Basic Information | |
---|---|
Family ID | F032952 |
Family Type | Metagenome |
Number of Sequences | 178 |
Average Sequence Length | 41 residues |
Representative Sequence | QSLIPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKT |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 178 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 1.12 % |
% of genes near scaffold ends (potentially truncated) | 94.94 % |
% of genes from short scaffolds (< 2000 bps) | 91.57 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (52.247 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (37.640 % of family members) |
Environment Ontology (ENVO) | Unclassified (77.528 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.910 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 178 Family Scaffolds |
---|---|---|
PF13539 | Peptidase_M15_4 | 8.43 |
PF00268 | Ribonuc_red_sm | 3.93 |
PF08291 | Peptidase_M15_3 | 3.93 |
PF02627 | CMD | 2.81 |
PF02776 | TPP_enzyme_N | 2.81 |
PF00959 | Phage_lysozyme | 2.25 |
PF10926 | DUF2800 | 1.69 |
PF00149 | Metallophos | 1.69 |
PF09374 | PG_binding_3 | 1.69 |
PF11351 | GTA_holin_3TM | 1.69 |
PF13023 | HD_3 | 1.69 |
PF09588 | YqaJ | 1.12 |
PF14090 | HTH_39 | 1.12 |
PF01555 | N6_N4_Mtase | 1.12 |
PF00456 | Transketolase_N | 0.56 |
PF04851 | ResIII | 0.56 |
PF05866 | RusA | 0.56 |
PF13392 | HNH_3 | 0.56 |
PF13578 | Methyltransf_24 | 0.56 |
PF00578 | AhpC-TSA | 0.56 |
PF10991 | DUF2815 | 0.56 |
PF02195 | ParBc | 0.56 |
PF05838 | Glyco_hydro_108 | 0.56 |
PF01467 | CTP_transf_like | 0.56 |
PF01978 | TrmB | 0.56 |
PF00464 | SHMT | 0.56 |
PF03118 | RNA_pol_A_CTD | 0.56 |
PF01612 | DNA_pol_A_exo1 | 0.56 |
PF10504 | DUF2452 | 0.56 |
PF12849 | PBP_like_2 | 0.56 |
PF13640 | 2OG-FeII_Oxy_3 | 0.56 |
PF13936 | HTH_38 | 0.56 |
PF07102 | YbcO | 0.56 |
PF00487 | FA_desaturase | 0.56 |
PF11753 | DUF3310 | 0.56 |
PF04545 | Sigma70_r4 | 0.56 |
PF00176 | SNF2-rel_dom | 0.56 |
COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
---|---|---|---|
COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 3.93 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 2.81 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 2.81 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.12 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.12 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.12 |
COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.56 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.56 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.56 |
COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.56 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.56 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.56 |
COG3926 | Lysozyme family protein | General function prediction only [R] | 0.56 |
COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.56 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.42 % |
Unclassified | root | N/A | 32.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002278|B570J29590_102339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1396 | Open in IMG/M |
3300002408|B570J29032_108808238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300002408|B570J29032_109569042 | Not Available | 884 | Open in IMG/M |
3300002835|B570J40625_100378338 | Not Available | 1388 | Open in IMG/M |
3300005581|Ga0049081_10156421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → unclassified Magnetovibrio → Magnetovibrio sp. | 832 | Open in IMG/M |
3300005582|Ga0049080_10010420 | Not Available | 3223 | Open in IMG/M |
3300005582|Ga0049080_10197741 | Not Available | 665 | Open in IMG/M |
3300005582|Ga0049080_10283018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300005582|Ga0049080_10315553 | Not Available | 502 | Open in IMG/M |
3300005584|Ga0049082_10016927 | Not Available | 2501 | Open in IMG/M |
3300005584|Ga0049082_10259582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300005584|Ga0049082_10268451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300005940|Ga0073913_10093980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300006805|Ga0075464_10442826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300006920|Ga0070748_1058502 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300008110|Ga0114343_1198849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300008111|Ga0114344_1221385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300008261|Ga0114336_1028756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4578 | Open in IMG/M |
3300008267|Ga0114364_1071683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300008267|Ga0114364_1118106 | Not Available | 794 | Open in IMG/M |
3300008267|Ga0114364_1194708 | Not Available | 505 | Open in IMG/M |
3300008996|Ga0102831_1102355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
3300009051|Ga0102864_1109235 | Not Available | 755 | Open in IMG/M |
3300009068|Ga0114973_10473455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300009075|Ga0105090_11005805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300009152|Ga0114980_10228219 | Not Available | 1090 | Open in IMG/M |
3300009154|Ga0114963_10216692 | Not Available | 1100 | Open in IMG/M |
3300009155|Ga0114968_10511396 | Not Available | 644 | Open in IMG/M |
3300009158|Ga0114977_10192265 | Not Available | 1200 | Open in IMG/M |
3300009159|Ga0114978_10564050 | Not Available | 662 | Open in IMG/M |
3300009159|Ga0114978_10611988 | Not Available | 628 | Open in IMG/M |
3300009161|Ga0114966_10414509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300009163|Ga0114970_10108591 | Not Available | 1710 | Open in IMG/M |
3300009164|Ga0114975_10677174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300009165|Ga0105102_10285816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300009165|Ga0105102_10468557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300009169|Ga0105097_10514056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300009181|Ga0114969_10617784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300009182|Ga0114959_10156622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
3300009184|Ga0114976_10712703 | Not Available | 502 | Open in IMG/M |
3300010160|Ga0114967_10325981 | Not Available | 782 | Open in IMG/M |
3300010334|Ga0136644_10032798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3435 | Open in IMG/M |
3300010885|Ga0133913_11065786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED36 | 2084 | Open in IMG/M |
3300010885|Ga0133913_13219313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300011011|Ga0139556_1023654 | Not Available | 894 | Open in IMG/M |
3300012012|Ga0153799_1043921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300012013|Ga0153805_1079485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300012286|Ga0157137_104949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300013004|Ga0164293_11032504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → unclassified Magnetovibrio → Magnetovibrio sp. | 511 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10524294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300013295|Ga0170791_16204013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1984 | Open in IMG/M |
3300014811|Ga0119960_1020705 | Not Available | 842 | Open in IMG/M |
3300015050|Ga0181338_1021852 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300015050|Ga0181338_1036379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300015050|Ga0181338_1052138 | Not Available | 596 | Open in IMG/M |
3300015050|Ga0181338_1069135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300017716|Ga0181350_1045605 | Not Available | 1177 | Open in IMG/M |
3300017716|Ga0181350_1070974 | Not Available | 895 | Open in IMG/M |
3300017716|Ga0181350_1072956 | Not Available | 878 | Open in IMG/M |
3300017716|Ga0181350_1098394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300017716|Ga0181350_1149754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300017716|Ga0181350_1149885 | Not Available | 545 | Open in IMG/M |
3300017722|Ga0181347_1024019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1917 | Open in IMG/M |
3300017722|Ga0181347_1190011 | Not Available | 544 | Open in IMG/M |
3300017723|Ga0181362_1118950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300017736|Ga0181365_1023899 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
3300017736|Ga0181365_1083735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300017747|Ga0181352_1008557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3352 | Open in IMG/M |
3300017747|Ga0181352_1028740 | All Organisms → Viruses → Predicted Viral | 1686 | Open in IMG/M |
3300017747|Ga0181352_1062905 | Not Available | 1060 | Open in IMG/M |
3300017747|Ga0181352_1107723 | Not Available | 760 | Open in IMG/M |
3300017754|Ga0181344_1080510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
3300017754|Ga0181344_1118030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300017754|Ga0181344_1134439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300017754|Ga0181344_1192419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300017754|Ga0181344_1199432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300017754|Ga0181344_1238669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300017761|Ga0181356_1112833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
3300017761|Ga0181356_1193417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300017761|Ga0181356_1232499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300017766|Ga0181343_1047728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → unclassified Magnetovibrio → Magnetovibrio sp. | 1264 | Open in IMG/M |
3300017766|Ga0181343_1228978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300017774|Ga0181358_1122989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
3300017774|Ga0181358_1256304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300017777|Ga0181357_1000417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15860 | Open in IMG/M |
3300017777|Ga0181357_1041053 | All Organisms → Viruses → Predicted Viral | 1818 | Open in IMG/M |
3300017777|Ga0181357_1138825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300017777|Ga0181357_1151525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → unclassified Magnetovibrio → Magnetovibrio sp. | 854 | Open in IMG/M |
3300017777|Ga0181357_1180684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300017777|Ga0181357_1254622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300017777|Ga0181357_1279084 | Not Available | 573 | Open in IMG/M |
3300017777|Ga0181357_1337210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300017780|Ga0181346_1190917 | Not Available | 744 | Open in IMG/M |
3300017784|Ga0181348_1017061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3115 | Open in IMG/M |
3300017784|Ga0181348_1098192 | Not Available | 1145 | Open in IMG/M |
3300017784|Ga0181348_1223457 | Not Available | 663 | Open in IMG/M |
3300017784|Ga0181348_1238794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300017785|Ga0181355_1170412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → unclassified Magnetovibrio → Magnetovibrio sp. | 870 | Open in IMG/M |
3300017785|Ga0181355_1221064 | Not Available | 736 | Open in IMG/M |
3300017785|Ga0181355_1260425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300017785|Ga0181355_1279688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300017785|Ga0181355_1316806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300017785|Ga0181355_1322576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300017785|Ga0181355_1323807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300017785|Ga0181355_1362104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300019783|Ga0181361_100401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2440 | Open in IMG/M |
3300019784|Ga0181359_1195916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300020141|Ga0211732_1189372 | Not Available | 576 | Open in IMG/M |
3300020151|Ga0211736_10721217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Sulfurovaceae → Nitratifractor → Nitratifractor salsuginis → Nitratifractor salsuginis DSM 16511 | 685 | Open in IMG/M |
3300020159|Ga0211734_11009540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300020221|Ga0194127_10512792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
3300021424|Ga0194117_10502500 | Not Available | 541 | Open in IMG/M |
3300021962|Ga0222713_10349802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter asymbioticus | 925 | Open in IMG/M |
3300022179|Ga0181353_1016650 | Not Available | 1910 | Open in IMG/M |
3300022179|Ga0181353_1054819 | Not Available | 1038 | Open in IMG/M |
3300022190|Ga0181354_1007682 | Not Available | 3034 | Open in IMG/M |
3300022407|Ga0181351_1034524 | All Organisms → Viruses → Predicted Viral | 2146 | Open in IMG/M |
3300022407|Ga0181351_1096543 | Not Available | 1149 | Open in IMG/M |
3300023174|Ga0214921_10559968 | Not Available | 523 | Open in IMG/M |
3300023184|Ga0214919_10373043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300024346|Ga0244775_10244137 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
3300024346|Ga0244775_10827130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
3300027547|Ga0209864_1058464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300027627|Ga0208942_1129976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300027733|Ga0209297_1089110 | Not Available | 1335 | Open in IMG/M |
3300027734|Ga0209087_1131599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300027736|Ga0209190_1136462 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
3300027749|Ga0209084_1211900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300027772|Ga0209768_10068023 | Not Available | 1823 | Open in IMG/M |
3300027772|Ga0209768_10197375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
3300027785|Ga0209246_10062170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1447 | Open in IMG/M |
3300027785|Ga0209246_10106630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
3300027798|Ga0209353_10286600 | Not Available | 701 | Open in IMG/M |
3300027798|Ga0209353_10455067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300027892|Ga0209550_10172630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1510 | Open in IMG/M |
3300027963|Ga0209400_1249947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300028025|Ga0247723_1055661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
3300028394|Ga0304730_1118672 | Not Available | 1114 | Open in IMG/M |
(restricted) 3300028557|Ga0247832_1183575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1078531 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1092262 | Not Available | 1429 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1184978 | Not Available | 805 | Open in IMG/M |
3300029930|Ga0119944_1000607 | Not Available | 6411 | Open in IMG/M |
3300029933|Ga0119945_1000546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5601 | Open in IMG/M |
3300031784|Ga0315899_10430504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
3300031786|Ga0315908_11042402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300031787|Ga0315900_10390180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
3300031857|Ga0315909_10424033 | Not Available | 945 | Open in IMG/M |
3300031885|Ga0315285_10499265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300031999|Ga0315274_10808960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300031999|Ga0315274_11944401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300032046|Ga0315289_11321583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300032116|Ga0315903_10633353 | Not Available | 814 | Open in IMG/M |
3300032118|Ga0315277_11300256 | Not Available | 638 | Open in IMG/M |
3300033978|Ga0334977_0573383 | Not Available | 507 | Open in IMG/M |
3300033992|Ga0334992_0049012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2415 | Open in IMG/M |
3300033995|Ga0335003_0105315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1455 | Open in IMG/M |
3300033996|Ga0334979_0154390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1385 | Open in IMG/M |
3300033996|Ga0334979_0652223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300034018|Ga0334985_0784583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300034019|Ga0334998_0112153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1794 | Open in IMG/M |
3300034020|Ga0335002_0652161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300034022|Ga0335005_0199110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
3300034060|Ga0334983_0195058 | Not Available | 1259 | Open in IMG/M |
3300034062|Ga0334995_0415541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 837 | Open in IMG/M |
3300034062|Ga0334995_0614909 | Not Available | 628 | Open in IMG/M |
3300034064|Ga0335001_0482109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300034092|Ga0335010_0075972 | Not Available | 2310 | Open in IMG/M |
3300034092|Ga0335010_0329442 | Not Available | 863 | Open in IMG/M |
3300034102|Ga0335029_0465442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300034106|Ga0335036_0825542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300034106|Ga0335036_0892507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300034117|Ga0335033_0549076 | Not Available | 545 | Open in IMG/M |
3300034118|Ga0335053_0516445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300034121|Ga0335058_0485911 | Not Available | 702 | Open in IMG/M |
3300034284|Ga0335013_0786171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300034356|Ga0335048_0133134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1447 | Open in IMG/M |
3300034356|Ga0335048_0445427 | Not Available | 632 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 37.64% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.42% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.92% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.06% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.37% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.37% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.37% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.25% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.12% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.12% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.12% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.12% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.12% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.12% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.12% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.12% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.56% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.56% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.56% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.56% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012286 | Freshwater microbial communities from Ausable River, Ontario, Canada - S47 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29590_1023396 | 3300002278 | Freshwater | QSLIPAKTDFPDFQASRHIWTVDGSRKWAVGDDWFYDIGERHE* |
B570J29032_1088082381 | 3300002408 | Freshwater | PAETKFPDFQAAKEIWTVDGTRKWSAGDDWFYDIKEKL* |
B570J29032_1095690424 | 3300002408 | Freshwater | SETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKERA* |
B570J40625_1003783381 | 3300002835 | Freshwater | QSLISGNVKFPDFKAAQNLWTVDGTRKWSAGDDWFYTIEEKNE* |
Ga0049081_101564212 | 3300005581 | Freshwater Lentic | KFPDFQAAKDFYTVDGTRKWSAGDDWFYDIEEKSA* |
Ga0049080_100104209 | 3300005582 | Freshwater Lentic | KLPDFKAAQTIFTVDGTRKWTVGDDWFYTIEERKE* |
Ga0049080_101977413 | 3300005582 | Freshwater Lentic | YDQSLVPGETKFPDFQAAQQSWSVDGSRKWAAGADWFYSIDERPE* |
Ga0049080_102830181 | 3300005582 | Freshwater Lentic | SLVPADTKFPDFQAAQRLWTVDGTRKWSAGDDWFYNIEEKKT* |
Ga0049080_103155533 | 3300005582 | Freshwater Lentic | QAKFPDFQAAKTIYSVDGTRKWTAGDDWFYSINEHD* |
Ga0049082_100169271 | 3300005584 | Freshwater Lentic | LFYDQSLVAGKVKLPDFKAAQIIFSVDGTRKWTAIGDDWFYSIDERKE* |
Ga0049082_102595822 | 3300005584 | Freshwater Lentic | KFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKTT* |
Ga0049082_102684511 | 3300005584 | Freshwater Lentic | LISGVTKFPDFKAAQTIFTVDGTRKWSAGDDWFYSIEEKE* |
Ga0073913_100939803 | 3300005940 | Sand | IFPDFQASRHIWTVDGSRKWSAGDDWFYDIEAKHE* |
Ga0075464_104428263 | 3300006805 | Aqueous | LWYDQSLIPNDTKHPDFQAAQTFWTVDGTRKWTTGNDWFYNIEERV* |
Ga0070748_10585028 | 3300006920 | Aqueous | YDQSLIPAETKFPDFQAAQRLWTVDGTRKWSASDDWFYDIKEKKE* |
Ga0114343_11988491 | 3300008110 | Freshwater, Plankton | KFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKENA* |
Ga0114344_12213853 | 3300008111 | Freshwater, Plankton | KFPDFKAAQTIFTVDGTRKWSAGDDWFYSIEERT* |
Ga0114336_10287563 | 3300008261 | Freshwater, Plankton | MYQSLISGNVKFPDFKAAQTIFTVDGTRKWSAGDDWFYTIEEKNE* |
Ga0114364_10716831 | 3300008267 | Freshwater, Plankton | PAETKFPDFKAAQQFWTVDGTRKWSAGDDWFYDIQEKNT* |
Ga0114364_11181061 | 3300008267 | Freshwater, Plankton | QSLITADTKWPDFQAARTLWTVDGTRKWSAGDDWFYTIEEKNE* |
Ga0114364_11947081 | 3300008267 | Freshwater, Plankton | QSLITADTKWPDFQAARTLWTVDGTRKWSAGDDWFYTIKEKNE* |
Ga0102831_11023551 | 3300008996 | Estuarine | LIPSETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKERT* |
Ga0102864_11092352 | 3300009051 | Estuarine | QSLITPDTKWPDFPAARTLWTVDGTRKWSAGDDWFYTIEEKNE* |
Ga0114973_104734551 | 3300009068 | Freshwater Lake | IPAETKFPDFQAAQTFYTVDGTRKWSAGDDWFYDLKEKNA* |
Ga0105090_110058051 | 3300009075 | Freshwater Sediment | QSLIPGETKFPDFKAAKEFWTVDGTRKWSAGDDWFYDIKENT* |
Ga0114980_102282191 | 3300009152 | Freshwater Lake | AQTKFPDFQAAQHLWSVDGTRKWSAGDDWFYTIDEKHD* |
Ga0114963_102166921 | 3300009154 | Freshwater Lake | TETKFPDFQAAQTFWTVDGTRKWSAGEDWFYDIKEKND* |
Ga0114968_105113963 | 3300009155 | Freshwater Lake | PAETKFPDFQAAQTFWTVDGTRKWSAGNDWFYDIEEKND* |
Ga0114977_101922651 | 3300009158 | Freshwater Lake | QSLISGNVKFPDFQAAQTIFAVDGTRKWSAGDDWFYNIEERKE* |
Ga0114978_105640501 | 3300009159 | Freshwater Lake | CLWYDQSLVPVETKFPDFQAAQHLWSVDGTRKWSAEDDWFYTIEEKND* |
Ga0114978_106119882 | 3300009159 | Freshwater Lake | WYDQSLISSVTKFPDFKAAQTVFTVDGTRKWSAGDDWFYTIDEKK* |
Ga0114966_104145091 | 3300009161 | Freshwater Lake | LWYDQSLVPAQTKFPDFQAAQHLWSVDGTRKWSAGDDWFYTIEEKHD* |
Ga0114970_101085911 | 3300009163 | Freshwater Lake | SLIPNEVKFSDFQAAQRKWSVDGTRKWTTSNDWFYKTEEKND* |
Ga0114975_106771741 | 3300009164 | Freshwater Lake | RCLWYDQSLVPAETKFPDFQAAQTFWTVDGTRKWSAGEDWFYDIKEKND* |
Ga0105102_102858161 | 3300009165 | Freshwater Sediment | SLIPAEVKFPDFQAAKTFWTVDGTRKWSAGDDWFYDLKERT* |
Ga0105102_104685571 | 3300009165 | Freshwater Sediment | ETKFPDFQAAKACWTVDGTRKWSAGDDWFYDIKENT* |
Ga0105097_105140561 | 3300009169 | Freshwater Sediment | IPAETKWPDFQAAQHLWTVDGTRKWSAGDDWFYDVKERTSVQKENTK* |
Ga0114969_106177841 | 3300009181 | Freshwater Lake | DFRAAQTIFTVDGTRKWSAGDDWFYSIDAKNEPG* |
Ga0114959_101566224 | 3300009182 | Freshwater Lake | LWYDQSLIPNEVKFPDFQAAQRKWSVDGTRKWTTNNDWFYTTEEKND* |
Ga0114976_107127032 | 3300009184 | Freshwater Lake | FPDFQAAQHLWSVDGTRKWAAGTDWFYTIDERPE* |
Ga0114967_103259811 | 3300010160 | Freshwater Lake | GVTKFPDFKAAQTIFTVDGTRKWSTGDDWFYTIEEKE* |
Ga0136644_100327986 | 3300010334 | Freshwater Lake | IPSETKFPDFQAAKRLWTVDGTRKWSAGDDWFYDIKEKV* |
Ga0133913_110657861 | 3300010885 | Freshwater Lake | KFPDFQAAQTFYTVDGTRKWSAGDDWFYEIKEKNSD* |
Ga0133913_132193131 | 3300010885 | Freshwater Lake | WYDQSLIPADVKFPDFQAAKDFYTVDGTRKWSAGDDWFYSIEEKTA* |
Ga0139556_10236541 | 3300011011 | Freshwater | SLVPAQTKFPDFQAAQHLWSVDGTRKWSAGDDWFYTIEEKHD* |
Ga0153799_10439213 | 3300012012 | Freshwater | DQSLIPAETKFPDFQAAQKLWTVDGTRKWSAGQDWFYDITEKNS* |
Ga0153805_10794852 | 3300012013 | Surface Ice | QSLVPSETKFPDFQAAQHLWSVDGSRKWAAGTDWFYTIDERPE* |
Ga0157137_1049495 | 3300012286 | Freshwater | DQSLVPAETKYPDFQAAKRLWSVDGTRKWSAGEDWFYDIKEKEE* |
Ga0164293_110325042 | 3300013004 | Freshwater | LIPAEVKFPDFQAAKDFYTVDGTRKWSAGDDWFYDIEEKSA* |
(restricted) Ga0172362_105242943 | 3300013133 | Sediment | VKFPDFQAAREIFTVDGSRKWAAGDDWFYTLEERQ* |
Ga0170791_162040131 | 3300013295 | Freshwater | LWYDQSLISGNVKFPDFQAAQTIFAVDGTRKWSAGDDWFYNIEERKE* |
Ga0119960_10207051 | 3300014811 | Aquatic | FPVTIAGYDQSLISGNVKFPDFKAAQTIFTVDGTRKWSAGDDWFYSIEERK* |
Ga0181338_10218521 | 3300015050 | Freshwater Lake | VKFPDFQAAKDFYTVDGTRKWSAGDDWFYDIQEKNS* |
Ga0181338_10363794 | 3300015050 | Freshwater Lake | YDQSLVPAQTKFPDFQAAQHLWSVDGTRKWSAGDDWFYTIEEKHD* |
Ga0181338_10521381 | 3300015050 | Freshwater Lake | LIPSETKFPDFQAAQHLWSVDGTRKWSAGDDWFYTIEEKNE* |
Ga0181338_10691353 | 3300015050 | Freshwater Lake | ETKFPDFQAAQRFWTVDGTRKWSAGDDWFYDFKERNT* |
Ga0181350_10456054 | 3300017716 | Freshwater Lake | FPDFQAAQTFWTVDGTRKWSAGDDWFYDFKERNEIRHP |
Ga0181350_10709745 | 3300017716 | Freshwater Lake | AETKFPDFEAAQRLWTVDGTRKWSTSDNWFYNLQETT |
Ga0181350_10729565 | 3300017716 | Freshwater Lake | DQSLIPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKT |
Ga0181350_10983943 | 3300017716 | Freshwater Lake | CLWYDQSLIPAETKFPDFEAAQKLWTVDGTRKWAAGGDWFYDIQEKT |
Ga0181350_11497541 | 3300017716 | Freshwater Lake | SLIPAETKFPDFQAAKEFWTVDGTRKWSAGDDWFYTLEEKT |
Ga0181350_11498851 | 3300017716 | Freshwater Lake | TKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKAKNA |
Ga0181347_10240196 | 3300017722 | Freshwater Lake | AETKFPDFQAAQTFWTVDGTRKWSAGDDWFYDIKEKNT |
Ga0181347_11900111 | 3300017722 | Freshwater Lake | TKFPDFQAAQTFWTVDGTRKWSAGDDWFYDIKEKTN |
Ga0181362_11189501 | 3300017723 | Freshwater Lake | TKHPDFQAAQTFWTVDGTRKWTTGTDWFYNIEERV |
Ga0181365_10238994 | 3300017736 | Freshwater Lake | CLWYDQSLIPAETKFPDFKAAQQLWTVDGTRKWSAGVDWFYGIQEKNT |
Ga0181365_10837351 | 3300017736 | Freshwater Lake | TKFPDFQAAQRLWTVDGTRKWSAGDDWFYDINEKKD |
Ga0181352_10085571 | 3300017747 | Freshwater Lake | KFPDFQAAQHLWSVDGTRKWSAGDDWFYTIEEKSD |
Ga0181352_10287401 | 3300017747 | Freshwater Lake | KIKFPDFQAARDFYTVDGTRKWAAGGDWFYDIEEKAD |
Ga0181352_10629051 | 3300017747 | Freshwater Lake | SLITSETKFPDFQAAQKFWTVDGTRKWSAGDDWFYSIEEKNA |
Ga0181352_11077232 | 3300017747 | Freshwater Lake | YDQSLIPAEVKFPDFQAAKDFYTVDGTRKWSAGDDWFYNIEEKNAA |
Ga0181344_10805104 | 3300017754 | Freshwater Lake | QSLIPSETKFPDFQAAQRFWTVDGTRKWSAGDDWFYDFKEKT |
Ga0181344_11180303 | 3300017754 | Freshwater Lake | RGKSETKFPDFQAAQRIWTVDGTRKWSAGDDWFYDINEKKD |
Ga0181344_11344394 | 3300017754 | Freshwater Lake | ETKFPDFQAAQTIWTVDGTRKWSAGDDWFYDIAEKNT |
Ga0181344_11924191 | 3300017754 | Freshwater Lake | ETKFPDFQAARRLWTVDGTRKWSAGEDWFYDIQERI |
Ga0181344_11994322 | 3300017754 | Freshwater Lake | MINWPDFQAAKDFYTVDGTRKWSAGDDWFYDIKARND |
Ga0181344_12386691 | 3300017754 | Freshwater Lake | TKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKERKE |
Ga0181356_11128331 | 3300017761 | Freshwater Lake | EERDQSLIPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDLKEKT |
Ga0181356_11934174 | 3300017761 | Freshwater Lake | SQTKFPDFQAAQHLWSVDGTRKWSAGDDWFYTIKEKHD |
Ga0181356_12324991 | 3300017761 | Freshwater Lake | FPDFKAAQTIFTVDGTRKWSAGDDWFYSIDAKNEPG |
Ga0181343_10477283 | 3300017766 | Freshwater Lake | VKFPDFQAAKDFYTVDGTRKWSAGDDWFYDIEEKSA |
Ga0181343_12289783 | 3300017766 | Freshwater Lake | DQSLIPAETKFPDFQAAQRLWTVDGTRKWAAGDDWFYDIEEKT |
Ga0181358_11229891 | 3300017774 | Freshwater Lake | SDQSLIPAETKFPDFQAAKEFWTVDGTRKWSAGDDWFYTIEEKT |
Ga0181358_12563041 | 3300017774 | Freshwater Lake | LWYDQSLIPAETKFPDFQAAKEFWTVDGTRKWSAGDDWFYTIEEKT |
Ga0181357_100041729 | 3300017777 | Freshwater Lake | ADTKWPDFQAARTLWTVDGTRKWSAGDDWFYTIEEKNE |
Ga0181357_10410535 | 3300017777 | Freshwater Lake | WYDQSLIPGETKFPDFQAAKNLWTVDGTRKWSAGNDWFYTIEEKT |
Ga0181357_11388255 | 3300017777 | Freshwater Lake | SLIPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKAKNA |
Ga0181357_11515251 | 3300017777 | Freshwater Lake | KFPDFQAAKDFYTVDGTRKWSAGDDWFYDIEEKSA |
Ga0181357_11806843 | 3300017777 | Freshwater Lake | PADTKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKERT |
Ga0181357_12546221 | 3300017777 | Freshwater Lake | YDQSLIPAEIKFPDFQAAKEFYTVDGTRKWSAGGDWFYDITEKST |
Ga0181357_12790841 | 3300017777 | Freshwater Lake | SLIPNETKFPDFQAARHIWTVDGTRKWTTGTDWFYNIEERT |
Ga0181357_13372103 | 3300017777 | Freshwater Lake | SLIPADTKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKNT |
Ga0181346_11909171 | 3300017780 | Freshwater Lake | CLWYDQSLISGNVKFPDFHAAQTIFTVDGTRKWSAGDDWFYNIEERKE |
Ga0181348_10170611 | 3300017784 | Freshwater Lake | ETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKNK |
Ga0181348_10981925 | 3300017784 | Freshwater Lake | ETKFPDFQAAQHLWSVDGTRKWSAGDDWFYTIEEKSD |
Ga0181348_12234572 | 3300017784 | Freshwater Lake | LPDFKAAQIIFSVDGTRKWTAIGDDWFYSIEERKE |
Ga0181348_12387941 | 3300017784 | Freshwater Lake | PAETKFPDFQAAQTIWTVDGTRKWSAGDDWFYDITEKNT |
Ga0181355_11704121 | 3300017785 | Freshwater Lake | IPAEVKFPDFQAAKDFYTVDGTRKWSAGDDWFYDIEEKSA |
Ga0181355_12210641 | 3300017785 | Freshwater Lake | QSLIPSETKFPDFQAARNIWTVDGTRKWSAGDDWFYTIEEKND |
Ga0181355_12604251 | 3300017785 | Freshwater Lake | RCLWYDQSLVPAETKFPDFQAAQTFWSVDGTRKCSAGDDWFYNIEEKNS |
Ga0181355_12796883 | 3300017785 | Freshwater Lake | CLWYDQSLIPAETKFPDFQAAKEFWTVDGTRKWSAGDDWFYTLEEKT |
Ga0181355_13168061 | 3300017785 | Freshwater Lake | IPAETKFPDFEAAQKLWTVDGTRKWAAGGDWFYDIEEKT |
Ga0181355_13225761 | 3300017785 | Freshwater Lake | WYDQSLIPAETKFPDFEAAQRLWTVDGTRKWSTSDNWFYNLQETT |
Ga0181355_13238073 | 3300017785 | Freshwater Lake | IPAETKFPDFQAAKNFYTVDGTRKWSAGDDWFYDIQEKNT |
Ga0181355_13621042 | 3300017785 | Freshwater Lake | SLIPAETKFPDFQAAQTFWTVDGTRKWFAGDDWFYDFKERNEIRHP |
Ga0181361_1004017 | 3300019783 | Freshwater Lake | LVPSETKFPDFQAAQHLWSVDGTRKWSTGDDWFYTIEEKSD |
Ga0181359_11959161 | 3300019784 | Freshwater Lake | PAETKFPDFQAAKEFWTVDGTRKWSAGDDWFYDIKEKSE |
Ga0211732_11893721 | 3300020141 | Freshwater | YDQSLISGTVKFPDFKAAQTIFTVDGTRKWSAGDDWFYNIEERKE |
Ga0211736_107212171 | 3300020151 | Freshwater | LIPNETKCPDFQASRHIWTVDGTRKWSAGDNWFYNIEERVT |
Ga0211734_110095403 | 3300020159 | Freshwater | CLWYDQSLISGNVKFPDFKAAQTIFTVDGTRKWSAGDDWFYSIEEKNE |
Ga0194127_105127921 | 3300020221 | Freshwater Lake | GLWYDQSLIPSETKTPDFQAAKNFWSVDGTRKWAAGNDWFYDFQERT |
Ga0194117_105025001 | 3300021424 | Freshwater Lake | QSLIPANVKFPDFQAAKNLWSVDGTRKWTAGKDWFYTIDEQ |
Ga0222713_103498021 | 3300021962 | Estuarine Water | TKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKT |
Ga0181353_10166506 | 3300022179 | Freshwater Lake | GYDQSLVPAETKFPDFQAAQTFWSVDGTRKWSAGDDWFYNIEEKNGD |
Ga0181353_10548194 | 3300022179 | Freshwater Lake | QSLIPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKT |
Ga0181354_10076826 | 3300022190 | Freshwater Lake | KFPDFQAAKEFWTVDGTRKWSAGDDWFYDIKEKNE |
Ga0181351_10345241 | 3300022407 | Freshwater Lake | SLIPGETKFPDFQAAKNLWTVDGTRKWSAGNDWFYTIEEKT |
Ga0181351_10965435 | 3300022407 | Freshwater Lake | IPAETKFPDFQAAQRFWTVDGTSKWSAGDDWFYDFKEKT |
Ga0214921_105599682 | 3300023174 | Freshwater | LISGNVKFPDFKAAQTIFTVDGTRKWSAGDDWFYTIEEKNE |
Ga0214919_103730432 | 3300023184 | Freshwater | SNVVKFPDFKAAQTVFTVDGTRKWSAGDNWFYTIDEKNE |
Ga0244775_102441371 | 3300024346 | Estuarine | QSLVPSETKKPDFQAARHIWTVDGSRKWSSGKDWFYDIEKRGEE |
Ga0244775_108271301 | 3300024346 | Estuarine | LIPSETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKERT |
Ga0209864_10584641 | 3300027547 | Sand | IFPDFQASRHIWTVDGSRKWSAGDDWFYDIEAKHE |
Ga0208942_11299762 | 3300027627 | Freshwater Lentic | ETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKTT |
Ga0209297_10891101 | 3300027733 | Freshwater Lake | DQSLISGNVKFPDFQAAQTIFAVDGTRKWSAGDDWFYNIEERKE |
Ga0209087_11315991 | 3300027734 | Freshwater Lake | SFIPAETKFPDFQAAKSLWTVDGTRKWSAGDDWFYDIKEKTT |
Ga0209190_11364623 | 3300027736 | Freshwater Lake | CLWYDQSLIPNEVKFPDFQAAQHRWSVDGTRKWTTSNDWFYTTEEKHD |
Ga0209084_12119001 | 3300027749 | Freshwater Lake | TKFPDFKAAQTIFTVDGTRKWIAGDDWFYSIDEKNE |
Ga0209768_100680237 | 3300027772 | Freshwater Lake | TKFPDFQAAKEFYTVDGTRKWSAGDDWFYDIKEKT |
Ga0209768_101973753 | 3300027772 | Freshwater Lake | DQSLIPAETKFPDFEAAQMIWTVDGSRKWAAGEDWFYDIKEKSE |
Ga0209246_100621702 | 3300027785 | Freshwater Lake | DQSLIPAETKFPDFKAAQQLWTVDGTRKWSAGDDWFYDIQEKNT |
Ga0209246_101066304 | 3300027785 | Freshwater Lake | KFPDFQAARRLWTVDGTRKWSAGDDWFYDIKEKSI |
Ga0209353_102866001 | 3300027798 | Freshwater Lake | LIPAETKFPDFKAAQQFWTVDGTRKWSAGDDWFYDIQEKTI |
Ga0209353_104550671 | 3300027798 | Freshwater Lake | KFPDFQAAQRFWTVDGTRKWSAGDDWFYDFKERNT |
Ga0209550_101726303 | 3300027892 | Freshwater Lake | ETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDINEKKD |
Ga0209400_12499472 | 3300027963 | Freshwater Lake | PSETKFPDFQAAQNLWTVDGTRKWTAGSDWFYSIDETKPD |
Ga0247723_10556615 | 3300028025 | Deep Subsurface Sediment | PSQTMFPDFQAARNIWTVDGSRKWSAGDDWFYNLEERNDNTTENN |
Ga0304730_11186721 | 3300028394 | Freshwater Lake | QSLVPSETKFPDFQAAQHLWSVDGTRKWSAGDDWFYTIEEKND |
(restricted) Ga0247832_11835751 | 3300028557 | Freshwater | AETKFPDFQAAQTFWTVDGTRKWSAGDDWFYDIKEKNA |
(restricted) Ga0247831_10785311 | 3300028559 | Freshwater | IPAETKFPDFQAAQTFWTVDGTRKWSAGDDWFYNIKEKNA |
(restricted) Ga0247844_10922621 | 3300028571 | Freshwater | GNVKFPDFKAAQTIFTVDGTRKWSAGDDWFYTIEGRKE |
(restricted) Ga0247844_11849782 | 3300028571 | Freshwater | LIPANVKFPDFQAAKNLWSVDGTRKWTAGKDWFYSIDEQ |
Ga0119944_100060711 | 3300029930 | Aquatic | DQSLVSPISKSPDFEAAKQFWSVDGTRKWTTSDDWFYDIKERNELP |
Ga0119945_100054614 | 3300029933 | Aquatic | QSLVSPISKSPDFEAAKQFWSVDGTRKWTTSDDWFYDIKERNELP |
Ga0315899_104305041 | 3300031784 | Freshwater | ETKFPDFQAAQRLWTVDGTRKWSAGDDWFYNIEEKKS |
Ga0315908_110424023 | 3300031786 | Freshwater | QSLIPADTKHPDFQAAQTFWTVDGTRKWTTGTDWFYNIEERT |
Ga0315900_103901801 | 3300031787 | Freshwater | DQSLVPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYNIEEKKS |
Ga0315909_104240331 | 3300031857 | Freshwater | AETKFPDFQAARRLWTVDGTRKWSAGDDWFYDIKEKST |
Ga0315285_104992652 | 3300031885 | Sediment | SLIPSDTKFPDFQAAQNLWTVDGTRKWTAGDDWFYDIVERKPDEKNAK |
Ga0315274_108089601 | 3300031999 | Sediment | CLWYDQSLIPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYSIKAKND |
Ga0315274_119444014 | 3300031999 | Sediment | YDQSLIPAEVRFPDFQAAKTFWTVDGTRKWSAGDDWFYNIEERT |
Ga0315289_113215831 | 3300032046 | Sediment | PAETKFPDFKAAQQFWTVDGTRKWSAGDDWFYDIQEKNT |
Ga0315903_106333532 | 3300032116 | Freshwater | WYDQSLISGNVKFPDFKAAQNLWTVDGTRKWTAGDDWFYTIEEKND |
Ga0315277_113002561 | 3300032118 | Sediment | SLIPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDLKEKT |
Ga0334977_0573383_29_172 | 3300033978 | Freshwater | LWYDQSLISGNVKFPDFRAAQTIFTVDGTRKWSAGDDWFYTIEEKNE |
Ga0334992_0049012_2249_2371 | 3300033992 | Freshwater | LIPAETKFPDFEAAQVIWTVDGSRKWAAGENWFYNIEEKM |
Ga0335003_0105315_1_132 | 3300033995 | Freshwater | DQSLVPADTKFPDFQAAQRLWTVDGTRKWSAGDDWFYNIEEKL |
Ga0334979_0154390_1266_1385 | 3300033996 | Freshwater | PADTKFPDFQAAQRLWTVDGTRKWSAGDDWFYNIEEKKS |
Ga0334979_0652223_3_116 | 3300033996 | Freshwater | EVKFPDFQAAKEFYTVDGTRKWAAGDDWFYTIQEKEA |
Ga0334985_0784583_351_473 | 3300034018 | Freshwater | LIPAETKFPDFEAAQAIWTVDGSRKWAAGENWFYDIKEKT |
Ga0334998_0112153_1668_1793 | 3300034019 | Freshwater | LVPADTKFPDFQAAQRLWTVDGTRKWSAGDDWFYNIEEKKT |
Ga0335002_0652161_408_536 | 3300034020 | Freshwater | QSLIPAETKFPNFQAAQTFWTVDGTRKWSAGDDWFYDIKEKK |
Ga0335005_0199110_3_125 | 3300034022 | Freshwater | LIPAEVKFPDFQAAKTFWTVDGTRKWSAGDDWFYNIEERT |
Ga0334983_0195058_1140_1259 | 3300034060 | Freshwater | PAKTDFPDFQASRHIWTVDGSRKWSAGDDWFYDIGERHE |
Ga0334995_0415541_33_143 | 3300034062 | Freshwater | VVKFPDFQAAKTFWTVDGTRKWSAGDDWFYDIKEKT |
Ga0334995_0614909_2_124 | 3300034062 | Freshwater | ETKFPDFQAARSLWTVDGTRKWSAGDDWFYDIKEKNERTI |
Ga0335001_0482109_3_146 | 3300034064 | Freshwater | CLWYDQSLIPAEVKFPDFQAAQTVWTVDGTRKWSAGDDWFYDITERR |
Ga0335010_0075972_8_130 | 3300034092 | Freshwater | MIPAETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKEKT |
Ga0335010_0329442_755_862 | 3300034092 | Freshwater | KFPDFQAAKNFYTVDGTRKWSAGDDWFYDIQEKDA |
Ga0335029_0465442_613_744 | 3300034102 | Freshwater | DQSLVPAEVKQPDFRVATKTYSVDGSRKWSAGEDWFYDIRERV |
Ga0335036_0825542_417_533 | 3300034106 | Freshwater | PAETRFPDFQAAKTIWTVDGTRKWSVGDDWFYNVEERK |
Ga0335036_0892507_366_503 | 3300034106 | Freshwater | WYDQSLIPAETKFPDFQAAQRLWTVDGTRKWAAGDDWFYDIQEKT |
Ga0335033_0549076_1_117 | 3300034117 | Freshwater | AGKTKFPDFQAAQQIYTVDGTRKWSAGDDWFYNIEERE |
Ga0335053_0516445_586_702 | 3300034118 | Freshwater | PAETKFPDFEAAQVIWTVDGSRKWAAGENWFYDIKEKT |
Ga0335058_0485911_577_702 | 3300034121 | Freshwater | SLISGNVKFPDFKAAQTIFTVDGTRKWSAGDDWFYNIEERK |
Ga0335013_0786171_1_114 | 3300034284 | Freshwater | AETKFPDFQAAQRLWTVDGTRKWSAGDDWFYDIKERT |
Ga0335048_0133134_1315_1437 | 3300034356 | Freshwater | LIPAETKFPDFEAAQVIWTVDGSRKWAAGENWFYDIKEKT |
Ga0335048_0445427_1_138 | 3300034356 | Freshwater | LWYDQSLIHQAKFPDFQAAKTIYSVDGTRKWTAGDDWFYSINEHD |
⦗Top⦘ |