPAWDLANLALWTAAGAGFVAWRFRWHS
Ga0318518_1047546613300032090SoilNAYAVRPFPAWDLVNLGLWTAAGAAFAVWRFRWHS
Ga0311301_1100736333300032160Peatlands SoilEVLENAYAVRPFPAWDLANLALWTAAGATFAVWRFRWHS
Ga0307471_10274995023300032180Hardwood Forest SoilVKALAEVLQNAYAVRPFPAWNLANLGLWTAAGAVFAVWRFRWHAT
Ga0307472_10057355933300032205Hardwood Forest SoilALAEVLQNTYVVRPYPAWDLASLALWTAVGAGFAAWRFRWHS
Ga0335085_1258892423300032770SoilAAFPVKALAEILQNTYAVRPFPAWDLANLALWTAGGAAVAVWRFRWHS
Ga0335075_10008377143300032896SoilVKALAQLLQGAYTVRPFPGWDLANLGLWTAAGVGFVAWRFRWHT
Ga0335075_1108519113300032896SoilQNTYAVRPFPAWDVVNLGLWTVAGTAFVLWRFRWNS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.