NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032814

Metagenome / Metatranscriptome Family F032814

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032814
Family Type Metagenome / Metatranscriptome
Number of Sequences 179
Average Sequence Length 42 residues
Representative Sequence MDYTKLNCPPFTAEEAAMIQSTRIRVGRNLADFPLGPGISRE
Number of Associated Samples 139
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 20.22 %
% of genes near scaffold ends (potentially truncated) 36.31 %
% of genes from short scaffolds (< 2000 bps) 74.86 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (68.715 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(7.821 % of family members)
Environment Ontology (ENVO) Unclassified
(32.961 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(41.899 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.29%    β-sheet: 0.00%    Coil/Unstructured: 75.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF00217ATP-gua_Ptrans 71.35
PF02807ATP-gua_PtransN 11.11
PF10262Rdx 1.17

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG3869Protein-arginine kinase McsBPosttranslational modification, protein turnover, chaperones [O] 71.35

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.47 %
UnclassifiedrootN/A14.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459014|G1P06HT01B48W8All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea614Open in IMG/M
3300000557|SL_8KL_010_SEDDRAFT_10046617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Moritellaceae → Moritella → unclassified Moritella → Moritella sp.2024Open in IMG/M
3300000557|SL_8KL_010_SEDDRAFT_10046617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Moritellaceae → Moritella → unclassified Moritella → Moritella sp.2024Open in IMG/M
3300002835|B570J40625_101066870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300004112|Ga0065166_10181891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida819Open in IMG/M
3300004128|Ga0066180_10350089All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter584Open in IMG/M
3300004463|Ga0063356_101453344All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter1012Open in IMG/M
3300004765|Ga0007745_1296287Not Available552Open in IMG/M
3300004767|Ga0007750_1552833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Sulfurospirillum → Sulfurospirillum arcachonense2854Open in IMG/M
3300004767|Ga0007750_1552833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Sulfurospirillum → Sulfurospirillum arcachonense2854Open in IMG/M
3300004769|Ga0007748_11266541All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300004769|Ga0007748_11356583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae736Open in IMG/M
3300004794|Ga0007751_11266424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1124Open in IMG/M
3300004795|Ga0007756_11535096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1053Open in IMG/M
3300004810|Ga0007757_11275092All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales569Open in IMG/M
3300005662|Ga0078894_10065583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter3121Open in IMG/M
3300005662|Ga0078894_10221653Not Available1713Open in IMG/M
3300005961|Ga0075157_10390776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida521Open in IMG/M
3300005987|Ga0075158_10021779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3880Open in IMG/M
3300005987|Ga0075158_10146252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1366Open in IMG/M
3300005987|Ga0075158_10193101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1172Open in IMG/M
3300005987|Ga0075158_10311743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida891Open in IMG/M
3300005988|Ga0075160_10020088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Sulfurovaceae3623Open in IMG/M
3300005988|Ga0075160_10081943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1774Open in IMG/M
3300005989|Ga0075154_10034488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3156Open in IMG/M
3300005989|Ga0075154_10091281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1823Open in IMG/M
3300006129|Ga0007834_1126516All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica526Open in IMG/M
3300006165|Ga0075443_10301183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales589Open in IMG/M
3300006356|Ga0075487_1265573Not Available602Open in IMG/M
3300006419|Ga0075496_1495683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae815Open in IMG/M
3300006805|Ga0075464_10023153All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria3238Open in IMG/M
3300007242|Ga0075172_1347257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae500Open in IMG/M
3300007513|Ga0105019_1012271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea6735Open in IMG/M
3300007513|Ga0105019_1012271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea6735Open in IMG/M
3300007513|Ga0105019_1012271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea6735Open in IMG/M
3300007667|Ga0102910_1106959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300007722|Ga0105051_11214157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae535Open in IMG/M
3300007860|Ga0105735_1011113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1490Open in IMG/M
3300007860|Ga0105735_1027689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1050Open in IMG/M
3300007862|Ga0105737_1205392Not Available521Open in IMG/M
3300007955|Ga0105740_1023353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea873Open in IMG/M
3300007958|Ga0105743_1027752Not Available599Open in IMG/M
3300008021|Ga0102922_1048287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1324Open in IMG/M
3300008107|Ga0114340_1025235All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales2763Open in IMG/M
3300008108|Ga0114341_10018399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae5025Open in IMG/M
3300008116|Ga0114350_1195691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300008117|Ga0114351_1111585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1574Open in IMG/M
3300008119|Ga0114354_1018263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales3183Open in IMG/M
3300008119|Ga0114354_1018263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales3183Open in IMG/M
3300008119|Ga0114354_1033611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2260Open in IMG/M
3300008119|Ga0114354_1092859Not Available1856Open in IMG/M
3300009071|Ga0115566_10500620Not Available689Open in IMG/M
3300009151|Ga0114962_10708154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300009154|Ga0114963_10363895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum791Open in IMG/M
3300009160|Ga0114981_10298560Not Available874Open in IMG/M
3300009180|Ga0114979_10700451Not Available573Open in IMG/M
3300009218|Ga0103848_1095408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida599Open in IMG/M
3300009422|Ga0114998_10408005Not Available635Open in IMG/M
3300009436|Ga0115008_10826795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300009442|Ga0115563_1340724Not Available540Open in IMG/M
3300009455|Ga0114939_10033664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2281Open in IMG/M
3300009495|Ga0115571_1145138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii999Open in IMG/M
3300009538|Ga0129287_10011240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida4212Open in IMG/M
3300009592|Ga0115101_1336959All Organisms → cellular organisms → Eukaryota3458Open in IMG/M
3300009599|Ga0115103_1459831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2680Open in IMG/M
3300009599|Ga0115103_1614158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2165Open in IMG/M
3300009608|Ga0115100_10244113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida978Open in IMG/M
3300009677|Ga0115104_10692013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300009785|Ga0115001_10172755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1404Open in IMG/M
3300010430|Ga0118733_109372430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii504Open in IMG/M
3300010883|Ga0133547_11814700Not Available1127Open in IMG/M
3300010885|Ga0133913_10508059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3175Open in IMG/M
3300012030|Ga0136599_1019098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum992Open in IMG/M
3300012415|Ga0138263_1239360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea628Open in IMG/M
3300012504|Ga0129347_1017634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria1182Open in IMG/M
3300012504|Ga0129347_1126484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1267Open in IMG/M
3300012520|Ga0129344_1279872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales2590Open in IMG/M
3300012525|Ga0129353_1961838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300012528|Ga0129352_10135878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1038Open in IMG/M
3300012711|Ga0157607_1231119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1323Open in IMG/M
3300012715|Ga0157599_1087162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1145Open in IMG/M
3300012723|Ga0157604_1147755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1965Open in IMG/M
3300012731|Ga0157616_1151418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea594Open in IMG/M
3300012756|Ga0138272_1153727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2942Open in IMG/M
3300012782|Ga0138268_1624667Not Available770Open in IMG/M
3300012952|Ga0163180_11538459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300013006|Ga0164294_10900458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae595Open in IMG/M
3300013087|Ga0163212_1202355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae621Open in IMG/M
3300013295|Ga0170791_16077813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300014493|Ga0182016_10275002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1042Open in IMG/M
3300017299|Ga0186338_1001274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria2985Open in IMG/M
3300017788|Ga0169931_10077258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea3334Open in IMG/M
3300018871|Ga0192978_1011542All Organisms → cellular organisms → Eukaryota1507Open in IMG/M
3300019048|Ga0192981_10218126Not Available740Open in IMG/M
3300019117|Ga0193054_1010356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales1236Open in IMG/M
3300019150|Ga0194244_10044945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea708Open in IMG/M
3300020109|Ga0194112_10781391All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica627Open in IMG/M
3300020146|Ga0196977_1002204All Organisms → cellular organisms → Eukaryota6357Open in IMG/M
3300020146|Ga0196977_1002204All Organisms → cellular organisms → Eukaryota6357Open in IMG/M
3300020146|Ga0196977_1007791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2696Open in IMG/M
3300020183|Ga0194115_10042350All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales2999Open in IMG/M
3300020190|Ga0194118_10067473All Organisms → cellular organisms → Eukaryota2279Open in IMG/M
3300020193|Ga0194131_10063646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2299Open in IMG/M
3300020196|Ga0194124_10097581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1680Open in IMG/M
3300020196|Ga0194124_10471235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii556Open in IMG/M
3300020204|Ga0194116_10040743All Organisms → cellular organisms → Eukaryota3435Open in IMG/M
3300020204|Ga0194116_10175680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1251Open in IMG/M
3300020204|Ga0194116_10436503Not Available636Open in IMG/M
3300020205|Ga0211731_10171339Not Available1511Open in IMG/M
3300020205|Ga0211731_10257468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea712Open in IMG/M
3300020205|Ga0211731_10339697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea827Open in IMG/M
3300020205|Ga0211731_11470836All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria1888Open in IMG/M
3300020578|Ga0194129_10086642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2186Open in IMG/M
3300021092|Ga0194122_10053611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2408Open in IMG/M
3300021093|Ga0194123_10202051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1015Open in IMG/M
3300021350|Ga0206692_1060602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria1449Open in IMG/M
3300021376|Ga0194130_10115554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1717Open in IMG/M
3300022074|Ga0224906_1149782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300025890|Ga0209631_10382298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida657Open in IMG/M
3300026448|Ga0247594_1059772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea658Open in IMG/M
3300026513|Ga0247590_1097253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea761Open in IMG/M
3300027720|Ga0209617_10125902Not Available1019Open in IMG/M
3300027720|Ga0209617_10189670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida796Open in IMG/M
3300027749|Ga0209084_1064202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter1715Open in IMG/M
3300027760|Ga0209598_10328998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae587Open in IMG/M
3300027770|Ga0209086_10189459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida957Open in IMG/M
3300027781|Ga0209175_10015239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3223Open in IMG/M
3300027781|Ga0209175_10029587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2322Open in IMG/M
3300027781|Ga0209175_10046391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1847Open in IMG/M
3300027784|Ga0207421_10012291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae8155Open in IMG/M
3300027784|Ga0207421_10012291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae8155Open in IMG/M
3300027784|Ga0207421_10012291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae8155Open in IMG/M
3300027810|Ga0209302_10520705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300027851|Ga0209066_10294549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae911Open in IMG/M
3300028137|Ga0256412_1102305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1041Open in IMG/M
3300028282|Ga0256413_1118348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum962Open in IMG/M
3300028282|Ga0256413_1222201Not Available675Open in IMG/M
3300028282|Ga0256413_1301464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea564Open in IMG/M
3300028412|Ga0306910_1020770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1126Open in IMG/M
(restricted) 3300028559|Ga0247831_1085476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1429Open in IMG/M
3300028864|Ga0302215_10099161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1241Open in IMG/M
3300029989|Ga0311365_10786766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida823Open in IMG/M
3300030528|Ga0210277_10582308All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica1192Open in IMG/M
3300030528|Ga0210277_10856554Not Available1163Open in IMG/M
3300030594|Ga0210280_1033396All Organisms → cellular organisms → Eukaryota811Open in IMG/M
3300030595|Ga0210276_11076315All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica820Open in IMG/M
3300030709|Ga0307400_10698809Not Available630Open in IMG/M
3300030788|Ga0073964_11745444All Organisms → Viruses → Predicted Viral1435Open in IMG/M
3300030849|Ga0075393_10808541All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica531Open in IMG/M
3300030909|Ga0074033_11029630Not Available866Open in IMG/M
3300031122|Ga0170822_10746244Not Available755Open in IMG/M
3300031231|Ga0170824_110898740Not Available907Open in IMG/M
3300031261|Ga0302140_10725909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida722Open in IMG/M
3300031269|Ga0307983_1027391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1201Open in IMG/M
3300031580|Ga0308132_1104388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300031622|Ga0302126_10308555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii532Open in IMG/M
3300031638|Ga0302125_10102822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii936Open in IMG/M
3300031737|Ga0307387_10001730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea4481Open in IMG/M
3300031738|Ga0307384_10113798Not Available1121Open in IMG/M
3300031750|Ga0307389_10010292All Organisms → cellular organisms → Bacteria → Proteobacteria3018Open in IMG/M
3300031758|Ga0315907_10939593All Organisms → cellular organisms → Eukaryota631Open in IMG/M
3300031784|Ga0315899_10215140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1931Open in IMG/M
3300031784|Ga0315899_10595200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1044Open in IMG/M
3300031784|Ga0315899_11351289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Moritellaceae → Moritella → unclassified Moritella → Moritella sp. PE36607Open in IMG/M
3300031784|Ga0315899_11713172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae516Open in IMG/M
3300032463|Ga0314684_10110173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1391Open in IMG/M
3300032463|Ga0314684_10193243Not Available1128Open in IMG/M
3300032617|Ga0314683_10011995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales3088Open in IMG/M
3300032617|Ga0314683_10368146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea898Open in IMG/M
3300032739|Ga0315741_10607307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida919Open in IMG/M
3300032742|Ga0314710_10440707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300032748|Ga0314713_10040731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1558Open in IMG/M
3300033572|Ga0307390_10613651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea679Open in IMG/M
3300034068|Ga0334990_0315289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum849Open in IMG/M
3300034105|Ga0335035_0149773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1471Open in IMG/M
3300034355|Ga0335039_0254481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida947Open in IMG/M
3300034355|Ga0335039_0276726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea897Open in IMG/M
3300034355|Ga0335039_0395925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae710Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.26%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent7.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.70%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.03%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.47%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.91%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.35%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.79%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.79%
Alkaline SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment2.79%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.12%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.12%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.12%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.12%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.12%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.12%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.68%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.68%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.56%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.56%
WatershedsEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds0.56%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.56%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.56%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.56%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.56%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.56%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.56%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.56%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.56%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.56%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.56%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459014Litter degradation PV2EngineeredOpen in IMG/M
3300000557Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SEDEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004128Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004765Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004810Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005961Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNAEngineeredOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006129Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007242Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007958Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0umEnvironmentalOpen in IMG/M
3300008021Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009218Microbial communities of water from Amazon river, Brazil - RCM1EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009455Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal SpringEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012030Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012711Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012715Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012723Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300017299Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 405 ?mol photons light - Strombidinopsis acuminata SPMC142 (MMETSP0126)Host-AssociatedOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027784Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027851Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300028864Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_1EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030585Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030849Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031269Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
2PV_018145802170459014Switchgrass, Maize And Mischanthus LitterMHADMLKTPPLPEDEAAMIKSTRIRVGRNLANYPLGP
SL_8KL_010_SEDDRAFT_1004661723300000557Alkaline SedimentMDSSKLICPPLFQANDANNMIVSTRIRVGRNLAEFPLGPGLTREQR*
SL_8KL_010_SEDDRAFT_1004661733300000557Alkaline SedimentMDFTKLNTPPFEAEEAKLIKSTRIRVGRNLAEYPLGPGLTKE*
B570J40625_10106687023300002835FreshwaterMDHTQLNCPPFSEEDAKMIRSTRIRVGRNLADFPLGPGLTRE*
Ga0065166_1018189123300004112Freshwater LakeMESSKLNAPPFPEEDGKFIISTRIRVGRNLADYPLGPGITND*
Ga0066180_1035008913300004128Freshwater LakeMDYTKLNCPPFSKEEAALIVSTRIRVGRNLADFPLGPGISRE*
Ga0063356_10145334413300004463Arabidopsis Thaliana RhizosphereMDYTKLQCPPLKNSEAKMIRSTRIRVGRNLADYPLGPGLSKE*
Ga0007745_129628713300004765Freshwater LakeMDHTQLKCPPFSDEDAKMIKSTRIRVGRNLAGYPLGPGLSKEQ
Ga0007750_155283323300004767Freshwater LakeMDYTKLNCPPFTKEEASLIVSTRIRVGRNLADFPLGPGISRE*
Ga0007750_155283343300004767Freshwater LakeMDYTKLNCPPFTEEEKAFIVSTRIRVGRNLADFPLGPGISRE*
Ga0007748_1126654113300004769Freshwater LakeMDYSKLNCPPFTAEESALIVSTRIRVGRNLKDFPLGPGISKE*
Ga0007748_1135658313300004769Freshwater LakeADKHSSDMDATKINAPPFTGEDAEMIKSTRIRVGRNLADFPLGPGISNL*
Ga0007751_1126642413300004794Freshwater LakeMDYKKLNCPPLTEEQASMIVSTRIRVGRNLADFPLGPGISRE*
Ga0007756_1153509653300004795Freshwater LakeMESSKLNAPPLPEEEAKLIISTRIRVGRNLADYPLGPGITNE*
Ga0007757_1127509223300004810Freshwater LakeMDYTKLNCPPFKKEEASLIVSTRIRVGRNLADFPLGPGISRE*
Ga0078894_1006558373300005662Freshwater LakeMDYTKLSCPPFTAQESALIVSTRIRVGRNLKDFPLGPGISKE*
Ga0078894_1022165333300005662Freshwater LakeMDASKLNAPPFAPEDAAMIVSTRIRVGRNLADYPLGPALTKE*
Ga0075157_1039077623300005961Wastewater EffluentMTTSKLNAPPFPKADAKMIRSTRIRVGRNLHGFPLGPGITN
Ga0075158_1002177943300005987Wastewater EffluentVSDMDYKKLHCPPFDESDAKMIKSTRIRVGRNLADYPLGPGLTK*
Ga0075158_1014625213300005987Wastewater EffluentMDSAALNAPPFPEEDGAMIISTRIRVGRNLADYPL
Ga0075158_1019310133300005987Wastewater EffluentMDYKKLHCPPFDESDAKMIKSTRIRVGRNLAEYPLGPGLTQ*
Ga0075158_1031174323300005987Wastewater EffluentMDSSALDAPPLPEEDGAMIISTRIRVGRNLADYPLGPGITNA*
Ga0075160_1002008883300005988Wastewater EffluentMDYTKLECPPLRNSEAKLIRSTRIRVGRNLADYPLGPGLTNE*
Ga0075160_1008194313300005988Wastewater EffluentLSKTIMATVDAKHVSDMDYTKLECPPLRNSEAKLIRSTRIRVGRNLADYPLGPGLTKE*
Ga0075154_1003448813300005989Wastewater EffluentMDSAALNAPPFPEEDGAMIISTRIRVGRNLADYPLGPGITNE*
Ga0075154_1009128113300005989Wastewater EffluentMDSSALDAPPLPEEDGAMIISTRIRVGRNLADYPLGPGI
Ga0007834_112651613300006129FreshwaterMDYKKLNCPPLTEEQASMIVSTRIRVGRNLADFPLGP
Ga0075443_1030118323300006165MarinePFAPDEAAMIVSTRIRVGRNLADFPLGPGVSKAQRD*
Ga0075487_126557313300006356AqueousMDHSKLDCPPFSEEDSKMILSTRIRVGRNLADFPLGPGISKE*
Ga0075496_149568333300006419AqueousMDHKALKCPPFSPDEAAMIVSTRIRVGRNLAEYPLGPGVSKAQRD
Ga0075464_1002315363300006805AqueousMDHTQLNCPPFPEEDAIMIKSTRIRVGRNLKAFPLGPGISRE*
Ga0075172_134725733300007242Wastewater EffluentTPPFEAKEAKLIKSTRIRVGRNLAGYPLGPGLNKE*
Ga0105019_1012271173300007513MarineMNFEELECPPFSDDDASMIISTRIRVGRNLADFPLGPGITKE*
Ga0105019_101227163300007513MarineMDFTQLKCPPFTEDEAAMILSTRIRVGRNLADFPLGPGVSK*
Ga0105019_101227193300007513MarineMDYGQLKCPPLKAEDAAMILSTRIRVGRNLADVPLGPGITKE*
Ga0102910_110695933300007667EstuarineMDYTKLNCPPFTAEEAAMIVSTRIRVGRNLADLPLGPGISKEKR
Ga0105051_1121415713300007722FreshwaterHQSDMDFTKLNCPPFTDKEAKRIKSTRIRVGRNLKDYPLGPGLTKE*
Ga0105735_101111353300007860Estuary WaterNMDHTQLNCPPFPEEDAIMIKSTRIRVGRNLKAFPLGPGISRE*
Ga0105735_102768933300007860Estuary WaterMDFSKLNCPPFSEEDAKMIRSTRIRIGRNLKAYPLGPGITREGRNAVEAAA*
Ga0105737_120539213300007862Estuary WaterTQLECPPFSEEDAEMIVSTRIRVGRNLAEFPLGPGISKE*
Ga0105740_102335323300007955Estuary WaterMNYKELVCPPFSEVEKGMIISTRIRVGRNLADYPLGPGITKE*
Ga0105743_102775213300007958Estuary WaterMNYKELKCPPFSKEEAARIISTRIRVGRNMADVPLGPGITKD*
Ga0102922_104828723300008021EstuarineKIDAGHVSNMDHTQLNCPPFSEEDAKMIKSTRIRVGRNLADFPLGPGLTRE*
Ga0114340_102523533300008107Freshwater, PlanktonMDATKLVAPPFSQEDASMIKSTRIRVGRNLDGYPLGPGITNE*
Ga0114341_1001839983300008108Freshwater, PlanktonMDYTKLNCPPFTDEEAALIVSTRIRVGRNLKDFPLGPGISKE*
Ga0114350_119569113300008116Freshwater, PlanktonMDYTKLNCPPFTEEENAMIVSTRIRVGRNLADFPLGPGI*
Ga0114351_111158513300008117Freshwater, PlanktonMDYTKLNCPPFTEEENAMIVSTRIRVGRNLADFPLGPGISRE*
Ga0114354_101826323300008119Freshwater, PlanktonMDYTKLNCPPFTAEEAAMIQSTRIRVGRNLADFPLGPGISRE*
Ga0114354_101826353300008119Freshwater, PlanktonMDYTKLNCPPFTEEESKMIQSTRIRVGRNLADFPLGPGISRE*
Ga0114354_103361153300008119Freshwater, PlanktonMDYTKLNCPPFTSEEAAMIQSTRIRVGRNLADFPLGPGISRE*
Ga0114354_109285913300008119Freshwater, PlanktonMDYTKLNCPPFTEEESKMIQSTRIRVGRNLADFPLGPGISKD*
Ga0115566_1050062013300009071Pelagic MarineKCPPFSADEAAMIVSTRIRVGRNLADFPLGPGVTKA*
Ga0114962_1070815423300009151Freshwater LakeMDYTKLNCPPFIKEEAALIVSTRIRVGRNLADFPLGPGISRE*
Ga0114963_1036389523300009154Freshwater LakeMDYTKLNCPPFTKEEAALIVSTRIRVGRNLADFPLGPGISRE*
Ga0114981_1029856013300009160Freshwater LakeMDFSKLNCPPFSEEDAKMIKSTRIRIGRNLKAYPLGPGITREGRNAVEAAA*
Ga0114979_1070045113300009180Freshwater LakeCPPFSKEEAALIVSTRIRVGRNLADFPLGPGISRE*
Ga0103848_109540813300009218River WaterNISDMDYKKLNCPPLTEEQASMIVSTRIRVGRNLADFPLGPGISRE*
Ga0114998_1040800513300009422MarineTKLKCPPFPADEAAMIVSTRIRVGRNLADYPLGPGVTKE*
Ga0115008_1082679513300009436MarineMDYTQLKCPPFTADEASMIVSTRIRVGRNLADYPLGPGVTKV*
Ga0115563_134072423300009442Pelagic MarinePFSEEEAAMIISTRIRVGRNLAEFPLGPGVTKEQRN*
Ga0114939_1003366423300009455GroundwaterMDSSKLNAPPFPAEEAAMIVSTRIRVGRNLADYPLGPGITNE*
Ga0115571_114513813300009495Pelagic MarineLDCPPFSPEDASMIVSTRIRVGRNLAEFPLGPGISKV*
Ga0129287_1001124043300009538Beach Aquifer PorewaterMNYEELDCPPFADDEAAMIKSTRIRVGRNLADYPLGPGISRE*
Ga0115101_133695913300009592MarineMNYKELKCPPFTKEEAARIISTRIRVGRNLADVPLGPGITKE*
Ga0115103_145983113300009599MarineSNMNYKELKCPPFTKEEAARIISTRIRVGRNLADVPLGPGITKE*
Ga0115103_161415843300009599MarineMNYEELDCPPFTEDEAAMILSTRIRVGRNVEGFPLGPSITKE*
Ga0115100_1024411323300009608MarineMNYKELKWPPFSKEEAARIISTRIRVGRNMADVPLGPGITKD*
Ga0115104_1069201333300009677MarineMDYNQLQCPPLKAEDAAMILSTRIRVGRNLADVPLGPGISKA*
Ga0115001_1017275543300009785MarineMDHTQLKCPPFTADEAEMILSTRIRVGRNLAAYPLGPGITKE*
Ga0118733_10937243023300010430Marine SedimentMDYTKLNCPPLPADEAAMINSTRIRVGRNLADFPLGPGITKEQRD*
Ga0133547_1181470023300010883MarineMDYTQLKCPPFTADESAMILSTRIRVGRNLAEFPLGPGISKE*
Ga0133913_1050805943300010885Freshwater LakeMDATKINAPPFTGEDAEMIKSTRIRVGRNLADFPLGPGISNL*
Ga0136599_101909823300012030Saline LakeMNFQDLACPPFEPEDAAMILSTRIRVGRNMADFPLGPGVSKDQRN*
Ga0138263_123936023300012415Polar MarineMDHTKLKCPPFSKEDDAMIISTRIRVGRNLAAYPLGPGITGPQR
Ga0129347_101763423300012504AqueousMNYKDLKCPPFSADEAAMIVSTRIRVGRNLADYPLGPGVTKA*
Ga0129347_112648423300012504AqueousMDHKQLKCPPFSPEDAARIVSTRIRVGRNLADFPLGPGVTKA*
Ga0129344_127987273300012520AqueousMDYTQLNCPPFTELEASMILSTRIRVGRNLADYPLGPGVSKE*
Ga0129353_196183813300012525AqueousMDYTQLNCPPFTELEASMILSTRIRVGRNLADYPL
Ga0129352_1013587813300012528AqueousLNCPPFTELEASMILSTRIRVGRNLADYPLGPGVSKE*
Ga0157607_123111913300012711FreshwaterMDYEKLVCPPFDDEDAKMIKSTRIRVGRNLAKFPLGPGITREQRN*
Ga0157599_108716213300012715FreshwaterMDYEKLVCPPFDDEDAKMIKSTRIRVGRNLAKFPLGPG
Ga0157604_114775513300012723FreshwaterMDYEKLVCPPFDDEDAKMIKSTRIRVGRNLAKFPLGP
Ga0157616_115141813300012731FreshwaterYEKLVCPPFDDEDAKMIKSTRIRVGRNLAKFPLGPGITREQRN*
Ga0138272_115372743300012756Freshwater LakeMDATKLVAPPFSQEDAAMIKSTRIRVGRNLDGYPLGPGITNE*
Ga0138268_162466713300012782Polar MarineGDLKCPPFAPDEAAMIVSTRIRVGRNLAEFPLGPGVSKAQRD*
Ga0163180_1153845923300012952SeawaterMDYTQLKCPPLKAEDAAMILSTRIRVGRNLAEVPLGPGITKE*
Ga0164294_1090045823300013006FreshwaterMDYKKLNTPPLPEEDAKMIKSTRIRVGRNLADYPLGPGLSKE*
Ga0163212_120235523300013087FreshwaterMDFSKLNTPSLPEADAKMIKSTRIRVGRNLADYPLGPGLTKE*
Ga0170791_1607781313300013295FreshwaterMDYTKLNCPPFTEEESKMIVSTRIRVGRNLADFPLGPGISKE*
Ga0182016_1027500213300014493BogMDASKLNAPPFAPEDAAMIVSTRIRVGRNLADFPLGPALTKE*
Ga0186338_100127443300017299Host-AssociatedMDAAKVNAPPFPEDEAKMIRSTRIRVGRNLADFPLGPGLKRE
Ga0169931_1007725853300017788FreshwaterMDYTKLNCPPFTPEDARMIRSTRIRIGRNLKAFPLGPGITREGRN
Ga0192978_101154223300018871MarineMDYTQLKCPPFTADESSMILSTRIRVGRNLADFPLGPGISKD
Ga0192981_1021812623300019048MarineMDYTKLDCPPFNAEDSAMILSTRIRVGRNLADFPLGPGISKE
Ga0193054_101035613300019117MarineMDWESLDCPELDEEDAAMIVSTRIRVGRNLAEFPLGPGVTKE
Ga0194244_1004494513300019150MarineLKCPPFSADEAAMIISTRIRVGRNLAEFPLGPGVTKV
Ga0194112_1078139113300020109Freshwater LakeMNASELSCPPLPEDEQAMIVSTRIRVGRNLEGYPLAPGVTNAQRIEIM
Ga0196977_100220423300020146SoilMDPTKLNCPPLEEDEAAMIVSTRIRVGRNLADFPLGPALTKE
Ga0196977_100220473300020146SoilMDYKKLHTPPFPEEEAKLIRSTRIRVGRNLADFPLGPGITRD
Ga0196977_100779143300020146SoilMTVAKINAPALTGEDAAMIKSTRIRVGRNLADFPLGPGITND
Ga0194115_1004235023300020183Freshwater LakeMDYTKLNCPPFTAEESALIVSTRIRVGRNLKDFPLGPGISKE
Ga0194118_1006747333300020190Freshwater LakeMDHTQLKCPPFEEEDAAMIKSTRIRVGRNLAAYPLGPGLTRE
Ga0194131_1006364633300020193Freshwater LakeMDHTQLNCPPFSAEDAAMIKSTRIRVGRNLARFPLGPGLTREMRNNI
Ga0194124_1009758113300020196Freshwater LakeMDYTKLNCPPFEAEDAKMIRSTRIRIGRNLKAYPG
Ga0194124_1047123513300020196Freshwater LakeMDYTKLNCPPFSAEESALIVSTRIRVGRNLEHFPLGPGISKE
Ga0194116_1004074363300020204Freshwater LakeMDHTQLECPPFEEEDAAMIKSTRIRVGRNLAAYPLGPGLTRE
Ga0194116_1017568013300020204Freshwater LakeMDATKLIAPPFSEEDAAMIKSTRIRVGRNLDGYPLGPGITDQ
Ga0194116_1043650313300020204Freshwater LakeMDHTQLNCPPFSAEDAAMIKSTRIRVGRNLAKFPLGPGLTREQR
Ga0211731_1017133933300020205FreshwaterMDYTKLNCPPFTEEESKMIQSTRIRVGRNLADFPLGPGISKD
Ga0211731_1025746813300020205FreshwaterVSDMDYTKLNCPPFTEEESKMIVSTRIRVGRNLADFPLGPGISKE
Ga0211731_1033969723300020205FreshwaterMDYTKLNCPPFTEEESKMIQSTRIRVGRNLADFPLGPGISRE
Ga0211731_1147083623300020205FreshwaterMDYTKLNCPPFTSEEAAMIQSTRIRVGRNLAYFPLGPGISRE
Ga0194129_1008664243300020578Freshwater LakeMDYTQLNCPPFSAEDAAMIKSTRIRVGRNLAGFPLGPGLTREMRNNI
Ga0194122_1005361133300021092Freshwater LakeMDYTKLNCPPFEAEDAKMIRSTRIRIGRNLKAYPL
Ga0194123_1020205123300021093Freshwater LakeVSDMDYTKLNCPPFTAEESALIVSTRIRVGRNLKDFPLGPGISKE
Ga0206692_106060233300021350SeawaterMDYTQLKCPPFSAEDSAMILSTRIRVGRNLADVPLGPGISKE
Ga0194130_1011555433300021376Freshwater LakeMDHTQLNCPPFEEEDAAMIKSTRIRVGRNLAAYPLGPGLTRE
Ga0224906_114978223300022074SeawaterMNYKELDCPPFSEVEAGMILSTRIRVGRNLADYPLGPGITKE
Ga0209631_1038229823300025890Pelagic MarineMDHSKLDCPPFSEEDSKMILSTRIRVGRNLADFPLGPGISKE
Ga0247594_105977213300026448SeawaterMNYKELKCPPFTKEEAARIISTRIRVGRNLADVPVGPGITKE
Ga0247590_109725333300026513SeawaterMDFNQLKCPPLKAEDANMIISTRIRVGRNLADVPLGPGISK
Ga0209617_1012590213300027720Freshwater And SedimentMDYTKLNCPPFTKEEASLIVSTRIRVGRNLADFPLGPGISRE
Ga0209617_1018967013300027720Freshwater And SedimentCPPFSEEDAKMIRSTRIRVGRNLADFPLGPGLTRE
Ga0209084_106420213300027749Freshwater LakeMDYTKLNCPPFTEEEKAFIVSTRIRVGRNLADFPLGPGI
Ga0209598_1032899813300027760Freshwater LakeMDYKKLNTPPFSEDEAKLIKSTRIRVGRNLADYPLGPGLTKEQ
Ga0209086_1018945913300027770Freshwater LakeSKLIAPPFSEEDAKMIKSTRIRVGRNLEGFPLGPGISNEQRL
Ga0209175_1001523943300027781Wastewater EffluentMDSAALNAPPFPEEDGAMIISTRIRVGRNLADYPLGPGITNE
Ga0209175_1002958723300027781Wastewater EffluentMDYKKLHCPPFDESDAKMIKSTRIRVGRNLAEYPLGPGLTQ
Ga0209175_1004639133300027781Wastewater EffluentMDSSALDAPPLPEEDGAMIISTRIRVGRNLADYPLGPGITNA
Ga0207421_10012291103300027784Alkaline SedimentMDFTKLNTPPFEAEEAKLIKSTRIRVGRNLAEYPLGPGLTKE
Ga0207421_10012291113300027784Alkaline SedimentMDSSKLICPPLFQANDANNMIVSTRIRVGRNLAEFPLGPGLTREQR
Ga0207421_1001229153300027784Alkaline SedimentMDYTKLNAPALPADEAAMIKSTRIRVGRNLADYPLGPGLNQK
Ga0209302_1052070523300027810MarineMDYTQLKCPPFTADEASMIVSTRIRVGRNLADYPLGPGVTKV
Ga0209066_1029454913300027851WatershedsLQCPPFAEAEAKLIRSTRIRVGRNLADYPLGPGVSRE
Ga0256412_110230513300028137SeawaterLKCPPFSADEAAMIVSTRIRVGRNLADFPLGPGVTKA
Ga0256413_111834833300028282SeawaterMDYNQLQCPPLKAEDAAMILSTRIRVGRNLADVPLGPGISKA
Ga0256413_122220113300028282SeawaterKHVSNMDHTKLKCPPFPPDEAAMIVSTRIRVGRNLADFPLGPGVTKA
Ga0256413_130146413300028282SeawaterMNYKELNCPPFTADESARILSTRIRVGRNLADYPLGPGITKE
Ga0306910_102077023300028412Saline LakeMNFQDLACPPFEPEDAAMILSTRIRVGRNMADFPLGPGVSKDQRN
(restricted) Ga0247831_108547623300028559FreshwaterMDATKINAPPFTGEDAEMIKSTRIRVGRNLADFPLGPGISNL
Ga0302215_1009916123300028864FenMDYKKLVCPPLPEDEARMIKSTRIRVGRNLADYPLGPGLSKE
Ga0311365_1078676623300029989FenMTVTRVNAPPFAEEDAKMIKSTRIRVGRNLKGFPLGPGVTNE
Ga0210277_1058230813300030528SoilMDYKKLNCPKFPEDEDKMINSTRIRVGRNLADYPLGSGVSRE
Ga0210277_1085655423300030528SoilMDYKKLDCPRFPEDEDKMINSTRIRVGRNLADYPLGTGISKEQR
Ga0247639_111564933300030585SoilHRSDMDYTKLNCPKLASDEDAMINSTRIRVGRNLADYPLGTAATK
Ga0210280_103339613300030594SoilCPRFPEDEDKMINSTRIRVGRNLADYPLGTGISKEQR
Ga0210276_1107631513300030595SoilYKKLNCPKFPEDEDKMINSTRIRVGRNLADYPLGSGVSRE
Ga0307400_1069880923300030709MarineKHADLKCPPFAPEEAAMIVSTRIRVGRNLAEFPLGPGVSKAQRD
Ga0073964_1174544423300030788MarineMDFTKLNIEPFTGEEASMILSTRIRVGRNLKDFPLGPGISRE
Ga0075393_1080854123300030849SoilMDYTKLKCPKFPQDEDKMINSTRIRVGRNLAEYPLGPGVSKS
Ga0074033_1102963013300030909SoilHTAKHVSDMTIKSLKAPPFSEEDAAFIKSTRVRVGRNLAGYPLGPGITN
Ga0170822_1074624413300031122Forest SoilSKLKCDPFTPEEEAMIISTRIRVGRNLKDFPLGPAITD
Ga0170824_11089874013300031231Forest SoilPKNAKHVTDMDASKLKCDPFTPEEEAMIISTRIRVGRNLKDFPLGPAITD
Ga0302140_1072590913300031261BogMESAALKAEPFSEEDSKMIVSTRIRVGRNLHGLPLGPGITNE
Ga0307983_102739123300031269Saline WaterMDFKTLKCPPFSAEDGAMILSTRIRVGRNMADFPLGPGVSKDQRN
Ga0308132_110438813300031580MarineMDYTQLKCPPFTADEAAMILSTRIRVGRNMAEVPLGPGISKE
Ga0302126_1030855523300031622MarineHVSDMDYTKLQCPPFPAEDAAMIKSTRIRVGRNLADYPLGPGITRE
Ga0302125_1010282223300031638MarineAQHVSDMDYTKLQCPPFPAEDAAMIKSTRIRVGRNLADYPLGPGITRE
Ga0307387_1000173023300031737MarineMDYTQLNCPPFTSDEAAMILSTRIRVGRNLAEFPLGPGITKEQRD
Ga0307384_1011379823300031738MarineMDYNKLNCEPFSEEDAKMILSTRIRVARNLADFPLGTGISRE
Ga0307389_1001029223300031750MarineMDYTQLNCPPFTSDEAAMILSTRIRVGRNLADVPLGPGITKEQRD
Ga0315907_1093959323300031758FreshwaterMDYTKLNCPPFTEEENAMIVSTRIRVGRNLADFPLGPGISRE
Ga0315899_1021514013300031784FreshwaterMDYTKLNCPPFTKEEADLIVSTRIRVGRNLADFPLGPGISR
Ga0315899_1059520013300031784FreshwaterMDYSKLNCPPFSAEEAALIVSTRIRVGRNLKDFPLGPGISKE
Ga0315899_1135128913300031784FreshwaterELNCPEFSPDEAAMIVSTRIRVGRNLADYPLGPGITNAQRIEVMERVT
Ga0315899_1171317223300031784FreshwaterKLNCPPFTAEEAALIVSTRIRVGRNLKDFPLGPGISKE
Ga0314684_1011017323300032463SeawaterKLKCPAFPPDEAAMIVSTRIRVGRNLAEFPLGPGVSKAQRD
Ga0314684_1019324313300032463SeawaterMNYKDLKCPPFSADEAAMIVSTRIRVGRNLAEFPLGPGVTKT
Ga0314683_1001199533300032617SeawaterMDHTQLNAPPFSEDDAKMIRSTRIRVGRNLADFPLGPGITKEQRL
Ga0314683_1036814613300032617SeawaterMKHTDLKCPPFAPDEAAMIVSTRIRVGRNLAAFPLGPGVSK
Ga0315741_1060730723300032739Forest SoilMDATKLNCPPLSEEDEKRIVSTRIRVGRNLADFPLGPQLTKE
Ga0314710_1044070733300032742SeawaterMNYKELVCPPFTEQEASMILSTRIRVGRNLAEFPLGPGIT
Ga0314713_1004073133300032748SeawaterMNYKDLKCPPFSADEAVMIVSTRIRVGRNLAEFPLGPGVTKT
Ga0307390_1061365123300033572MarineMNHEELNCPPFSPEDASMILSTRIRVGRNLAEFPLGP
Ga0334990_0315289_464_5923300034068FreshwaterMDFKLLKCPPLTGSDASMIVSTRIRVGRNLEDFPLGPGISKE
Ga0335035_0149773_286_4143300034105FreshwaterMDFKLLKCPPLTESDASMIVSTRIRVGRNLADFPLGPGISKE
Ga0335039_0254481_819_9473300034355FreshwaterMDHTQLNCPPFSEEDAKMIRSTRIRVGRNLADFPLGPGLTRE
Ga0335039_0276726_41_1693300034355FreshwaterMNASKLNAPPFNEEDSKMIVSTRIRVGRNLAEFPLGPGLTGE
Ga0335039_0395925_91_2193300034355FreshwaterMDYKKLNTPPFEAKEASLIKSTRIRVGRNLAGYPLGPGLSKE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.