NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033018

Metagenome / Metatranscriptome Family F033018

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033018
Family Type Metagenome / Metatranscriptome
Number of Sequences 178
Average Sequence Length 40 residues
Representative Sequence MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Number of Associated Samples 154
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 65.73 %
% of genes near scaffold ends (potentially truncated) 25.28 %
% of genes from short scaffolds (< 2000 bps) 79.21 %
Associated GOLD sequencing projects 148
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.775 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.483 % of family members)
Environment Ontology (ENVO) Unclassified
(21.348 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.438 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.53%    β-sheet: 0.00%    Coil/Unstructured: 51.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 178 Family Scaffolds
PF07369DUF1488 46.07
PF01165Ribosomal_S21 7.30
PF00075RNase_H 6.18
PF00313CSD 3.93
PF08379Bact_transglu_N 1.69
PF04392ABC_sub_bind 1.12
PF05977MFS_3 1.12
PF01636APH 1.12
PF04546Sigma70_ner 1.12
PF00487FA_desaturase 1.12
PF03401TctC 0.56
PF00270DEAD 0.56
PF00271Helicase_C 0.56
PF01936NYN 0.56
PF02195ParBc 0.56
PF05940NnrS 0.56
PF06897DUF1269 0.56
PF07995GSDH 0.56
PF02622DUF179 0.56
PF14534DUF4440 0.56
PF13683rve_3 0.56
PF00905Transpeptidase 0.56
PF02738MoCoBD_1 0.56
PF13505OMP_b-brl 0.56
PF01266DAO 0.56
PF01527HTH_Tnp_1 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 178 Family Scaffolds
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 7.30
COG1305Transglutaminase-like enzyme, putative cysteine proteasePosttranslational modification, protein turnover, chaperones [O] 1.69
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.12
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 1.12
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 1.12
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.12
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 1.12
COG1432NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturationGeneral function prediction only [R] 0.56
COG1678Putative transcriptional regulator, AlgH/UPF0301 familyTranscription [K] 0.56
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.56
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.56
COG3213Nitric oxide response protein NnrSSignal transduction mechanisms [T] 0.56
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.78 %
UnclassifiedrootN/A20.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZN2CUW02H6STKAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium501Open in IMG/M
2199352025|deepsgr__Contig_14841Not Available965Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100328568Not Available503Open in IMG/M
3300000787|JGI11643J11755_11557205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium663Open in IMG/M
3300000956|JGI10216J12902_100697441All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300001686|C688J18823_11115735All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M
3300001991|JGI24743J22301_10064048All Organisms → cellular organisms → Bacteria → Proteobacteria760Open in IMG/M
3300002245|JGIcombinedJ26739_100160831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2123Open in IMG/M
3300002568|C688J35102_120976367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4226Open in IMG/M
3300004062|Ga0055500_10155819Not Available543Open in IMG/M
3300004114|Ga0062593_101027833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria848Open in IMG/M
3300004152|Ga0062386_100387948All Organisms → cellular organisms → Bacteria → Proteobacteria1123Open in IMG/M
3300004152|Ga0062386_100619709All Organisms → cellular organisms → Bacteria → Proteobacteria885Open in IMG/M
3300004153|Ga0063455_100810653Not Available650Open in IMG/M
3300004156|Ga0062589_102062893All Organisms → cellular organisms → Bacteria → Proteobacteria580Open in IMG/M
3300004479|Ga0062595_101307604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300004778|Ga0062383_10224115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales877Open in IMG/M
3300005164|Ga0066815_10080004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium587Open in IMG/M
3300005169|Ga0066810_10087188All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300005179|Ga0066684_10195486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium1306Open in IMG/M
3300005184|Ga0066671_10661663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales677Open in IMG/M
3300005355|Ga0070671_100464338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1087Open in IMG/M
3300005436|Ga0070713_100231806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1679Open in IMG/M
3300005545|Ga0070695_100643554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales836Open in IMG/M
3300005569|Ga0066705_10086917Not Available1836Open in IMG/M
3300005575|Ga0066702_10520228Not Available722Open in IMG/M
3300005576|Ga0066708_10851131All Organisms → cellular organisms → Bacteria → Proteobacteria570Open in IMG/M
3300005598|Ga0066706_10746736Not Available776Open in IMG/M
3300005713|Ga0066905_100994107Not Available739Open in IMG/M
3300005713|Ga0066905_101518994All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300005718|Ga0068866_10003446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6473Open in IMG/M
3300005981|Ga0081538_10152388All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300005983|Ga0081540_1009217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae6807Open in IMG/M
3300006031|Ga0066651_10630800Not Available571Open in IMG/M
3300006038|Ga0075365_10005288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6945Open in IMG/M
3300006046|Ga0066652_101348384All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300006047|Ga0075024_100054819All Organisms → cellular organisms → Bacteria → Proteobacteria1673Open in IMG/M
3300006057|Ga0075026_100696288All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300006057|Ga0075026_100733509All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300006057|Ga0075026_100816306Not Available567Open in IMG/M
3300006576|Ga0074047_12046019All Organisms → cellular organisms → Bacteria → Proteobacteria1343Open in IMG/M
3300006581|Ga0074048_13126719All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300006797|Ga0066659_10140700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1703Open in IMG/M
3300006800|Ga0066660_10088918All Organisms → cellular organisms → Bacteria2153Open in IMG/M
3300006852|Ga0075433_10113671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2402Open in IMG/M
3300006852|Ga0075433_10136080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2184Open in IMG/M
3300006854|Ga0075425_100014240All Organisms → cellular organisms → Bacteria8582Open in IMG/M
3300007788|Ga0099795_10438032All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300009012|Ga0066710_100211872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2769Open in IMG/M
3300009090|Ga0099827_10421284All Organisms → cellular organisms → Bacteria → Proteobacteria1142Open in IMG/M
3300009094|Ga0111539_10062067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4425Open in IMG/M
3300009553|Ga0105249_12756408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium563Open in IMG/M
3300009813|Ga0105057_1017213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium1032Open in IMG/M
3300009840|Ga0126313_10027489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3867Open in IMG/M
3300010036|Ga0126305_10031863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2879Open in IMG/M
3300010037|Ga0126304_10463527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium849Open in IMG/M
3300010040|Ga0126308_10639822All Organisms → cellular organisms → Bacteria → Proteobacteria728Open in IMG/M
3300010041|Ga0126312_11421246All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300010154|Ga0127503_10208223All Organisms → cellular organisms → Bacteria → Proteobacteria1168Open in IMG/M
3300010339|Ga0074046_10087268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2021Open in IMG/M
3300010360|Ga0126372_10337172Not Available1345Open in IMG/M
3300010373|Ga0134128_12151297Not Available614Open in IMG/M
3300010379|Ga0136449_100419698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2363Open in IMG/M
3300010391|Ga0136847_12544594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187856Open in IMG/M
3300010396|Ga0134126_11479989Not Available749Open in IMG/M
3300010396|Ga0134126_12611995All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300010397|Ga0134124_11462481Not Available710Open in IMG/M
3300010864|Ga0126357_1067693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300010865|Ga0126346_1393247Not Available825Open in IMG/M
3300010867|Ga0126347_1006958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300010867|Ga0126347_1066391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300010867|Ga0126347_1464541Not Available514Open in IMG/M
3300011119|Ga0105246_10167342Not Available1680Open in IMG/M
3300011120|Ga0150983_10279270All Organisms → cellular organisms → Bacteria → Proteobacteria889Open in IMG/M
3300011120|Ga0150983_10617777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1481Open in IMG/M
3300011423|Ga0137436_1035149All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300012096|Ga0137389_10327052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1301Open in IMG/M
3300012199|Ga0137383_11108606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium573Open in IMG/M
3300012203|Ga0137399_11010017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales700Open in IMG/M
3300012203|Ga0137399_11023067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales696Open in IMG/M
3300012204|Ga0137374_10015604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8749Open in IMG/M
3300012204|Ga0137374_10020663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7464Open in IMG/M
3300012204|Ga0137374_10021773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7247Open in IMG/M
3300012212|Ga0150985_103615718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6730Open in IMG/M
3300012212|Ga0150985_117796713All Organisms → cellular organisms → Bacteria → Proteobacteria771Open in IMG/M
3300012383|Ga0134033_1043550All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300012389|Ga0134040_1242787All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300012469|Ga0150984_104211309All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300012469|Ga0150984_106827344All Organisms → cellular organisms → Bacteria → Proteobacteria1201Open in IMG/M
3300012469|Ga0150984_121830977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1180Open in IMG/M
3300012915|Ga0157302_10135491All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300012917|Ga0137395_10091148All Organisms → cellular organisms → Bacteria → Proteobacteria2008Open in IMG/M
3300012986|Ga0164304_10354504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1026Open in IMG/M
3300013102|Ga0157371_11338249All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300013306|Ga0163162_11353677All Organisms → cellular organisms → Bacteria → Proteobacteria809Open in IMG/M
3300014501|Ga0182024_10308236All Organisms → cellular organisms → Bacteria → Proteobacteria2088Open in IMG/M
3300014745|Ga0157377_11112162All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300014965|Ga0120193_10098249Not Available509Open in IMG/M
3300015201|Ga0173478_10020143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1885Open in IMG/M
3300015201|Ga0173478_10791702Not Available519Open in IMG/M
3300015245|Ga0137409_10944868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces afghaniensis → Streptomyces afghaniensis 772699Open in IMG/M
3300015371|Ga0132258_10230779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4509Open in IMG/M
3300015371|Ga0132258_10344477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3683Open in IMG/M
3300015372|Ga0132256_101908265All Organisms → cellular organisms → Bacteria → Proteobacteria701Open in IMG/M
3300016341|Ga0182035_10685354Not Available892Open in IMG/M
3300016422|Ga0182039_11409202Not Available633Open in IMG/M
3300018027|Ga0184605_10013162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3212Open in IMG/M
3300018054|Ga0184621_10129077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales906Open in IMG/M
3300018056|Ga0184623_10200657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium917Open in IMG/M
3300018062|Ga0187784_11497890Not Available534Open in IMG/M
3300018067|Ga0184611_1016111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2235Open in IMG/M
3300018071|Ga0184618_10257198Not Available739Open in IMG/M
3300018081|Ga0184625_10399433All Organisms → cellular organisms → Bacteria → Proteobacteria709Open in IMG/M
3300018429|Ga0190272_12035523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales609Open in IMG/M
3300018431|Ga0066655_10367331All Organisms → cellular organisms → Bacteria → Proteobacteria947Open in IMG/M
3300018469|Ga0190270_12529961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium575Open in IMG/M
3300018481|Ga0190271_10415393All Organisms → cellular organisms → Bacteria → Proteobacteria1443Open in IMG/M
3300019263|Ga0184647_1072869All Organisms → cellular organisms → Bacteria → Proteobacteria737Open in IMG/M
3300019356|Ga0173481_10222658Not Available832Open in IMG/M
3300019767|Ga0190267_10130193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1062Open in IMG/M
3300019889|Ga0193743_1186529All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300020002|Ga0193730_1068782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1010Open in IMG/M
3300021180|Ga0210396_11162330Not Available647Open in IMG/M
3300021401|Ga0210393_10110234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2196Open in IMG/M
3300021420|Ga0210394_10808898All Organisms → cellular organisms → Bacteria → Proteobacteria818Open in IMG/M
3300025900|Ga0207710_10028299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2433Open in IMG/M
3300025904|Ga0207647_10769959Not Available520Open in IMG/M
3300025915|Ga0207693_10046342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3415Open in IMG/M
3300025920|Ga0207649_11580184All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300025931|Ga0207644_10364326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1176Open in IMG/M
3300025986|Ga0207658_10300535All Organisms → cellular organisms → Bacteria → Proteobacteria1382Open in IMG/M
3300026215|Ga0209849_1075877All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300026552|Ga0209577_10041424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3942Open in IMG/M
3300026557|Ga0179587_10221384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1204Open in IMG/M
3300027273|Ga0209886_1011425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1286Open in IMG/M
3300027625|Ga0208044_1079670All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300027703|Ga0207862_1223936All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300027812|Ga0209656_10066762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1972Open in IMG/M
3300027812|Ga0209656_10418851All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300027824|Ga0209040_10029586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae3479Open in IMG/M
3300027866|Ga0209813_10113608All Organisms → cellular organisms → Bacteria → Proteobacteria936Open in IMG/M
3300027882|Ga0209590_10069873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2019Open in IMG/M
3300027905|Ga0209415_10015696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales12249Open in IMG/M
3300027907|Ga0207428_10084660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2470Open in IMG/M
3300027907|Ga0207428_10864541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales640Open in IMG/M
3300027908|Ga0209006_10190185Not Available1787Open in IMG/M
3300027915|Ga0209069_10082936All Organisms → cellular organisms → Bacteria → Proteobacteria1533Open in IMG/M
3300028379|Ga0268266_11571202Not Available633Open in IMG/M
3300028577|Ga0265318_10397217Not Available504Open in IMG/M
3300028710|Ga0307322_10240149Not Available502Open in IMG/M
3300028712|Ga0307285_10042693All Organisms → cellular organisms → Bacteria → Proteobacteria1115Open in IMG/M
3300028712|Ga0307285_10136244All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300028713|Ga0307303_10061825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria811Open in IMG/M
3300028782|Ga0307306_10106992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales750Open in IMG/M
3300028793|Ga0307299_10202529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales746Open in IMG/M
3300028793|Ga0307299_10296465Not Available607Open in IMG/M
3300028807|Ga0307305_10097767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1356Open in IMG/M
3300028810|Ga0307294_10356056All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300028876|Ga0307286_10235094Not Available669Open in IMG/M
3300031091|Ga0308201_10095549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales848Open in IMG/M
3300031198|Ga0307500_10059454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales944Open in IMG/M
3300031226|Ga0307497_10031361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1735Open in IMG/M
3300031247|Ga0265340_10010344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4991Open in IMG/M
3300031247|Ga0265340_10419250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales590Open in IMG/M
3300031446|Ga0170820_12748131All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300031576|Ga0247727_10886592Not Available628Open in IMG/M
3300031720|Ga0307469_10092351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2095Open in IMG/M
3300031720|Ga0307469_10579587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales999Open in IMG/M
3300031740|Ga0307468_100116835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1631Open in IMG/M
3300031740|Ga0307468_100779202Not Available812Open in IMG/M
3300031879|Ga0306919_10341946Not Available1142Open in IMG/M
3300031942|Ga0310916_10087690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2474Open in IMG/M
3300031946|Ga0310910_11152326All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300032001|Ga0306922_10771723All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300032013|Ga0310906_11009143All Organisms → cellular organisms → Bacteria → Proteobacteria598Open in IMG/M
3300032035|Ga0310911_10298611Not Available927Open in IMG/M
3300034268|Ga0372943_0029485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2971Open in IMG/M
3300034820|Ga0373959_0144321All Organisms → cellular organisms → Bacteria → Proteobacteria598Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.37%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.37%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.25%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.25%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.81%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.81%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.69%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.12%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.12%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.12%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.12%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.12%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.12%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.56%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.56%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.56%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.56%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.56%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.56%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.56%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.56%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.56%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.56%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.56%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.56%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004062Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009813Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010864Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010865Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012383Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027273Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_030387002170459003Grass SoilMTQPAISRILVGPYGLHAFGAAVLVLFLAFLWVFN
deepsgr_024355502199352025SoilMAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
INPhiseqgaiiFebDRAFT_10032856823300000364SoilMAHEAISRVLVGPYGLHAFAAGVLALFAVFLWIFNFTSFF*
JGI11643J11755_1155720523300000787SoilMAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTFF*
JGI10216J12902_10069744113300000956SoilMAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFT
C688J18823_1111573513300001686SoilMGQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF*
JGI24743J22301_1006404823300001991Corn, Switchgrass And Miscanthus RhizosphereMAQAALSRXLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
JGIcombinedJ26739_10016083123300002245Forest SoilMEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF*
C688J35102_12097636733300002568SoilMASTAASKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF*
Ga0055500_1015581913300004062Natural And Restored WetlandsMAQAAISRVLIGPYGLHAFGIALLVLFAVFLWVFNFTHFFGGGAS*
Ga0062593_10102783323300004114SoilMAQTAFARILVGPYGLHAVLGVMLALFVAFLWVFNFTTFF*
Ga0062386_10038794823300004152Bog Forest SoilMGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF*
Ga0062386_10061970923300004152Bog Forest SoilMGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTAFF*
Ga0063455_10081065313300004153SoilMAQAALARILIGPYGLHAFIGVMLALFAAFLWVFNFTTFF*
Ga0062589_10206289323300004156SoilMAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF*
Ga0062595_10130760423300004479SoilMAQAAISRVLIGPYGLHAFGITLLVLFAVFLWAFNFTHFFGGGAF*
Ga0062383_1022411533300004778Wetland SedimentMEQSATARILIGPYGLHGFSIVALVLFLLFLWAFNFTSFF*
Ga0066815_1008000423300005164SoilMAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF*
Ga0066810_1008718823300005169SoilMAQAALSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF*
Ga0066684_1019548623300005179SoilMARSAASRVLVGPHGLHAFGLAAIAGLIVFLWIFNFTNFF*
Ga0066671_1066166333300005184SoilMEQSAIARILVGPYGLHAFGFVVLSFFLAFLWVFNFTAFF*
Ga0070671_10046433813300005355Switchgrass RhizosphereMAQTALARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF*
Ga0070713_10023180633300005436Corn, Switchgrass And Miscanthus RhizosphereMAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0070695_10064355423300005545Corn, Switchgrass And Miscanthus RhizosphereMAQETIARTLVGPYGLHLFGAALLLMFIGFLVVFNFTNFF*
Ga0066705_1008691733300005569SoilMEHSGSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF*
Ga0066702_1052022813300005575SoilMEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTTFF*
Ga0066708_1085113123300005576SoilMCAMEQSAIARVLVGPYGLHAFGFVVLGFFLAFLWVFNFTTFF*
Ga0066706_1074673623300005598SoilMEHSDSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF*
Ga0066905_10099410713300005713Tropical Forest SoilSTASRILVGPYGLHAFGFVVLAFFPPFLWVFNFTSFF*
Ga0066905_10151899423300005713Tropical Forest SoilMQQAALARILSGPFGLHAAGIVTLALFALFLWAFNFTTFF*
Ga0068866_1000344653300005718Miscanthus RhizosphereMAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0081538_1015238823300005981Tabebuia Heterophylla RhizosphereMPQATLSRLLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF*
Ga0081540_100921763300005983Tabebuia Heterophylla RhizosphereMQQAALTRILGRPFGLHAAGIVMLALFALFLWAFNFTTFF*
Ga0066651_1063080023300006031SoilMASTAASRLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFC*
Ga0075365_1000528813300006038Populus EndosphereMAQAALSRILVGPYGLHAFIAVMLAFFIAFLWVFNFTTFF*
Ga0066652_10134838423300006046SoilMASTAASRLLIGPYGLHAVVAVVLALFLGFLWLFNFTSFF*
Ga0075024_10005481923300006047WatershedsMENSAVARILVGPYGLHAFGAVVLSLFLAFLWVFNFTSFF*
Ga0075026_10069628823300006057WatershedsMAQAAISRVLIGPYGLHAFGFTLLALFAVFLWLFNFTHFFGGGAS*
Ga0075026_10073350913300006057WatershedsMMMSETCAMTQAVASRMRIGRYGLRAFGAVVLALFLAFLWVFNFTTFF*
Ga0075026_10081630623300006057WatershedsMAQAAISRVLIGPYGLHAFGIALLVLFAVFLWVFNFTHFFGGGAF*
Ga0074047_1204601913300006576SoilAMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0074048_1312671923300006581SoilLSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF*
Ga0066659_1014070013300006797SoilMEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF*
Ga0066660_1008891813300006800SoilMEQSAIARVLVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF*
Ga0075433_1011367123300006852Populus RhizosphereMQSGTLSRVFVGPFGLHAFGIVVLALFALFLWAFNFTTFF*
Ga0075433_1013608033300006852Populus RhizosphereMAQTALARILVGPYGLHAFLGVMLALFLAFLWVFNFTTFF*
Ga0075425_10001424073300006854Populus RhizosphereMQSGTLTRVFIGPFGLHAFGIVVLALFALFLWAFNFTTFF*
Ga0099795_1043803233300007788Vadose Zone SoilMAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF*
Ga0066710_10021187283300009012Grasslands SoilMEHSDSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF
Ga0099827_1042128423300009090Vadose Zone SoilMEQSAASRMLIGPYGLHAFGAVLLIFFLAFLWVFNFTNFF*
Ga0111539_1006206733300009094Populus RhizosphereMTIAALARILVGPGGLHAFGAVTLALFLAFLWFFNFTAFF*
Ga0105249_1275640823300009553Switchgrass RhizosphereMEQSAVSRILIGPYGLHAFGFGGLVVFVIFLWIFNFTKFF*
Ga0105057_101721323300009813Groundwater SandMERSATSIFIGPYGLHGFGIVALVFFLVFLWAFNFTTFF*
Ga0126313_1002748953300009840Serpentine SoilMPEAALSRFLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF*
Ga0126305_1003186323300010036Serpentine SoilMPEATLSRSLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF*
Ga0126304_1046352723300010037Serpentine SoilMAPSVFSRVLVGPNGIHALGFVLLALFLAFIWIFNFTSFF*
Ga0126308_1063982223300010040Serpentine SoilMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0126312_1142124613300010041Serpentine SoilVMPEATLSRSLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF*
Ga0127503_1020822323300010154SoilMTQAVASRMLVGRYGLRAFGAVVLALFLAFLWVFNFTTFF*
Ga0074046_1008726823300010339Bog Forest SoilLKLLGPAASMGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF*
Ga0126372_1033717213300010360Tropical Forest SoilLSRVFIGPFGLHAFGFVVLALFALFLWAFNFTTFF*
Ga0134128_1215129723300010373Terrestrial SoilMRAMTQMAASRILIGPYGLHAFVVAVLVLFLGFLWLFNFTTFF*
Ga0136449_10041969823300010379Peatlands SoilMAESAVSRILVGPYGLHAFGAVALVLFFIFLWAFNFTTFF*
Ga0136847_1254459423300010391Freshwater SedimentSRIFVGPYGLHAVSLAMLFLFLGFLWVFNFTSFF*
Ga0134126_1147998913300010396Terrestrial SoilMPALTQMAVSRILIGPYGLHAFVVAVLVLFLGFLWLFNFTTFF*
Ga0134126_1261199513300010396Terrestrial SoilMAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFC*
Ga0134124_1146248113300010397Terrestrial SoilARPMESSATARILIGPYGLHAFGLILLSLFLGFLWVFNFTTFFGGSAVITQ*
Ga0126357_106769323300010864Boreal Forest SoilMAQATIARTLAGPYGLHVWGTALVALFVGFLVVFNFTNFF*
Ga0126346_139324733300010865Boreal Forest SoilMTQATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF*
Ga0126347_100695823300010867Boreal Forest SoilMAQATIARALVGPYGLHAVGAVLLVLFVGFLAVFNFTNFF*
Ga0126347_106639133300010867Boreal Forest SoilMAQATIARTLAGPYGLHVWGAALVALFVGFLVVFNFTNFF*
Ga0126347_146454123300010867Boreal Forest SoilMTQATIAKTLVGPYGLHAVGAALVALFVGFLVEIS
Ga0105246_1016734213300011119Miscanthus RhizosphereMAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTF
Ga0150983_1027927033300011120Forest SoilMDNQAMEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF*
Ga0150983_1061777743300011120Forest SoilASRILVGPYGLHAFGLVVLTFFVVFLWVFNFTSFF*
Ga0137436_103514913300011423SoilMEQTAIARILVGPYGLHAFGFVVLGFFLMFLWVFNFTAFF*
Ga0137389_1032705233300012096Vadose Zone SoilMEQTAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF*
Ga0137383_1110860623300012199Vadose Zone SoilMEHSATSRILIGPYGLHAFGFAVFAFFLIFLWVFNFTKF
Ga0137399_1101001733300012203Vadose Zone SoilARILVGPYGLHAAGFVMLGFFLAFLWVFNFTTFF*
Ga0137399_1102306713300012203Vadose Zone SoilALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF*
Ga0137374_1001560433300012204Vadose Zone SoilMWPATSRILIGPYGLHGFAIVTLLFFLVFLWAFNFTSFF*
Ga0137374_1002066363300012204Vadose Zone SoilMGQTNMNQILVGPYGLHAFLGVALALFLGFLYVFNFTAFF*
Ga0137374_1002177343300012204Vadose Zone SoilMEPSAISRTLVGPFGLHAFGGVVLALFLVFLWVFNFTNFF*
Ga0150985_10361571833300012212Avena Fatua RhizosphereMASTAVSKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF*
Ga0150985_11779671313300012212Avena Fatua RhizosphereMGAMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFKFTPFF*
Ga0134033_104355023300012383Grasslands SoilMRAMTQAAVTRMLIGPYGLHAFLAFLLALFVGFLWLFNFTTFF*
Ga0134040_124278723300012389Grasslands SoilMRAMTQAAVTRRLIGPYGLHAFLAFLLALFVGFLWLFNFTTFF*
Ga0150984_10421130923300012469Avena Fatua RhizosphereMAQAALSRLLIGPYGLHALIGVMLALFVAFLWVFNFTTFF*
Ga0150984_10682734443300012469Avena Fatua RhizosphereMAQAALARFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0150984_12183097713300012469Avena Fatua RhizosphereMAQAALSRILVGPYGLHAFIAVMLALFIAFLWVFNFTTFF*
Ga0157302_1013549123300012915SoilDRMRAMTQMAVSRILIGPYGLHAFVATVLVLFLGFLWLFNFTTFF*
Ga0137395_1009114833300012917Vadose Zone SoilMCTMEQSAVARILVGPYGLHAAGFVMLGFFLAFLWAFNFTTFF*
Ga0164304_1035450413300012986SoilAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF*
Ga0157371_1133824913300013102Corn RhizosphereQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF*
Ga0163162_1135367733300013306Switchgrass RhizosphereMAQTAFARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF*
Ga0182024_1030823623300014501PermafrostMENSAVSRILVGPYGLHAFGLVLLTFFVVFLWVFNFTSFF*
Ga0157377_1111216223300014745Miscanthus RhizosphereMGAMAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0120193_1009824923300014965TerrestrialMRAMQPATLSRILAGPFVLRAMAAAALALFAAFLWIFNFTTFF*
Ga0173478_1002014333300015201SoilMAQAALSRLLIGPYGLHAFIGVMLALFVTFLWVFNFTTFF*
Ga0173478_1079170223300015201SoilMAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFT
Ga0137409_1094486813300015245Vadose Zone SoilMEQTAIARILVGPYGLHAFGLGMLTLFVAFLWVFNFTSFF*
Ga0132258_1023077933300015371Arabidopsis RhizosphereMAQIEASRILIGPYGLYAFVAAVLLFFLGFLWVFNFTTFF*
Ga0132258_1034447723300015371Arabidopsis RhizosphereMQIALSRILIGPYGLHAFAAVALTLFLGFLWVFNFTTFF*
Ga0132256_10190826523300015372Arabidopsis RhizosphereMQPGTLSRFFIGPFGLHAFGFGVLALFALFLWAFNFTTFF*
Ga0182035_1068535423300016341SoilMTQTAISRILIGPYGLHALVAAVLVLFLGFLWVFNFTTFF
Ga0182039_1140920213300016422SoilMAQTAISRILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF
Ga0184605_1001316223300018027Groundwater SedimentMAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF
Ga0184621_1012907723300018054Groundwater SedimentMAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTSDAADA
Ga0184623_1020065713300018056Groundwater SedimentMAQADIARMLIGPYGLHAFLGIFAILFLAFLWVFNFTTFF
Ga0187784_1149789033300018062Tropical PeatlandMGQTAVSRILIGPYGLYAFIAIVLLLFLGFLWVFNF
Ga0184611_101611153300018067Groundwater SedimentMAQAALARFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0184618_1025719813300018071Groundwater SedimentMAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTT
Ga0184625_1039943323300018081Groundwater SedimentMGCAMPEATLSRLLIGPFGLHAFIAAALILFAGFLWVFNFTNFF
Ga0190272_1203552323300018429SoilMENIAMAPAIASSILGPYGLHAFGAVAVVLFLAFLWVFNFTSFF
Ga0066655_1036733123300018431Grasslands SoilMASTAASKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF
Ga0190270_1252996113300018469SoilMGARAMSQSAVSRILVGPHGMHAVGALVLALFLAFLWAFNFTSFF
Ga0190271_1041539343300018481SoilMEQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0184647_107286913300019263Groundwater SedimentMAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0173481_1022265823300019356SoilMAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTFF
Ga0190267_1013019313300019767SoilMAQAALARILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0193743_118652913300019889SoilMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0193730_106878233300020002SoilMAQAALSKILVGPYGLHAFIAVMLGLFAAFLWVFNFTTFF
Ga0210396_1116233023300021180SoilMENSAASRILVGPYGLHAFGLVLLTFFAVFLWAFNFTNFF
Ga0210393_1011023413300021401SoilMENSAASRILVGPYGLHAFGLVLLTFFVVFLWVFNFTSFF
Ga0210394_1080889813300021420SoilMENSAASRILVGPYGLHAFGLVLLTSFVVFLWVFNFTSFF
Ga0207710_1002829913300025900Switchgrass RhizosphereAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0207647_1076995923300025904Corn RhizosphereMAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNF
Ga0207693_1004634253300025915Corn, Switchgrass And Miscanthus RhizosphereMAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0207649_1158018423300025920Corn RhizosphereLSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0207644_1036432633300025931Switchgrass RhizosphereMAQTALARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF
Ga0207658_1030053513300025986Switchgrass RhizosphereQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0209849_107587723300026215SoilMESSAISRILVGPCGLHAFGLVLLSFFIVFLWVFNFTNFF
Ga0209577_1004142423300026552SoilMEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF
Ga0179587_1022138433300026557Vadose Zone SoilMAQAAIARVLVGPYGLHAFGAVLLLLFVGFLVVFNFTSFF
Ga0209886_101142513300027273Groundwater SandMERSATSIFIGPYGLHGFGIVALVFFLVFLWAFNFTTFF
Ga0208044_107967013300027625Peatlands SoilMAESAVSRILVGPYGLHAFGAVALVLFFIFLWAFNFTTFF
Ga0207862_122393613300027703Tropical Forest SoilAMAPEAISRVLVGPYGLHAFAAAVLALFAVFLWVFNFTNFF
Ga0209656_1006676233300027812Bog Forest SoilMGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTTFF
Ga0209656_1041885113300027812Bog Forest SoilMGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF
Ga0209040_1002958663300027824Bog Forest SoilMGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTAFF
Ga0209813_1011360823300027866Populus EndosphereMAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF
Ga0209590_1006987333300027882Vadose Zone SoilMNQILVGPYGLHAFLGVALALFLGFLYVFNFTTFF
Ga0209415_1001569663300027905Peatlands SoilMAESAVSRILVGPYGLHAFGAVALVLFFTFLWAFNFTTFF
Ga0207428_1008466033300027907Populus RhizosphereMTIAALARILVGPGGLHAFGAVTLALFLAFLWFFNFTAFF
Ga0207428_1086454123300027907Populus RhizosphereMQSGTLTRVFIGPFGLHAFGIVVLALFALFLWAFNFTTFF
Ga0209006_1019018543300027908Forest SoilMEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF
Ga0209069_1008293633300027915WatershedsMENSAVARILVGPYGLHAFGAVVLSLFLAFLWVFNFTSFF
Ga0268266_1157120223300028379Switchgrass RhizosphereMAQAALARILIGPYGLHAFIGVMLALFAAFLWVFNFTTFF
Ga0265318_1039721723300028577RhizosphereQATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF
Ga0307322_1024014913300028710SoilMAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNF
Ga0307285_1004269333300028712SoilMAQAALSRILVGPYGLHAFVAVTLALFVAFLLVFNFTTFF
Ga0307285_1013624433300028712SoilAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0307303_1006182513300028713SoilMAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTF
Ga0307306_1010699213300028782SoilAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF
Ga0307299_1020252913300028793SoilAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF
Ga0307299_1029646513300028793SoilMAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFT
Ga0307305_1009776743300028807SoilNQGGMGAMAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Ga0307294_1035605623300028810SoilAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Ga0307286_1023509413300028876SoilMAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNF
Ga0308201_1009554913300031091SoilMAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNCTTVF
Ga0307500_1005945433300031198SoilVSLAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Ga0307497_1003136143300031226SoilLSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Ga0265340_1001034463300031247RhizosphereMTQATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF
Ga0265340_1041925023300031247RhizosphereMAQATIARTLVGPYGLHVAGAALVALFAGFLYVFNFTNFF
Ga0170820_1274813113300031446Forest SoilMAQAALSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF
Ga0247727_1088659223300031576BiofilmMERSAAARLFIGPYGLHGFSIVALLVFLVFLWAFNFTSFF
Ga0307469_1009235163300031720Hardwood Forest SoilMTQSAVSRIFVGPYGLRAFGIVVLTPFVTFLWAFNFTNFF
Ga0307469_1057958723300031720Hardwood Forest SoilMTRSAVSRIFVGPYGLHAFGIVVLTLLVTFVWAFNFTNFF
Ga0307468_10011683523300031740Hardwood Forest SoilMTRSAVSRIFVGPYGLRAFGIVVLTLFVTFLWAFNFTNFF
Ga0307468_10077920223300031740Hardwood Forest SoilMQQADMARILIGPFGLHAAGIVMLALFALFLWAFNFTTFF
Ga0306919_1034194613300031879SoilMTQTAISGILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF
Ga0310916_1008769053300031942SoilMAQTTVSKTLVGPYGLHAFLVVLLVLFLGFLWLFNFTTFF
Ga0310910_1115232613300031946SoilMKQSTASRILVGPYGLHPFGFVVLAFFLAFLWVFN
Ga0306922_1077172343300032001SoilTTVSKTLVGPYGLHAFLVVLLVLFLGFLWLFNFTTFF
Ga0310906_1100914313300032013SoilMAQTALARILVGPYGLHAFLGVMLALFLAFLWVFNFTTFF
Ga0310911_1029861123300032035SoilMTQTAISRILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF
Ga0372943_0029485_852_9743300034268SoilMQQSAAAKIMVGPYGLHAFGLLVLAVFTTFLWLFNFTTFF
Ga0373959_0144321_167_2983300034820Rhizosphere SoilMGAMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.